Carbon-free production of 2-deoxy-scyllo-inosose (DOI) in cyanobacterium Synechococcus elongatus PCC 7942.

Science.gov (United States)

Watanabe, Satoru; Ozawa, Hiroaki; Kato, Hiroaki; Nimura-Matsune, Kaori; Hirayama, Toshifumi; Kudo, Fumitaka; Eguchi, Tadashi; Kakinuma, Katsumi; Yoshikawa, Hirofumi

2018-01-01

Owing to their photosynthetic capabilities, there is increasing interest in utilizing cyanobacteria to convert solar energy into biomass. 2-Deoxy-scyllo-inosose (DOI) is a valuable starting material for the benzene-free synthesis of catechol and other benzenoids. DOI synthase (DOIS) is responsible for the formation of DOI from d-glucose-6-phosphate (G6P) in the biosynthesis of 2-deoxystreptamine-containing aminoglycoside antibiotics such as neomycin and butirosin. DOI fermentation using a recombinant Escherichia coli strain has been reported, although a carbon source is necessary for high-yield DOI production. We constructed DOI-producing cyanobacteria toward carbon-free and sustainable DOI production. A DOIS gene derived from the butirosin producer strain Bacillus circulans (btrC) was introduced and expressed in the cyanobacterium Synechococcus elongatus PCC 7942. We ultimately succeeded in producing 400 mg/L of DOI in S. elongatus without using a carbon source. DOI production by cyanobacteria represents a novel and efficient approach for producing benzenoids from G6P synthesized by photosynthesis.

On fossil Mollusca from the island of Mandul, East-Borneo

NARCIS (Netherlands)

Beets, C.

1950-01-01

This paper presents the results of the examination of a fairly big collection of mollusca from the island of Mandul, north of Tarakan, East-Borneo. The material was collected by Dr. Van Holst Pellekaan while investigating the geology of Mandul in the service of the “Bataafsche Petroleum

Blueprint for a minimal photoautotrophic cell: conserved and variable genes in Synechococcus elongatus PCC 7942

Directory of Open Access Journals (Sweden)

Peretó Juli

2011-01-01

Full Text Available Abstract Background Simpler biological systems should be easier to understand and to engineer towards pre-defined goals. One way to achieve biological simplicity is through genome minimization. Here we looked for genomic islands in the fresh water cyanobacteria Synechococcus elongatus PCC 7942 (genome size 2.7 Mb that could be used as targets for deletion. We also looked for conserved genes that might be essential for cell survival. Results By using a combination of methods we identified 170 xenologs, 136 ORFans and 1401 core genes in the genome of S. elongatus PCC 7942. These represent 6.5%, 5.2% and 53.6% of the annotated genes respectively. We considered that genes in genomic islands could be found if they showed a combination of: a unusual G+C content; b unusual phylogenetic similarity; and/or c a small number of the highly iterated palindrome 1 (HIP1 motif plus an unusual codon usage. The origin of the largest genomic island by horizontal gene transfer (HGT could be corroborated by lack of coverage among metagenomic sequences from a fresh water microbialite. Evidence is also presented that xenologous genes tend to cluster in operons. Interestingly, most genes coding for proteins with a diguanylate cyclase domain are predicted to be xenologs, suggesting a role for horizontal gene transfer in the evolution of Synechococcus sensory systems. Conclusions Our estimates of genomic islands in PCC 7942 are larger than those predicted by other published methods like SIGI-HMM. Our results set a guide to non-essential genes in S. elongatus PCC 7942 indicating a path towards the engineering of a model photoautotrophic bacterial cell.

Age validation and variation in growth, mortality and population structure of Liza argentea and Myxus elongatus (Mugilidae) in two temperate Australian estuaries.

Science.gov (United States)

Kendall, B W; Gray, C A; Bucher, D

2009-12-01

This study investigated variation in the rates of growth and mortality, and age and fork-length (L(F)) compositions of two exploited species of Mugilidae, Liza argentea and Myxus elongatus, in two south-east Australian estuaries (Lake Macquarie and St Georges Basin). An ageing protocol was developed by counting opaque growth zones on sectioned otoliths which was validated by periodically examining the otoliths of captive-reared young-of-the-year fishes, and marginal increment analysis of wild fishes. The maximum recorded age was 17 years for L. argentea and 12 years for M. elongatus, which is greater than generally observed in other species of mugilids. Growth models of each species significantly differed between sexes and, except for male L. argentea, between estuaries. Fishes from Lake Macquarie generally had a greater mean L(F) at age than those from St Georges Basin and females of both species generally attained a greater maximum L(F) and age than males. Gillnet catches of L. argentea were of similar L(F) and age compositions in both estuaries, whereas the age composition of catches of M. elongatus in Lake Macquarie contained a greater proportion of younger fish. Estimates of total, natural and fishing mortality were greater for M. elongatus than L. argentea across both estuaries, and estimates of total mortality were greatest for both species in Lake Macquarie. The data indicate that neither species has been overfished in these estuaries.

Using a Microfluidic Gradient Generator to Characterize BG-11 Medium for the Growth of Cyanobacteria Synechococcus elongatus PCC7942

Directory of Open Access Journals (Sweden)

Chih-Chun Yang

2015-11-01

Full Text Available The photosynthetic cyanobacterium Synechococcus elongatus PCC7942 has recently gained great attention for its ability to directly convert CO2 into renewable chemicals upon genetic engineering. Thus, it is of great interest to increase the growth speed and lower the medium requirement for cultivating this cyanobacterium. The cultivation medium of Synechococcus elongatus PCC7942 has been developed, which consists of many inorganic and metal ingredients with a specific composition, known as the BG-11 medium. In this work, we analyzed the concentration effect of each ingredient and identified the absolutely essential components in BG-11 medium for cyanobacteria growth using the concentration gradient generator chip (CGGC fabricated by MEMS technology. As shown by our results, removal of the individual component sodium nitrate, potassium phosphate, or magnesium sulfate from the BG-11 medium led to severe growth inhibition of Synechococcus elongatus PCC7942. Contrary to our expectation, increasing concentration of the crucial ingredients showed either insignificant or negative impact on cell growth. Overall, standard growth could be achieved without supplementation of ethylenediaminetetraacetic acid (EDTA disodium, sodium carbonate, or sodium citrate to the culture medium. Further improvement of the CGGC-based microfluidic system based on this preliminary study may broaden its application range to analyze more complicated correlations.

Integration of DNA barcoding for the initial recordings of Lessepsian fishes: a case study of the Indo-Pacific slender ponyfish Equulites elongatus.

Science.gov (United States)

Sakinan, S; Karahan, A; Ok, M

2017-03-01

In this study, the DNA barcode of a regional Lessepsian sighting of the slender ponyfish Equulites elongatus is integrated with morphometric and meristic descriptors as a case study to address further identification problems in the Mediterranean Sea. The study also aims to contribute to the regional mitochondrial cytochrome oxidase I information pool, to support other potential uses. The initial sighting of E. elongatus from the north-eastern Mediterranean coast of Turkey is provided from a trawl survey on 3 June 2015, where 76 specimens were captured during a 15 min tow. © 2016 The Fisheries Society of the British Isles.

Accumulation of cesium-137 by useful mollusca

International Nuclear Information System (INIS)

Suzuki, Yuzuru; Nakahara, Motokazu; Nakamura, Ryoichi

1978-01-01

There are few data available on the radioactive contamination of marine mollusca, especially cephalopoda. Therefore, in this paper, data obtained on the radioactive contamination of cephalopoda were compared with those on pelecypoda and gastropoda. The uptake and elimination experiments were carried out by means of radioisotope tracer methods, and the concentration factors of 137 Cs due to radioactive fallout were estimated. The contamination of cephalopoda was also compared with those of other marine organisms in terms of concentration factor. The activity ratios in the organs or tissues of octopus were in the range of 3.5 and 12.8 on the 14th day after the beginning of exposure and those of squid were in the range of 8.8 and 10.9 on the 6th day after the commencement of the experiment. The biological half time was 90 days for octopus from the observation over 75 days, while it was 31 days for clam from the results of 75 days' experiment. The concentration factors of 137 Cs due to radioactive fallout were in the range of 3 and 23 for cephalopoda, 7 and 28 for pelecypoda and 24 and 30 for gastropoda, respectively. It was concluded that no difference in the concentration factors was clearly observable among the classes of mollusca, but the values were substantially similar to those of crustaceans and slightly lower than those of marine fish. (auth.)

Two new species of the Liolaemus elongatus-kriegi complex (Iguania, Liolaemidae) from Andean highlands of southern Chile

Science.gov (United States)

Troncoso-Palacios, Jaime; Díaz, Hugo A.; Esquerré, Damien; Urra, Felix A.

2015-01-01

Abstract The elongatus-kriegi complex is one of the most diverse clades of the Liolaemus (sensu stricto) subgenus of lizards. There are currently 29 species recognized in this group distributed between Chile and Argentina. Based on molecular evidence, there seem to be five main clades nested within this complex: the elongatus, leopardinus, kriegi, petrophilus and punmahuida clades. Liolaemus buergeri and Liolaemus kriegi, both of the kriegi clade, were believed to inhabit the surroundings of the Laja Lagoon, in the Biobío Region of Chile. Moreover, this Chilean population of Liolaemus kriegi was recently recognized as an undescribed taxon called “Liolaemus sp. A” based on molecular phylogenetics. In this work, we studied these two populations of the Laja Lagoon and provided the morphological diagnosis to describe them as two new species: Liolaemus scorialis sp. n. and Liolaemus zabalai sp. n., previously considered Liolaemus buergeri and “Liolaemus kriegi/Liolaemus sp. A” respectively. Additionally, we identified another population of Liolaemus scorialis in the vicinity of La Mula Lagoon in the Araucanía Region of Chile. Liolaemus scorialis differs from almost all of the species of the elongatus-kriegi complex by its considerably smaller size. Nevertheless, without molecular data we cannot assign it to any particular subclade. Liolaemus zabalai belongs to the kriegi clade based on published molecular phylogenies. Finally, we provide some natural history data on both species and we document for the first time the presence of Liolaemus neuquensis in Chile from a museum specimen from La Mula Lagoon. PMID:25987873

MOLLUSCA' BIODIVERSITY (GASTROPODA AND BIVALVIA AS A BIO INDICATOR OF QUALITY OF WATER IN THE COASTAL ISLAND OF TUNDA ISLAND, BANTEN

Directory of Open Access Journals (Sweden)

Indria Wahyuni

2017-07-01

Full Text Available The research has been done on Juli 2017 in the coastal region of Tunda Island. This study aims to determine the Biodiversity of Mollusca (Gastropoda and Bivalvia As Bioindicator of Water Quality In Coastal Area of Tunda Island, Banten. Sampling consists of 2 observation stations, namely the mangrove coastal area (3 transects and the seagrass coastal area (2 transects determined by purposive sampling. The observation of each station is done by using the quadratic transect method with 100 m transect line distance, and in each transect line there are 5 observation plots measuring 1m2 x 1m2. The data analysis includes density, biodiversity, bio-indicators of water quality based on diversity index. Result of research on 5 transect found 45 type Mollusca which represent 2 class, that is Gastropoda class of 29 species Gastropoda joined in 14 Family. As for Bivalvia class found 16 species incorporated in 9 families. The total density of Mollusca is 541.2 ind / m2 which consists of 392.4 ind / m2 for Gastropoda class and 148.8 ind / m2 for Bivalvia class. Mollusca diversity was calculated using the diversity index of Shannon-Wienner (H '. The results of diversity index ranged from 3.1356 - 3.3314 with high category. Bioindicator of aquatic quality using diversity index indicates that the coastal area of Tunda Island belongs to a very mildly polluted category.

Seasonal changes in food quantity and quality of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus: a bioassay approach

DEFF Research Database (Denmark)

Koski, Marja; Dutz, Jörg; Klein Breteler, W.

2010-01-01

We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column of the Mar......We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column...... with the seston from the spring bloom in March-April. The juveniles of both species were able to complete their development only in spring experiments. A multiple regression analyses and comparison to a good-quality standard food of the same concentration suggested that, in an annual scale, the egg production...

On six species of marine Mollusca from suriname, four of which are new

NARCIS (Netherlands)

Regteren, van C.O.

1971-01-01

Four new species are here described in order to have their descriptions published before "Seashells of Wia Wia" by D. J. Green & R. H. Hill and the second part of my paper on the Holocene and Recent marine Mollusca of Suriname will appear. Notes are added on two species for which names are used

A new species of Leporinus Agassiz, 1829 from the upper Rio Paraná basin (Characiformes, Anostomidae with redescription of L. elongatus Valenciennes, 1850 and L. obtusidens (Valenciennes, 1837

Directory of Open Access Journals (Sweden)

Heraldo A. Britski

2012-01-01

Full Text Available Leporinus obtusidens Valenciennes, 1837 and L. elongatus Valenciennes, 1850 are redescribed based on the type specimens, including those of their junior synonyms, and recently collected specimens. Leporinus obtusidens is considered to be widespread, occuring in the river drainages of La Plata, São Francisco, and Parnaíba. Leporinus aguapeiensis Campos, 1945, described from the upper Rio Paraná, and L. silvestrii Boulenger, 1902, described from the Rio Paraguay, are considered junior synonyms of L. obtusidens. Leporinus elongatus is endemic to the Rio Jequitinhonha and Rio Pardo, two eastern Brazilian river basins, and the locality cited for the lectotype, Rio São Fransico, likely to be erroneous. Leporinus crassilabris Borodin, 1929, and L. crassilabris breviceps Borodin, 1929, both described from the Rio Jequitinhonha, are considered junior synynoms of L. elongatus. A new species of Leporinus, endemic to the upper Rio Paraná, very similar and sometimes mistaken with L. obtusidens, is formally described. In addition, comments on Leporinus pachyurus Valenciennes, 1850 and on L. bimaculatus Castelnau, 1855 are provided, and a lectotype for L. bimaculatus is selected.

Morphology, chemistry and function of the postpharyngeal gland in the South American digger wasps Trachypus boharti and Trachypus elongatus.

Directory of Open Access Journals (Sweden)

Gudrun Herzner

Full Text Available Microbes pose severe threats to animals as competitors or pathogens and strongly affect the evolution of life history traits like parental care. Females of the European beewolf Philanthus triangulum, a solitary digger wasp, provision their offspring with paralyzed honeybees and embalm them with the secretion from large postpharyngeal glands (PPG that contain mainly unsaturated hydrocarbons. This coating changes the physico-chemical properties of the prey surface, causes a reduction of water condensation and retards growth of mold fungi. Here we examined the closely related South American genus Trachypus, which shows a life-history similar to Philanthus. We investigated whether Trachypus spp. also possess PPGs and embalm larval provisions. Using histological methods and 3D reconstructions we show that Trachypus boharti and T. elongatus possess PPGs that are similar to P. triangulum but somewhat smaller. The ultrastructure of the gland epithelium suggests that the gland content is at least partly sequestered from the hemolymph. Chemical analyses using gas chromatography / mass spectrometry revealed that both the cuticle and PPGs of Trachypus contain mainly unsaturated long-chain hydrocarbons. The gland of T. boharti additionally contains long-chain ketones. The hydrocarbons from the PPG of T. elongatus occurred on prey bees excavated from nests in the field but not on conspecific control bees. While the embalming only slightly elevated the amount of hydrocarbons on prey bees, the proportion of unsaturated hydrocarbons, which is crucial for the antifungal effect, was significantly increased. The Trachypus species under study possess PPGs that are very similar to the PPG of P. triangulum with regard to morphology, ultrastructure and chemistry. Moreover, we provide clear evidence that T. elongatus females embalm their prey, presumably as a means of prey preservation. The observed differences among Trachypus and Philanthus in gland size and prey

Some fossil species of Babylonia seen in ultraviolet light, with description of a new species (Mollusca, Gastropoda)

NARCIS (Netherlands)

Regteren, van C.O.; Gittenberger, E.

1972-01-01

When preparing a revision of the genus Babylonia for "Indo-Pacific Mollusca", edited by Dr. R. Tucker Abbott, we tried ultraviolet light to see the outline of the colour-pattern of some fossil species. Later on we saw the same method described by Mrs. Katherine Krueger (1971). Dr. H. E. Coomans of

The structure of allophycocyanin from Thermosynechococcus elongatus at 3.5 Å resolution

Energy Technology Data Exchange (ETDEWEB)

Murray, James William; Maghlaoui, Karim; Barber, James, E-mail: j.barber@imperial.ac.uk [Division of Molecular Biosciences, Imperial College, Exhibition Road, London SW7 2AZ (United Kingdom)

2007-12-01

The crystal structure of a light-harvesting protein that interacts with photosystem II is reported. Cyanobacteria and red algae use light-harvesting pigments bound by proteins to capture solar radiation and to channel excitation energy into their reaction centres. In most cyanobacteria, a multi-megadalton soluble structure known as the phycobilisome is a major light-harvesting system. Allophycocyanin is the main component of the phycobilisome core, forming a link between the rest of the phycobilisome and the reaction-centre core. The crystal structure of allophycocyanin from Thermosynechococcus elongatus (TeAPC) has been determined and refined at 3.5 Å resolution to a crystallographic R value of 26.0% (R{sub free} = 28.5%). The structure was solved by molecular replacement using the allophycocyanin structure from Spirulina platensis as the search model. The asymmetric unit contains an (αβ) monomer which is expanded by symmetry to a crystallographic trimer.

Spatial genetic structure and mitochondrial DNA phylogeography of Argentinean populations of the grasshopper Dichroplus elongatus.

Directory of Open Access Journals (Sweden)

Natalia Rosetti

Full Text Available Many grasshopper species are considered of agronomical importance because they cause damage to pastures and crops. Comprehension of pest population dynamics requires a clear understanding of the genetic diversity and spatial structure of populations. In this study we report on patterns of genetic variation in the South American grasshopper Dichroplus elongatus which is an agricultural pest of crops and forage grasses of great economic significance in Argentina. We use Direct Amplification of Minisatellite Regions (DAMD and partial sequences of the cytochrome oxydase 1 (COI mitochondrial gene to investigate intraspecific structure, demographic history and gene flow patterns in twenty Argentinean populations of this species belonging to different geographic and biogeographic regions. DAMD data suggest that, although genetic drift and migration occur within and between populations, measurable relatedness among neighbouring populations declines with distance and dispersal over distances greater than 200 km is not typical, whereas effective gene flow may occur for populations separated by less than 100 km. Landscape analysis was useful to detect genetic discontinuities associated with environmental heterogeneity reflecting the changing agroecosystem. The COI results indicate the existence of strong genetic differentiation between two groups of populations located at both margins of the Paraná River which became separated during climate oscillations of the Middle Pleistocene, suggesting a significant restriction in effective dispersion mediated by females and large scale geographic differentiation. The number of migrants between populations estimated through mitochondrial and DAMD markers suggest that gene flow is low prompting a non-homogeneous spatial structure and justifying the variation through space. Moreover, the genetic analysis of both markers allows us to conclude that males appear to disperse more than females, reducing the chance of the

The study of desiccation-tolerance in drying leaves of the desiccation-tolerant grass Sporobolus elongatus and the desiccation-sensitive grass Sporobolus pyramidalis.

Science.gov (United States)

Ghasempour, Hamid Reza; Kianian, Jahanbakheshe

2007-03-01

Hydrated leaves of the resurrection grass Sporobolus elongatus are not desiccation tolerant (DT), but moderate to severe drought stress can induce their DT with the leaves remain attach to drying intact plants. In vivo protein synthesis was studied with SDS-page of extracts of leaves of intact drying plants of S. elongatus (a desiccation-Tolerant grass (DT)) and S. pyramidalis (a desiccation-sensitive species (DS)). Free proline increased in drying leaves. Soluble sugar contents also increased with drying but were less than fully hydrated leaves at 8% RWC. Total protein also showed an increase with an exception at 8% RWC which showed a decrease. SDS-page of extracts of drying leaves of both DT and DS plants were studied as relative water contents (RWC) decreased. In first phase, DT species at 58% RWC (80-51% RWC range), two proteins increased in contents. In the second phase, at 8% (35-4% RWC range) two new bands increased and two bands decreased. In leaves of DS species some bands decreased as drying progressed. Also, as drying advanced free proline increased in DT species. Total protein increased as drying increased but at 8% RWC decreased. All data of results are consistent with current views about studied factors and their roles during drying and induction of desiccation tolerance in DT plants.

Distribución geográfica, prevalencia e intensidad de las infecciones de Gregarina ronderosi (Eugregarinorida: Gregarinidae en Dichroplus elongatus (Orthoptera: Acrididae

Directory of Open Access Journals (Sweden)

Christian Bardi

2016-01-01

Full Text Available regarina ronderosi es un parásito obligado del tracto digestivo del acrídido plaga Dichroplus elongatus y una de las únicas dos eugregarinas de acrídidos argentinos descriptas con su ciclo de vida completo. Dada la falta de conocimiento acerca de aspectos epizootiológicos fundamentales de las infecci- ones causadas por eugregarinas en acrídidos de Argentina, el objetivo de esta contribución es iniciar el registro de la distribución geográfica de G. ronderosi en la región Pampeana, su prevalencia natural y la intensidad de las infecciones en condiciones naturales. Para ello, se colectaron ejemplares de D. elongatus (2008 – 2012 en distintos puntos de la región Pampeana. Se obtuvieron y analizaron un total de 4084 ejemplares provenientes de cuarenta y dos localidades. La prevalen- cia promedio de G. ronderosi para el total de localidades con presencia (diecisiete localidades fue de 29,7 ± EE 6,6% (n = 1071. El total de individuos infectados (n = 396 fue categorizado respecto de la intensidad de las infecciones: tres (0,8% presentaron infecciones muy fuertes, ochenta (20% fuerte, doscientos diez (53% moderadas y ciento tres (26% infecciones leves. Se ha ampliado la distribución ge- ográfica conocida, se han registrado prevalencias elevadas que sugieren la ocur - rencia de epizootias y se han registrado por primera vez en condiciones naturales infecciones de G. ronderosi categorizadas como Fuertes y Muy Fuertes.

Photoautotrophic production of polyhydroxyalkanoates in a synthetic mixed culture of Synechococcus elongatus cscB and Pseudomonas putida cscAB.

Science.gov (United States)

Löwe, Hannes; Hobmeier, Karina; Moos, Manuel; Kremling, Andreas; Pflüger-Grau, Katharina

2017-01-01

One of the major challenges for the present and future generations is to find suitable substitutes for the fossil resources we rely on today. Cyanobacterial carbohydrates have been discussed as an emerging renewable feedstock in industrial biotechnology for the production of fuels and chemicals, showing promising production rates when compared to crop-based feedstock. However, intrinsic capacities of cyanobacteria to produce biotechnological compounds are limited and yields are low. Here, we present an approach to circumvent these problems by employing a synthetic bacterial co-culture for the carbon-neutral production of polyhydroxyalkanoates (PHAs) from CO 2 . The co-culture consists of two bio - modules : Bio - module I , in which the cyanobacterial strain Synechococcus elongatus cscB fixes CO 2 , converts it to sucrose, and exports it into the culture supernatant; and bio - module II , where this sugar serves as C-source for Pseudomonas putida cscAB and is converted to PHAs that are accumulated in the cytoplasm. By applying a nitrogen-limited process, we achieved a maximal PHA production rate of 23.8 mg/(L day) and a maximal titer of 156 mg/L. We will discuss the present shortcomings of the process and show the potential for future improvement. These results demonstrate the feasibility of mixed cultures of S. elongatus cscB and P. putida cscAB for PHA production, making room for the cornucopia of possible products that are described for P. putida . The construction of more efficient sucrose-utilizing P. putida phenotypes and the optimization of process conditions will increase yields and productivities and eventually close the gap in the contemporary process. In the long term, the co-culture may serve as a platform process, in which P. putida is used as a chassis for the implementation of synthetic metabolic pathways for biotechnological production of value-added products.

Comparative genomics of vesicomyid clam (Bivalvia: Mollusca chemosynthetic symbionts

Directory of Open Access Journals (Sweden)

Girguis Peter R

2008-12-01

Full Text Available Abstract Background The Vesicomyidae (Bivalvia: Mollusca are a family of clams that form symbioses with chemosynthetic gamma-proteobacteria. They exist in environments such as hydrothermal vents and cold seeps and have a reduced gut and feeding groove, indicating a large dependence on their endosymbionts for nutrition. Recently, two vesicomyid symbiont genomes were sequenced, illuminating the possible nutritional contributions of the symbiont to the host and making genome-wide evolutionary analyses possible. Results To examine the genomic evolution of the vesicomyid symbionts, a comparative genomics framework, including the existing genomic data combined with heterologous microarray hybridization results, was used to analyze conserved gene content in four vesicomyid symbiont genomes. These four symbionts were chosen to include a broad phylogenetic sampling of the vesicomyid symbionts and represent distinct chemosynthetic environments: cold seeps and hydrothermal vents. Conclusion The results of this comparative genomics analysis emphasize the importance of the symbionts' chemoautotrophic metabolism within their hosts. The fact that these symbionts appear to be metabolically capable autotrophs underscores the extent to which the host depends on them for nutrition and reveals the key to invertebrate colonization of these challenging environments.

First record of Stibarobdella moorei (Annelida, Hirudinea, Piscicolidae) a marine leech parasitizing Octopus bimaculatus (Mollusca: Octopodidae) from the Mexican Pacific coast

OpenAIRE

López-Peraza D. J.; Hernández-Rodríguez M.; Barón-Sevilla B.; Bückle-Ramírez L. F.; Grano-Maldonado M. I.

2017-01-01

The occurrence of the parasitic marine leech Stibarobdella moorei (Oka, 1910) (Hirudinea: Piscicolidae) along the northwest Mexican Pacific coast is described for the first time. This ectoparasite was collected from the skin of the Octopus bimaculatus (Verril, 1983) (Mollusca: Octopodidae). Stibarobdella loricata (Hardig, 1924) is synonymized with S. moorei as this species resembles other species of the genus based on tubercle patterns and the presence of papillae and a marginal fringe on the...

The mitochondrial genome of the sipunculid Phascolopsis gouldii supports its association with Annelida rather than Mollusca

Energy Technology Data Exchange (ETDEWEB)

Boore, Jeffrey L.; Staton, Joseph

2001-09-01

We have determined the sequence of about half (7470 nts) of the mitochondrial genome of the sipunculid Phascolopsis gouldii, the first representative of this phylum to be so studied. All of the 19 identified genes are transcribed from the same DNA strand. The arrangement of these genes is remarkably similar to that of the oligochaete annelid Lumbricus terrestris. Comparison of both the inferred amino acid sequences and the gene arrangements of a variety of diverse metazoan taxa reveals that the phylum Sipuncula is more closely related to Annelida than to Mollusca. This requires reinterpretation of the homology of several embryological features and of patterns of animal body plan evolution.

ppGpp Controls Global Gene Expression in Light and in Darkness in S. elongatus

Directory of Open Access Journals (Sweden)

Anna M. Puszynska

2017-12-01

Full Text Available The bacterial and plant stringent response involves production of the signaling molecules guanosine tetraphosphate and guanosine pentaphosphate ((pppGpp, leading to global reorganization of gene expression. The function of the stringent response has been well characterized in stress conditions, but its regulatory role during unstressed growth is less studied. Here, we demonstrate that (pppGpp-deficient strains of S. elongatus have globally deregulated biosynthetic capacity, with increased transcription rate, translation rate, and cell size in unstressed conditions in light and impaired viability in darkness. Synthetic restoration of basal guanosine tetraphosphate (ppGpp levels is sufficient to recover transcriptional balance and appropriate cell size in light and to rescue viability in light/dark conditions, but it is insufficient to enable efficient dark-induced transcriptional shutdown. Our work underscores the importance of basal ppGpp signaling for regulation of cyanobacterial physiology in the absence of stress and for viability in energy-limiting conditions, highlighting that basal (pppGpp level is essential in cyanobacteria in the environmental light/dark cycle.

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

Science.gov (United States)

Danchin, Etienne G.J.; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Sokolova (Guzeeva), Elena; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T.

2017-01-01

Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum. PMID:29065523

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes.

Science.gov (United States)

Danchin, Etienne G J; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Guzeeva, Elena Sokolova; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T; den Akker, Sebastian Eves-van

2017-10-23

Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus , representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus , respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

Directory of Open Access Journals (Sweden)

Etienne G.J. Danchin

2017-10-01

Full Text Available Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

Proximate composition, mineral content and fatty acid profile of two marine fishes from Cameroonian coast: Pseudotolithus typus (Bleeker, 1863 and Pseudotolithus elongatus (Bowdich, 1825

Directory of Open Access Journals (Sweden)

J.M. Njinkoue

2016-10-01

Full Text Available Background: Knowledge of chemical composition of fish from Cameroon is poor. The genera Pseudotolithus are nutritionally and economically important in Cameroon. Thus the knowledge on their chemical composition could help in functional food elaboration. Purpose: In this study, Proximate composition, fatty acid profiles and mineral composition were determined in two fish species, Pseudotolithus typus and Pseudotolithus elongatus from Cameroonian coasts. Basic procedure: AOAC standard method was used. Fatty acids were identified by GC/MS as N-acylpyrolidides. Mineral compositions were determined by atomic absorption spectrophotometry for Ca, Na, K, Mg, Fe, Zn, Cu, Mn, and by UV spectrophotometry for phosphorus (P. Main finding: Results indicated that chemical composition was not similar in the two fish species. Results also showed that water is the main constituent in the edible parts and in the bones with 76.17% to 78.24% and 51.21% to 55.28% respectively. Pseudotolithus typus and Pseudotolithus elongatus were good sources of proteins with 16.17% and 13.4% respectively. All the fish analyzed for fat were lean with fat contents less than 0.5%. These species of fish were poor in ω6PUFA and were rich in ω3PUFA with about one third of total fatty acids. The main ω3 fatty acids were eicosapentaenoic acid (EPA and docosahexaenoic acid (DHA. The most abundant main elements were the potassium in the edible parts (1.39% and calcium in the bones (18.26%. The most abundant trace elements were Zn and Fe in the edible parts and in the bones. Principal conclusion: The Na/K ratio values and ω3 fatty acids contents suggest that consumption of these two fish species could be recommended to prevent cardiovascular diseases. Keywords: Proximal composition, Mineral content, Fatty acid profiles, Pseudotolithus typus, Pseudotolithus elongates

CRISPR/Cas9 mediated targeted mutagenesis of the fast growing cyanobacterium Synechococcus elongatus UTEX 2973.

Science.gov (United States)

Wendt, Kristen E; Ungerer, Justin; Cobb, Ryan E; Zhao, Huimin; Pakrasi, Himadri B

2016-06-23

As autotrophic prokaryotes, cyanobacteria are ideal chassis organisms for sustainable production of various useful compounds. The newly characterized cyanobacterium Synechococcus elongatus UTEX 2973 is a promising candidate for serving as a microbial cell factory because of its unusually rapid growth rate. Here, we seek to develop a genetic toolkit that enables extensive genomic engineering of Synechococcus 2973 by implementing a CRISPR/Cas9 editing system. We targeted the nblA gene because of its important role in biological response to nitrogen deprivation conditions. First, we determined that the Streptococcus pyogenes Cas9 enzyme is toxic in cyanobacteria, and conjugational transfer of stable, replicating constructs containing the cas9 gene resulted in lethality. However, after switching to a vector that permitted transient expression of the cas9 gene, we achieved markerless editing in 100 % of cyanobacterial exconjugants after the first patch. Moreover, we could readily cure the organisms of antibiotic resistance, resulting in a markerless deletion strain. High expression levels of the Cas9 protein in Synechococcus 2973 appear to be toxic and result in cell death. However, introduction of a CRISPR/Cas9 genome editing system on a plasmid backbone that leads to transient cas9 expression allowed for efficient markerless genome editing in a wild type genetic background.

Modelling Pseudocalanus elongatus stage-structured population dynamics embedded in a water column ecosystem model for the northern North Sea

Science.gov (United States)

Moll, Andreas; Stegert, Christoph

2007-01-01

This paper outlines an approach to couple a structured zooplankton population model with state variables for eggs, nauplii, two copepodites stages and adults adapted to Pseudocalanus elongatus into the complex marine ecosystem model ECOHAM2 with 13 state variables resolving the carbon and nitrogen cycle. Different temperature and food scenarios derived from laboratory culture studies were examined to improve the process parameterisation for copepod stage dependent development processes. To study annual cycles under realistic weather and hydrographic conditions, the coupled ecosystem-zooplankton model is applied to a water column in the northern North Sea. The main ecosystem state variables were validated against observed monthly mean values. Then vertical profiles of selected state variables were compared to the physical forcing to study differences between zooplankton as one biomass state variable or partitioned into five population state variables. Simulated generation times are more affected by temperature than food conditions except during the spring phytoplankton bloom. Up to six generations within the annual cycle can be discerned in the simulation.

The Histopathology of the Infection of Tilapia rendalli and Hypostomus regani (Osteichthyes by Lasidium Larvae of Anodontites trapesialis (Mollusca, Bivalvia

Directory of Open Access Journals (Sweden)

Ângela Teresa Silva-Souza

2002-04-01

Full Text Available It is described the histopathology of the infection of Tilapia rendalli (Osteichthyes, Perciformes, Cichlidae and Hypostomus regani (Osteichthyes, Siluriformes, Loricariidae by lasidium larvae of Anodontites trapesialis (Mollusca, Bivalvia, Mycetopodidae. The larvae were encysted within the epidermis of the host, being surrounded by a thin hyaline membrane, 3-6 µm thick, of parasite origin. A proliferative host cell reaction did not occur. The histopathology of the infection shows that the lesions induced by the parasites are minimal. However, the numerous small lesions produced by the release of the larvae may provide optimal conditions for the infection by opportunistic pathogens, namely fungus, which may eventually cause the death of the host.

Quitones (Mollusca: Polyplacophora de El Salvador, América Central

Directory of Open Access Journals (Sweden)

Cedar I García-Ríos

2007-03-01

Full Text Available En El Salvador se habían registrado los poliplacóforos Chaetopleura lurida (Sowerby, 1832; Ischnochiton guatemalensis (Thiele, 1910; Ceratozona angusta (Thiele, 1909; Chiton stokesii (Broderip, 1832 y Acantochitona exquisita (Pilsbry, 1893. Recolectamos quitones en aguas someras de El Salvador en julio del 2002, agragando a la lista a Lepidochitona beanii (Carpenter, 1857; Ischnochiton dispar (Sowerby, 1832; Stenoplax limaciformis (Sowerby, 1832; Callistochiton expressus (Carpenter, 1865; Acanthochitona arragonites (Carpenter, 1867; Acanthochitona ferreirai (Lyons, 1988 y Acanthochitona hirudiniformis (Sowerby, 1832. Ampliamos la distribución documentada de I. dispar hacia el norte y describimos brevemente una especie innominada de Lepidochitona.Chitons (Mollusca: Polyplacophora from El Salvador, Central America. Collections of 11 species of shallow water Polyplacophora from El Salvador were made in July 2002. Previously only five species had been documented in El Salvador: Chaetopleura lurida (Sowerby, 1832; Ischnochiton guatemalensis (Thiele, 1910; Ceratozona angusta (Thiele, 1909; Chiton stokesii (Broderip, 1832 and Acantochitona exquisita (Pilsbry, 1893. Of these, I. guatemalensis and A. exquisita were not collected in this census. Seven other species are reported here for El Salvador for the first time: Lepidochitona beanii (Carpenter, 1857; Ischnochiton dispar (Sowerby, 1832; Stenoplax limaciformis (Sowerby, 1832; Callistochiton expressus (Carpenter, 1865; Acanthochitona arragonites (Carpenter, 1867; A. ferreirai (Lyons, 1988 and A. hirudiniformis (Sowerby, 1832. The known geographic distribution of I. dispar is extended to the north. An un-named species of Lepidochitona is briefly described. Rev. Biol. Trop. 55 (1: 171-176. Epub 2007 March. 31.

Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD = Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD

Directory of Open Access Journals (Sweden)

Patrícia Cristina Gomes

2008-04-01

Full Text Available Recentemente a produção aquícola brasileira tem apresentado grandeprogresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dezprimers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de Gst indicam que houvebaixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence ofthree piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia(B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

Alcohol-tolerant mutants of cyanobacterium Synechococcus elongatus PCC 7942 obtained by single-cell mutant screening system.

Science.gov (United States)

Arai, Sayuri; Hayashihara, Kayoko; Kanamoto, Yuki; Shimizu, Kazunori; Hirokawa, Yasutaka; Hanai, Taizo; Murakami, Akio; Honda, Hiroyuki

2017-08-01

Enhancement of alcohol tolerance in microorganisms is an important strategy for improving bioalcohol productivity. Although cyanobacteria can be used as a promising biocatalyst to produce various alcohols directly from CO 2 , low productivity, and low tolerance against alcohols are the main issues to be resolved. Nevertheless, to date, a mutant with increasing alcohol tolerance has rarely been reported. In this study, we attempted to select isopropanol (IPA)-tolerant mutants of Synechococcus elongatus PCC 7942 using UV-C-induced random mutagenesis, followed by enrichment of the tolerant candidates in medium containing 10 g/L IPA and screening of the cells with a high growth rate in the single cell culture system in liquid medium containing 10 g/L IPA. We successfully acquired the most tolerant strain, SY1043, which maintains the ability to grow in medium containing 30 g/L IPA. The photosynthetic oxygen-evolving activities of SY1043 were almost same in cells after 72 h incubation under light with or without 10 g/L IPA, while the activity of the wild-type was remarkably decreased after the incubation with IPA. SY1043 also showed higher tolerance to ethanol, 1-butanol, isobutanol, and 1-pentanol than the wild type. These results suggest that SY1043 would be a promising candidate to improve alcohol production using cyanobacteria. Biotechnol. Bioeng. 2017;114: 1771-1778. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Mollusca from a species-rich deep-water Leptometra community in the Alboran Sea

Directory of Open Access Journals (Sweden)

Serge Gofas

2014-12-01

Full Text Available An exceptional species richness for Mollusca was found on Avempace bank (349-365 m, Djibouti group, Alboran Sea, where the most abundant species was the crinoid Leptometra phalangium. A sample of sediment sieved on a 0.5-mm mesh yielded 156 species of molluscs (83 live-taken, 1772 specimens with a high Shannon-Wiener diversity index (H’(log2=3.60. The dominant mollusc was Limopsis aurita and the six most common species accounted for 77% of the specimens. On the other hand, 42 species were represented by only one or two specimens. Two species are described as new, three more are first findings in the Mediterranean and two are first findings in Iberian waters. One-third of the species have not been reported from the neighbouring, well-explored Alboran Island platform. There is a considerable balance between the trophic groups, denoting a stable and structured community. Most of the species have an extensive Atlantic range, and most have a planktonic larval stage. Therefore, it can be hypothesized that the fauna benefits from a diverse influx of larvae carried in by the more superficial incoming Atlantic current. Because of its exceptional richness, this type of bathyal community with Leptometra and Limopsis should be considered a high priority for habitat conservation in the Mediterranean deep sea.

Annotated type catalogue of the Orthalicoidea (Mollusca, Gastropoda) in the Museum für Naturkunde, Berlin.

Science.gov (United States)

Breure, Abraham S H

2013-01-01

The type status is described of 96 taxa classified within the superfamily Orthalicoidea and present in the Mollusca collection of the Museum für Naturkunde der Humboldt-Universität zu Berlin. Lectotypes are designated for the following taxa: Orthalicus elegans Rolle, 1895; Bulimus maranhonensis Albers, 1854; Orthalicus nobilis Rolle, 1895; Orthalichus tricinctus Martens, 1893. Orthalicus sphinx tresmariae is introduced as new name for Zebra sphinx turrita Strebel, 1909, not Zebra quagga turrita Strebel, 1909. The following synonyms are established: Zebra crosseifischeri Strebel, 1909 = Orthalicus princeps fischeri Martens, 1893; Orthalicus isabellinus Martens, 1873 = Orthalicus bensoni (Reeve, 1849); Zebra zoniferus naesiotes Strebel, 1909 = Orthalicus undatus (Bruguière, 1789); Porphyrobaphe (Myiorthalicus) dennisoni pallida Strebel, 1909 = Hemibulimus dennisoni (Reeve, 1848); Zebra delphinus pumilio Strebel, 1909 = Orthalicus delphinus (Strebel, 1909); Orthalicus (Laeorthalicus) reginaeformis Strebel, 1909 = Corona perversa (Swainson, 1821); Bulimus (Eurytus) corticosus Sowerby III, 1895 = Plekocheilus (Eurytus) stuebeli Martens, 1885. The taxon Bulimus (Eudioptus) psidii Martens, 1877 is now placed within the family Sagdidae, tentatively in the genus Platysuccinea. Appendices are included with an index to all the types of Orthalicoidea extant (including those listed by Köhler 2007) and a partial list of letters present in the correspondence archives.

First record of Stibarobdella moorei (Annelida, Hirudinea, Piscicolidae a marine leech parasitizing Octopus bimaculatus (Mollusca: Octopodidae from the Mexican Pacific coast

Directory of Open Access Journals (Sweden)

López-Peraza D. J.

2017-12-01

Full Text Available The occurrence of the parasitic marine leech Stibarobdella moorei (Oka, 1910 (Hirudinea: Piscicolidae along the northwest Mexican Pacific coast is described for the first time. This ectoparasite was collected from the skin of the Octopus bimaculatus (Verril, 1983 (Mollusca: Octopodidae. Stibarobdella loricata (Hardig, 1924 is synonymized with S. moorei as this species resembles other species of the genus based on tubercle patterns and the presence of papillae and a marginal fringe on the oral sucker. The present finding throws new light on the biodiversity and host preference of the ectoparasite and suggests a successful migration to unusual host. The coast of the Pacific Ocean, particularly in the Bay of Los Angeles, Baja California, Mexico is a new geographical distribution area for S. moorei, and O. bimaculatus is a new host reported for this leech. The morphology of this ectoparasite is briefly described.

The NADPH thioredoxin reductase C functions as an electron donor to 2-Cys peroxiredoxin in a thermophilic cyanobacterium Thermosynechococcus elongatus BP-1

International Nuclear Information System (INIS)

Sueoka, Keigo; Yamazaki, Teruaki; Hiyama, Tetsuo; Nakamoto, Hitoshi

2009-01-01

An NADPH thioredoxin reductase C was co-purified with a 2-Cys peroxiredoxin by the combination of anion exchange chromatography and electroelution from gel slices after native PAGE from a thermophilic cyanobacterium Thermosynechococcus elongatus as an NAD(P)H oxidase complex induced by oxidative stress. The result provided a strong evidence that the NADPH thioredoxin reductase C interacts with the 2-Cys peroxiredoxin in vivo. An in vitro reconstitution assay with purified recombinant proteins revealed that both proteins were essential for an NADPH-dependent reduction of H 2 O 2 . These results suggest that the reductase transfers the reducing power from NADPH to the peroxiredoxin, which reduces peroxides in the cyanobacterium under oxidative stress. In contrast with other NADPH thioredoxin reductases, the NADPH thioredoxin reductase C contains a thioredoxin-like domain in addition to an NADPH thioredoxin reductase domain in the same polypeptide. Each domain contains a conserved CXYC motif. A point mutation at the CXYC motif in the NADPH thioredoxin reductase domain resulted in loss of the NADPH oxidation activity, while a mutation at the CXYC motif in the thioredoxin-like domain did not affect the electron transfer, indicating that this motif is not essential in the electron transport from NADPH to the 2-Cys peroxiredoxin.

Biochemical profile of Achatina fulica (Mollusca: Gastropoda) after infection by different parasitic loads of Angiostrongylus cantonensis (Nematoda, Metastrongylidae).

Science.gov (United States)

Tunholi-Alves, Vinícius Menezes; Tunholi, Victor Menezes; Amaral, Ludimila Santos; Mota, Esther Maria; Maldonado Júnior, Arnaldo; Pinheiro, Jairo; Garcia, Juberlan

2015-01-01

The effect of experimental infection by different parasitic loads of Angiostrongylus cantonensis (Nematode, Metastrongylidae) on the activities of the aminotransferases and concentration of total proteins, uric acid and urea in the hemolymph of Achatina fulica (Mollusca, Gastropoda) were investigated. There was a significant decrease in the concentration of total proteins in the exposed snails to 5000 or more larvae. This change was accompanied by an increase in the concentrations of urea and uric acid in the hemolymph, suggesting a higher rate of deamination of the amino acids. Besides this, variations in the activities of the aminotransferases were also observed, with the highest values recorded in the groups exposed to greater parasite load. These results suggest an increase in the use of total proteins, since there was increased formation of nitrogenous catabolites, in conformity with an increase in the aminotransferase activities. Infection was verified by the fact that L3 larvae recovered from the snails was proportion to the exposure dose of L1 larvae. Histopathological results also indicated presence of an inflammatory cell infiltrate, favoring an increase of both transaminases. Copyright © 2014 Elsevier Inc. All rights reserved.

Diversidad y microestructura de quitones (Mollusca: Polyplacophora del Caribe de Costa Rica

Directory of Open Access Journals (Sweden)

Cedar I García-Ríos

2011-03-01

Full Text Available Los poliplacóforos asociados a los arrecifes de coral en la costa caribeña de Costa Rica han sido poco estudiados. El examen del cascajo de coral acumulado en el sublitoral somero, en cuatro estaciones de colección, localizadas en la Provincia de Limón reveló una diversidad de quitones mayor a la documentada. Anteriormente se habían registrado ocho especies para el Caribe costaricense: Ischnochiton erythronotus (C.B. Adams, 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon, 1886; S. purpurascens (C.B. Adams, 1845; Acanthopleura granulata (Gmelin, 1791; Chiton marmoratus Gmelin, 1791; C. tuberculatus Linnaeus, 1758; Acanthochitona rhodea (Pilsbry, 1893. Otras cinco se registran aquí por primera vez: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954; Cryptoconchus floridanus (Dall 1889.Diversity and microstructure of quitons (Mollusca: Polyplacophora from the Caribbean of Costa Rica. The polyplacophorans of the coral reef on the Caribbean coast of Costa Rica have been insufficiently studied. The examination of coral rubble accumulated in the shallow sublitoral waters on four collection stations in Provincia Limón revealed a higher diversity of chitons than was documented. From the country eight species were previously known: Ischnochiton erythronotus (C.B. Adams 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon 1886; S. purpurascens (C.B. Adams 1845; Acanthopleura granulate (Gmelin 1791; Chiton marmoratus Gmelin 1791; C. tuberculatus Linnaeus 1758 and Acanthochitona rhodea (Pilsbry 1893. This study added five more species that are reported here for the first time: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954 and Cryptoconchus floridanus (Dall 1889. Rev. Biol. Trop. 59 (1: 129-136. Epub 2011 March 01.

The Complete Sequence of the Mitochondrial Genome of the Chamberednautilus (Mollusca: Cephalopoda)

Energy Technology Data Exchange (ETDEWEB)

Boore, Jeffrey L.

2005-12-01

Background: Mitochondria contain small genomes that arephysically separate from those of nuclei. Their comparison serves as amodel system for understanding the processes of genome evolution.Although complete mitochondrial genome sequences have been reported formore than 600 animals, the taxonomic sampling is highly biased towardvertebrates and arthropods, leaving much of the diversity yetuncharacterized. Results: The mitochondrial genome of a cephalopodmollusk, the Chambered Nautilus, is 16,258 nts in length and 59.5 percentA+T, both values that are typical of animal mitochondrial genomes. Itcontains the 37 genes that are typical for animal mtDNAs, with 15 on oneDNA strand and 22 on the other. The arrangement of these genes can bederived from that of the distantly related Katharina tunicata (Mollusca:Polyplacophora) by a switch in position of two large blocks of genes andtranspositions of four tRNA genes. There is strong skew in thedistribution of nucleotides between the two strands. There are an unusualnumber of non-coding regions and their function, if any, is not known;however, several of these demark abrupt shifts in nucleotide skew,suggesting that they may play roles in transcription and/or replication.One of the non-coding regions contains multiple repeats of a tRNA-likesequence. Some of the tRNA genes appear to overlap on the same strand,but this could be resolved if the polycistron were cleaved at thebeginning of the downstream gene, followed by polyadenylation of theproduct of the upstream gene to form a fully paired structure.Conclusions: Nautilus sp. mtDNA contains an expected gene content thathas experienced few rearrangements since the evolutionary split betweencephalopods and polyplacophorans. It contains an unusual number ofnon-coding regions, especially considering that these otherwise often aregenerated by the same processes that produce gene rearrangements. Thisappears to be yet another case where polyadenylation of mitochondrialtRNAs restores

Isolation, one-step affinity purification, and characterization of a polyextremotolerant laccase from the halophilic bacterium Aquisalibacillus elongatus and its application in the delignification of sugar beet pulp.

Science.gov (United States)

Rezaei, Shahla; Shahverdi, Ahmad Reza; Faramarzi, Mohammad Ali

2017-04-01

The aim of the present work was to study the ability of a halophilic bacterial laccase to efficient delignification in extreme conditions. Here, a highly stable extracellular laccase showing ligninolytic activity from halophilic Aquisalibacillus elongatus is described. The laccase production was strongly influenced by NaCl and CuSO 4 and under optimal conditions reached 4.8UmL -1 . The monomeric enzyme of 75kDa was purified by a synthetic affinity column with 68.2% yield and 99.8-fold purification. The enzyme showed some valuable features viz. stability against a wide range of organic solvents, salts, metals, inhibitors, and surfactants and specificity to a wide spectrum of substrates diverse in structure and redox potential. It retained more than 50% of the original activity at 25-75°C and pH 5.0-10.0. Furthermore, the enzyme was found to be effective in the delignification of sugar beet pulp in an ionic liquid that makes it useful for industrial applications. Copyright © 2017 Elsevier Ltd. All rights reserved.

Annotated type catalogue of the Orthalicoidea (Mollusca, Gastropoda in the Museum für Naturkunde, Berlin

Directory of Open Access Journals (Sweden)

Abraham Breure

2013-03-01

Full Text Available The type status is described of 96 taxa classified within the superfamily Orthalicoidea and present in the Mollusca collection of the Museum für Naturkunde der Humboldt-Universität zu Berlin. Lectotypes are designated for the following taxa: Orthalicus elegans Rolle, 1895; Bulimus maranhonensis Albers, 1854; Orthalicus nobilis Rolle, 1895; Orthalichus tricinctus Martens, 1893. Orthalicus sphinx tresmariae is introduced as new name for Zebra sphinx turrita Strebel, 1909, not Z. quagga turrita Strebel, 1909. The following synonyms are established: Zebra crosseifischeri Strebel, 1909 = Orthalicus princeps fischeri Martens, 1893; Orthalicus isabellinus Martens, 1873 = O. bensoni (Reeve, 1849; Zebra zoniferus naesiotes Strebel, 1909 = Orthalicus undatus (Bruguière, 1789; Porphyrobaphe (Myiorthalicus dennisoni pallida Strebel, 1909 = Hemibulimus dennisoni (Reeve, 1848; Zebra delphinus pumilio Strebel, 1909 = Orthalicus delphinus (Strebel, 1909; Orthalicus (Laeorthalicus reginaeformis Strebel, 1909 = Corona perversa (Swainson, 1821; Bulimus (Eurytus corticosus Sowerby III, 1895 = Plekocheilus (Eurytus stuebeli Martens, 1885. The taxon Bulimus (Eudioptus psidii Martens, 1877 is now placed within the family Sagdidae, tentatively in the genus Platysuccinea. Appendices are included with an index to all the types of Orthalicoidea extant (including those listed by Köhler 2007 and a partial list of letters present in the correspondence archives.

Homology and homoplasy of swimming behaviors and neural circuits in the Nudipleura (Mollusca, Gastropoda, Opisthobranchia)

Science.gov (United States)

Newcomb, James M.; Sakurai, Akira; Lillvis, Joshua L.; Gunaratne, Charuni A.; Katz, Paul S.

2012-01-01

How neural circuit evolution relates to behavioral evolution is not well understood. Here the relationship between neural circuits and behavior is explored with respect to the swimming behaviors of the Nudipleura (Mollusca, Gastropoda, Opithobranchia). Nudipleura is a diverse monophyletic clade of sea slugs among which only a small percentage of species can swim. Swimming falls into a limited number of categories, the most prevalent of which are rhythmic left–right body flexions (LR) and rhythmic dorsal–ventral body flexions (DV). The phylogenetic distribution of these behaviors suggests a high degree of homoplasy. The central pattern generator (CPG) underlying DV swimming has been well characterized in Tritonia diomedea and in Pleurobranchaea californica. The CPG for LR swimming has been elucidated in Melibe leonina and Dendronotus iris, which are more closely related. The CPGs for the categorically distinct DV and LR swimming behaviors consist of nonoverlapping sets of homologous identified neurons, whereas the categorically similar behaviors share some homologous identified neurons, although the exact composition of neurons and synapses in the neural circuits differ. The roles played by homologous identified neurons in categorically distinct behaviors differ. However, homologous identified neurons also play different roles even in the swim CPGs of the two LR swimming species. Individual neurons can be multifunctional within a species. Some of those functions are shared across species, whereas others are not. The pattern of use and reuse of homologous neurons in various forms of swimming and other behaviors further demonstrates that the composition of neural circuits influences the evolution of behaviors. PMID:22723353

Volutidae (Mollusca: Gastropoda) of the Lakhra Formation (Earliest Eocene, Sindh, Pakistan): systematics, biostratigraphy and paleobiogeography.

Science.gov (United States)

Merle, Didier; Pacaud, Jean-Michel; Métais, Grégoire; Bartolini, Annachiara; Lashari, Rafiq A; Brohi, Imdad A; Solangi, Sarfraz H; Marivaux, Laurent; Welcomme, Jean-Loup

2014-06-27

The paleobiodiversity of the Volutidae (Mollusca: Gastropoda) of the Ranikot Group (Sindh, Pakistan) and particularly of the Lakhra Formation (SBZ 5 biozone, Earliest Eocene), is reconsidered on the basis of new material collected during recent field trips. Ten new species are described (Mitreola brohii sp. nov., Lyrischapa vredenburgi sp. nov., L. brevispira sp. nov., Athleta (Volutopupa) citharopsis sp. nov., A. (Volutocorbis) lasharii sp. nov., Volutilithes welcommei sp. nov., V. sindhiensis sp. nov., Pseudaulicina coxi sp. nov., Sindhiluta lakhraensis sp. nov. and Pakiluta solangii sp. nov.) and one species is in open nomenclature (Lyria sp.). Three new genera are described: Lyriopsis gen. nov. [Volutinae, ?Lyriini, type species: Lyriopsis cossmanni (Vredenburg, 1923)], Sindhiluta gen. nov. [Volutilithinae, type species: Sindhiluta lakhraensis n. sp.] and Pakiluta gen. nov. [?Volutodermatinae, type species: Pakiluta solangii n. sp.]. Two new combinations are proposed: Lyriopsis cossmanni (Vredenburg, 1923) comb. nov. and Athleta (Volutopupa) intercrenatus (Cossmann & Pissarro, 1909) comb. nov. Lectotypes are designated for Lyria cossmanni Vredenburg, 1923, L. feddeni Vredenburg, 1923, Volutospina noetlingi Cossmann & Pissarro, 1909, V. intercrenata Cossmann & Pissarro, 1909 and Athleta (Volutocorbis) victoriae Vredenburg, 1923. With 21 species, this volutid fauna is the most diverse recorded from the Tethys Ocean during Earliest Eocene time. The assemblage is characterized by a strong turnover marked by regional speciation and the appearance of many western Tethyan invaders. Although at the species level, the assemblage documents a strong provincialism, at the genus level, the high number of shared genera between Eastern Tethyan and Old World Tethyan realms begins a phase of long-term homogeneity of volutid assemblages from the Tethyan paleobiogeographic province.

Assessing metal contamination from construction and demolition (C&D) waste used to infill wetlands: using Deroceras reticulatum (Mollusca: Gastropoda).

Science.gov (United States)

Staunton, John A; Mc Donnell, Rory J; Gormally, Michael J; Williams, Chris D; Henry, Tiernan; Morrison, Liam

2014-11-01

Large quantities of construction and demolition waste (C&D) are produced globally every year, with little known about potential environmental impacts. In the present study, the slug, Deroceras reticulatum (Mollusca: Gastropoda) was used as the first biomonitor of metals (Ag, As, Ba, Cd, Co, Cr, Cu, Mn, Mo, Ni, Pb, Sb, Se, Ti, Tl, V and Zn) on wetlands post infilling with construction and demolition (C&D) waste. The bioaccumulation of As, Ba, Cd, Co, Sb, Se and Tl were found to be significantly elevated in slugs collected on C&D waste when compared to unimproved pastures (control sites), while Mo, Se and Sr had significantly higher concentrations in slugs collected on C&D waste when compared to known contaminated sites (mining locations), indicating the potential hazardous nature of C&D waste to biota. Identifying exact sources for these metals within the waste can be problematic, due to its heterogenic nature. Biomonitors are a useful tool for future monitoring and impact studies, facilitating policy makers and regulations in other countries regarding C&D waste infill. In addition, improving separation of C&D waste to allow increased reuse and recycling is likely to be effective in reducing the volume of waste being used as infill, subsequently decreasing potential metal contamination.

Comunidades de quitones (Mollusca: Polyplacophora de la Bahía de La Paz, Baja California Sur, México

Directory of Open Access Journals (Sweden)

Cedar I García Ríos

2007-03-01

Full Text Available A las ocho especies de poliplacóforos registradas en Bahía de la Paz, Baja California Sur, México, o cerca de ella, agregamos a Lepidochitona beanii, Chaetopleura lurida, Stenoplax limaciformis, S. mariposa, Lepidozona clathrata, L. serrata y Acanthochitona arragonites. El análisis de las comunidades estudiadas usando técnicas de ordenación sugiere que podría relacionarse la exposición al oleaje con la riqueza y la diversidad de especies. La comunidad recolectada en condiciones intermedias de exposición al oleaje presentó mayor número de especies y mayor diversidad de acuerdo con el índice de Shannon.Polyplacophoran communities (Mollusca: Polyplacophora at Bahía de La Paz, Baja California Sur, México. Eight species of polyplacophorans have been reported from La Bahía de la Paz, Baja California Sur, Mexico. We add Lepidochitona beanii, Chaetopleura lurida, Stenoplax limaciformis, S. mariposa, Lepidozona clathrata, L. serrata and Acanthochitona arragonites, increasing the known number of species to 15. Ordination analysis of five chiton communities at the site suggests a correlation of wave exposure to species composition and diversity: communities with intermediate wave exposure have more species (richness and higher diversity (Shannon’s index. Rev. Biol. Trop. 55 (1: 177-182. Epub 2007 March. 31.

Development of a high-frequency in vivo transposon mutagenesis system for Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

Science.gov (United States)

Watabe, Kazuyuki; Mimuro, Mamoru; Tsuchiya, Tohru

2014-11-01

Synechocystis sp. PCC 6803 (Synechocystis) is the first sequenced photosynthetic organism and has two advantages: natural transformation and light-activated heterotrophic growth. Such characteristics have mainly promoted reverse genetic analysis in this organism, however, to date approximately 50% of genes are still annotated as 'unknown protein' or 'hypothetical protein'. Therefore, forward genetic analysis is required for the identification of significant genes responsible for photosynthesis and other physiological phenomena among the genes of unknown function. The in vivo transposon mutagenesis system is one of the major methods for random mutagenesis. However, present in vivo transposon mutagenesis systems for cyanobacteria face problems such as relatively low frequency of transposition and repeated transposition in the host cells. In this study, we constructed vectors based on a mini-Tn5-derived vector that was designed to prevent repeated transposition. Our vectors carry a hyperactive transposase and optimized recognition sequence of transposase, which were reported to enhance frequency of transposition. Using the vector, we succeeded in highly frequent transposition (9×10(-3) per recipient cell) in Synechocystis. Transposon insertion sites of 10 randomly selected mutants indicated that the insertion sites spread throughout the genome with low sequence dependency. Furthermore, one of the 10 mutants exhibited the slow-growing phenotype, and the mutant was functionally complemented by using our expression vector. Our system also worked with another model cyanobacterium, Synechococcus elongatus PCC 7942, with high frequency. These results indicate that the developed system can be applied to the forward genetic analysis of a broad range of cyanobacteria. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

ON THE PALEOFAUNA INVERTEBRATES (MOLLUSCA, ARTROPODA; INSECTA OF DIATOMITE DEPOSITS OF SHAMB–1 LOCALITY (SISIAN SUITE, EARLY PLEISTOCENE, ARMENIA

Directory of Open Access Journals (Sweden)

М. A. Маrjanyan

2016-01-01

Full Text Available Aim. The study of fossil insects from diatomaceous sediments of Shamb-1 locality of Sisian Suite (Early Pleistocene. The collection of fossils plants and animals of Institute of Botany of NAS RA and authors' findings served as material for study.Methods. The material is processed and prepared for study by conventional methods in paleontology for prints and fossils of insects from diatomaceous sediments. There are 654 samples studied: 2 samples were with mollusks’ imprints and 652 samples with imprints of insects, from which preserved marks on 291samples allowed to identify them up to order, family, genus and species.Results. The studied material refers to the Mollusca and Arthropoda (Insecta types. Insects are represented by species of orders Orthoptera (2 fam., Homoptera (1 fam., Heteroptera (2 fam., Coleoptera (15 fam., Hymenoptera (2 fam., Diptera (1 fam.. Coleopteras dominate among them and are presented with following species of the family – Carabidae, Dytiscidae, Hydrophilidae, Histeridae, Staphylinidae, Silphidae, Elateridae, Buprestidae, Lampyridae, Scarabaeidae, Chrysomelidae, Tenebrionidae, Coccinellidae, Cerambycidae, Curculionidae.Main conclusions. An analysis of the taxonomic composition of paleofauna was done, which corresponds to the recent fauna and with considering modern ecological characteristics of systematical groups and species. In the investigated location of Shamb-1 a version is suggested about the palaeolandscapes and palaeoclimate in the Early Pleistocene.

The influence of fish cage culture on δ{sup 13}C and δ{sup 15}N of filter-feeding Bivalvia (Mollusca)

Energy Technology Data Exchange (ETDEWEB)

Benedito, E.; Takeda, A.M., E-mail: eva@nupelia.uem.br [Universidade Estadual de Maringa (UEM), PR (Brazil). Nucleo de Pesquisas em Limnologia, Ictiologia e Aquicultura; Figueroa, L. [Universidade Estadual de Maringa (UEM), PR (Brazil). Pos-Graduacao em Ecologia de Ambientes Aquaticos Continentais; Manetta, GI. [Universidade Estadual de Maringa (UEM), PR (Brazil). Pos-Graduacao em Biologia Comparada

2013-11-15

The objective of this study was to evaluate the effect of Oreochromis niloticus cage culture promoted variations in the δ{sup 13}C and δ{sup 15}N in Corbicula fluminea (Mollusca; Bivalvia) and in the sediment of an aquatic food web. Samples were taken before and after net cage installation in the Rosana Reservoir (Paranapanema River, PR-SP). Samples of specimens of the bivalve filter C. fluminea and samples of sediment were collected using a modified Petersen grab. All samples were dried in an oven (60 °C) for 72 hours, macerated to obtain homogenous fine powders and sent for carbon (δ{sup 13}C) and nitrogen (δ{sup 15}N) isotopic value analysis in a mass spectrometer. There were significant differences in the δ{sup 13}C and δ{sup 15}N values of the invertebrate C. fluminea between the beginning and the end of the experiment. There were no differences between the δ{sup 13}C and δ{sup 15}N values of sediment. These results indicate that the installation of fish cage culture promoted impacts in the isotopic composition of the aquatic food web organisms, which could exert influence over the native species and the ecosystem. (author)

Nervous system development in the Pacific oyster, Crassostrea gigas (Mollusca: Bivalvia).

Science.gov (United States)

Yurchenko, Olga V; Skiteva, Olga I; Voronezhskaya, Elena E; Dyachuk, Vyacheslav A

2018-01-01

have not been observed previously in molluscs. Finally, we performed a morphology-based comparative analysis of neuronal structures among bivalve, conchiferan, and aculiferan species. We described the development of the nervous system during the larval development in Crassostrea gigas . These data greatly advance the currently limited understanding of neurodevelopment in bivalves and mollusks, which has hampered the generation of a ground pattern reconstruction of the last common ancestor of Mollusca. Our morphological data support phylogenomic data indicating a closer Bivalvia-Gastropoda sister group relationship than the Bivalvia-Scaphopoda (Diasoma) group relationship.

Detection limits of absorbed dose of ionizing radiation in molluscan shells as determined by e.p.r. spectroscopy

International Nuclear Information System (INIS)

Stachowicz, W.; Michalik, J.; Burlinska, G.; Sadlo, J.; Dziedzic-Goclawska, A.; Ostrowski, K.

1995-01-01

The exposure of waters to ionizing radiation from radionuclides imprisoned in dumped nuclear waste containers, freed in nuclear submarine accidents or released in underwater magma eruptions are difficult to be evaluated by conventional radiometric methods. Ionizing radiation evokes stable paramagnetic centers in crystalline lattice of mineral components in bone skeletons of mammals and fishes as well as in exoskeletons of mollusca. They give rise in e.p.r. to specific, extremely stable signals which are proposed to be applied as indicators of radiation exposure levels. In the present study the e.p.r. detection limits of the dose of ionizing radiation absorbed in shells of fresh water and marine mollusca (selected species) have been estimated. It has been found that with fresh water mollusca the dose of 1-2 Gy can be detected, while the sea water mollusca by one order of magnitude lower, i.e. about 0.1 Gy. (author)

A massive ingression of the alien species Mytilus edulis L. (Bivalvia: Mollusca into the Mediterranean Sea following the Costa Concordia cruise-ship disaster

Directory of Open Access Journals (Sweden)

E. CASOLI

2016-03-01

Full Text Available The Costa Concordia cruise-ship disaster occurred just off the coast of Italy on January 13th, 2012, and entailed the largest marine salvage operation in history. The salvage employed vessels from different European harbours, providing an unexpected means for transporting alien species into the Mediterranean. In this work we identified mussel species using fragments length polymorphism of a nuclear locus and report the first evidence of the transport of the blue mussel, Mytilus edulis Linnaeus, 1758 (Bivalvia: Mollusca, into the Mediterranean Sea, as a part of the fouling community of the hull of an accommodation barge arrived from a NE Atlantic location in October 2012. Furthermore, we describe the rapid growth of this species, under the ASV Pioneer, until its almost total extinction during the summer of 2013, which left a covering of mussel shells on the underlying Posidonia oceanica (Linnaeus Delile, 1813. meadow. This high mortality rate indicated that M. edulis had been exposed to high stress conditions, probably due to different salinity, temperature, and oligotrophic conditions from its place of origin, and there was no spawning event or known settlement on the nearest infralittoral natural habitats. This event reminds us of how the Mediterranean Sea is constantly under alien-species pressure, due to human activities.

In vitro kinetics of P700+ reduction of Thermosynechococcus elongatus trimeric Photosystem I complexes by recombinant cytochrome c 6 using a Joliot-type LED spectrophotometer.

Science.gov (United States)

Nguyen, Khoa; Vaughn, Michael; Frymier, Paul; Bruce, Barry D

2017-01-01

The reduction rate of photo-oxidized Photosystem I (PSI) with various natural and artificial electron donors have been well studied by transient absorption spectroscopy. The electron transfer rate from various donors to P 700 + has been measured for a wide range of photosynthetic organisms encompassing cyanobacteria, algae, and plants. PSI can be a limiting component due to tedious extraction and purification methods required for this membrane protein. In this report, we have determined the in vivo, intracellular cytochrome c 6 (cyt c 6 )/PSI ratio in Thermosynechococcus elongatus (T.e.) using quantitative Western blot analysis. This information permitted the determination of P 700 + reduction kinetics via recombinant cyt c 6 in a physiologically relevant ratio (cyt c 6 : PSI) with a Joliot-type, LED-driven, pump-probe spectrophotometer. Dilute PSI samples were tested under varying cyt c 6 concentration, temperature, pH, and ionic strength, each of which shows similar trends to the reported literature utilizing much higher PSI concentrations with laser-based spectrophotometer. Our results do however indicate kinetic differences between actinic light sources (laser vs. LED), and we have attempted to resolve these effects by varying our LED light intensity and duration. The standardized configuration of this spectrophotometer will also allow a more uniform kinetic analysis of samples in different laboratories. We can conclude that our findings from the LED-based system display an added total protein concentration effect due to multiple turnover events of P 700 + reduction by cyt c 6 during the longer illumination regime.

Molecular phylogenetic analysis supports a Gondwanan origin of the Hyriidae (Mollusca: Bivalvia: Unionida) and the paraphyly of Australasian taxa.

Science.gov (United States)

Graf, Daniel L; Jones, Hugh; Geneva, Anthony J; Pfeiffer, John M; Klunzinger, Michael W

2015-04-01

The freshwater mussel family Hyriidae (Mollusca: Bivalvia: Unionida) has a disjunct trans-Pacific distribution in Australasia and South America. Previous phylogenetic analyses have estimated the evolutionary relationships of the family and the major infra-familial taxa (Velesunioninae and Hyriinae: Hyridellini in Australia; Hyriinae: Hyriini, Castaliini, and Rhipidodontini in South America), but taxon and character sampling have been too incomplete to support a predictive classification or allow testing of biogeographical hypotheses. We sampled 30 freshwater mussel individuals representing the aforementioned hyriid taxa, as well as outgroup species representing the five other freshwater mussel families and their marine sister group (order Trigoniida). Our ingroup included representatives of all Australian genera. Phylogenetic relationships were estimated from three gene fragments (nuclear 28S, COI and 16S mtDNA) using maximum parsimony, maximum likelihood, and Bayesian inference, and we applied a Bayesian relaxed clock model calibrated with fossil dates to estimate node ages. Our analyses found good support for monophyly of the Hyriidae and the subfamilies and tribes, as well as the paraphyly of the Australasian taxa (Velesunioninae, (Hyridellini, (Rhipidodontini, (Castaliini, Hyriini)))). The Hyriidae was recovered as sister to a clade comprised of all other Recent freshwater mussel families. Our molecular date estimation supported Cretaceous origins of the major hyriid clades, pre-dating the Tertiary isolation of South America from Antarctica/Australia. We hypothesize that early diversification of the Hyriidae was driven by terrestrial barriers on Gondwana rather than marine barriers following disintegration of the super-continent. Copyright © 2015 Elsevier Inc. All rights reserved.

Abyssal fauna of the UK-1 polymetallic nodule exploration area, Clarion-Clipperton Zone, central Pacific Ocean: Mollusca.

Science.gov (United States)

Wiklund, Helena; Taylor, John D; Dahlgren, Thomas G; Todt, Christiane; Ikebe, Chiho; Rabone, Muriel; Glover, Adrian G

2017-01-01

We present the first DNA taxonomy publication on abyssal Mollusca from the Clarion-Clipperton Zone (CCZ), central Pacific ocean, using material collected as part of the Abyssal Baseline (ABYSSLINE) environmental survey cruise 'AB01' to the UK Seabed Resources Ltd (UKSRL) polymetallic-nodule exploration area 'UK-1' in the eastern CCZ. This is the third paper in a series to provide regional taxonomic data for a region that is undergoing intense deep-sea mineral exploration for high-grade polymetallic nodules. Taxonomic data are presented for 21 species from 42 records identified by a combination of morphological and genetic data, including molecular phylogenetic analyses. These included 3 heterodont bivalves, 5 protobranch bivalves, 4 pteriomorph bivalves, 1 caudofoveate, 1 monoplacophoran, 1 polyplacophoran, 4 scaphopods and 2 solenogastres. Gastropoda were recovered but will be the subject of a future study. Seven taxa matched published morphological descriptions for species with deep Pacific type localities, and our sequences provide the first genetic data for these taxa. One taxon morphologically matched a known cosmopolitan species but with a type locality in a different ocean basin and was assigned the open nomenclature ' cf ' as a precautionary approach in taxon assignments to avoid over-estimating species ranges. One taxon is here described as a new species, Ledella knudseni sp. n. For the remaining 12 taxa, we have determined them to be potentially new species, for which we make the raw data, imagery and vouchers available for future taxonomic study. The Clarion-Clipperton Zone is a region undergoing intense exploration for potential deep-sea mineral extraction. We present these data to facilitate future taxonomic and environmental impact study by making both data and voucher materials available through curated and accessible biological collections.

Abyssal fauna of the UK-1 polymetallic nodule exploration area, Clarion-Clipperton Zone, central Pacific Ocean: Mollusca

Directory of Open Access Journals (Sweden)

Helena Wiklund

2017-10-01

Full Text Available We present the first DNA taxonomy publication on abyssal Mollusca from the Clarion-Clipperton Zone (CCZ, central Pacific ocean, using material collected as part of the Abyssal Baseline (ABYSSLINE environmental survey cruise ‘AB01’ to the UK Seabed Resources Ltd (UKSRL polymetallic-nodule exploration area ‘UK-1’ in the eastern CCZ. This is the third paper in a series to provide regional taxonomic data for a region that is undergoing intense deep-sea mineral exploration for high-grade polymetallic nodules. Taxonomic data are presented for 21 species from 42 records identified by a combination of morphological and genetic data, including molecular phylogenetic analyses. These included 3 heterodont bivalves, 5 protobranch bivalves, 4 pteriomorph bivalves, 1 caudofoveate, 1 monoplacophoran, 1 polyplacophoran, 4 scaphopods and 2 solenogastres. Gastropoda were recovered but will be the subject of a future study. Seven taxa matched published morphological descriptions for species with deep Pacific type localities, and our sequences provide the first genetic data for these taxa. One taxon morphologically matched a known cosmopolitan species but with a type locality in a different ocean basin and was assigned the open nomenclature ‘cf’ as a precautionary approach in taxon assignments to avoid over-estimating species ranges. One taxon is here described as a new species, Ledella knudseni sp. n. For the remaining 12 taxa, we have determined them to be potentially new species, for which we make the raw data, imagery and vouchers available for future taxonomic study. The Clarion-Clipperton Zone is a region undergoing intense exploration for potential deep-sea mineral extraction. We present these data to facilitate future taxonomic and environmental impact study by making both data and voucher materials available through curated and accessible biological collections.

Variety of DNA Replication Activity Among Cyanobacteria Correlates with Distinct Respiration Activity in the Dark.

Science.gov (United States)

Ohbayashi, Ryudo; Yamamoto, Jun-Ya; Watanabe, Satoru; Kanesaki, Yu; Chibazakura, Taku; Miyagishima, Shin-Ya; Yoshikawa, Hirofumi

2017-02-01

Cyanobacteria exhibit light-dependent cell growth since most of their cellular energy is obtained by photosynthesis. In Synechococcus elongatus PCC 7942, one of the model cyanobacteria, DNA replication depends on photosynthetic electron transport. However, the critical signal for the regulatory mechanism of DNA replication has not been identified. In addition, conservation of this regulatory mechanism has not been investigated among cyanobacteria. To understand this regulatory signal and its dependence on light, we examined the regulation of DNA replication under both light and dark conditions among three model cyanobacteria, S. elongatus PCC 7942, Synechocystis sp. PCC 6803 and Anabaena sp. PCC 7120. Interestingly, DNA replication activity in Synechocystis and Anabaena was retained when cells were transferred to the dark, although it was drastically decreased in S. elongatus. Glycogen metabolism and respiration were higher in Synechocystis and Anabaena than in S. elongatus in the dark. Moreover, DNA replication activity in Synechocystis and Anabaena was reduced to the same level as that in S. elongatus by inhibition of respiratory electron transport after transfer to the dark. These results demonstrate that there is disparity in DNA replication occurring in the dark among cyanobacteria, which is caused by the difference in activity of respiratory electron transport. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Molluscan Evolutionary Development

DEFF Research Database (Denmark)

Wanninger, Andreas Wilhelm Georg; Koop, Damien; Moshel-Lynch, Sharon

2008-01-01

Brought together by Winston F. Ponder and David R. Lindberg, thirty-six experts on the evolution of the Mollusca provide an up-to-date review of its evolutionary history. The Mollusca are the second largest animal phylum and boast a fossil record of over 540 million years. They exhibit remarkable...

NMSBA: Aken Technologies Final Report: Toxicity Testing of Liquidoff

Energy Technology Data Exchange (ETDEWEB)

Ruffing, Anne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jensen, Travis [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Strickland, Lucas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2015-02-01

To determine the effect of Liquidoff on bacteria, three bacterial strains were tested: Escherichia coli DH5α, Synechococcus sp. PCC 7002, and Synechococcus elongatus PCC 7942. E. coli DH5α is a Gram-negative, aerobic bacterium that is often found in normal gut flora and is commonly used the laboratory due to its fast growth rate. Synechococcus sp. PCC 7002 and S. elongatus PCC 7942 are Gram-negative, aquatic, autophototrophic cyanobacteria. Synechococcus sp. PCC 7002 is a marine cyanobacterium isolated from ‘fish pens’ on Magueyes Island, Puerto Rico in 1962, while S. elongatus PCC 7942 is a freshwater cyanobacterium. It should be noted that no Gram-positive bacterium was tested in this study.

Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD - DOI: 10.4025/actascianimsci.v30i2.4710 Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD - DOI: 10.4025/actascianimsci.v30i2.4710

Directory of Open Access Journals (Sweden)

Lauro Vargas

2008-08-01

Full Text Available Recentemente a produção aquícola brasileira tem apresentado grande progresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dez primers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de indicam que houve baixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence of three piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia (B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

The linked units of 5S rDNA and U1 snDNA of razor shells (Mollusca: Bivalvia: Pharidae).

Science.gov (United States)

Vierna, J; Jensen, K T; Martínez-Lage, A; González-Tizón, A M

2011-08-01

The linkage between 5S ribosomal DNA and other multigene families has been detected in many eukaryote lineages, but whether it provides any selective advantage remains unclear. In this work, we report the occurrence of linked units of 5S ribosomal DNA (5S rDNA) and U1 small nuclear DNA (U1 snDNA) in 10 razor shell species (Mollusca: Bivalvia: Pharidae) from four different genera. We obtained several clones containing partial or complete repeats of both multigene families in which both types of genes displayed the same orientation. We provide a comprehensive collection of razor shell 5S rDNA clones, both with linked and nonlinked organisation, and the first bivalve U1 snDNA sequences. We predicted the secondary structures and characterised the upstream and downstream conserved elements, including a region at -25 nucleotides from both 5S rDNA and U1 snDNA transcription start sites. The analysis of 5S rDNA showed that some nontranscribed spacers (NTSs) are more closely related to NTSs from other species (and genera) than to NTSs from the species they were retrieved from, suggesting birth-and-death evolution and ancestral polymorphism. Nucleotide conservation within the functional regions suggests the involvement of purifying selection, unequal crossing-overs and gene conversions. Taking into account this and other studies, we discuss the possible mechanisms by which both multigene families could have become linked in the Pharidae lineage. The reason why 5S rDNA is often found linked to other multigene families seems to be the result of stochastic processes within genomes in which its high copy number is determinant.

Evaluation of uptake and chronic toxicity of virgin polystyrene microbeads in freshwater zebra mussel Dreissena polymorpha (Mollusca: Bivalvia).

Science.gov (United States)

Magni, Stefano; Gagné, François; André, Chantale; Della Torre, Camilla; Auclair, Joëlle; Hanana, Houda; Parenti, Camilla Carla; Bonasoro, Francesco; Binelli, Andrea

2018-08-01

Microplastics (MPs), plastic debris smaller than 5mm, are widely found in both marine and freshwater ecosystems. However, few studies regarding their hazardous effects on inland water organisms, have been conducted. For this reason, the aim of our research was the evaluation of uptake and chronic toxicity of two mixtures (MIXs) of virgin polystyrene microbeads (PMs) of 10μm and 1μm in size (MIX 1, with 5×10 5 of 1μmsizePMs/L and 5×10 5 of 10μmsizePMs/L, and MIX 2 with 2×10 6 of 1μmsizePMs/L and 2×10 6 of 10μmsizePMs/L) on freshwater zebra mussel Dreissena polymorpha (Mollusca: Bivalvia) during 6 exposure days. The PM uptake in the mussel body and hemolymph was assessed using confocal microscopy, while the chronic toxicity of PMs was evaluated on exposed mussels using a comprehensive battery of biomarkers of cellular stress, oxidative damage and neuro- genotoxicity. Confocal microscopy analyses showed that MPs concentrated in the gut lumen of exposed mussels, absorbed and transferred firstly in the tissues and then in the hemolymph. The results revealed that PMs do not produce oxidative stress and genetic damage, with the exception of a significant modulation of catalase and glutathione peroxidase activities in mussels exposed to MIX 1. Regarding neurotoxicity, we observed only a significant increase of dopamine concentration in mussels exposed to both MIXs, suggesting a possible implication of this neurotransmitter in an elimination process of accumulated PMs. This research represents a first study about the evaluation of virgin MP toxicity in zebra mussel and more research is warranted concerning the long term neurological effects of virgin MPs. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.

Characterization of mutants expressing thermostable D1 and D2 polypeptides of photosystem II in the cyanobacterium Synechococcus elongatus PCC 7942.

Science.gov (United States)

Haraguchi, Norihisa; Kaseda, Jun; Nakayama, Yasumune; Nagahama, Kazuhiro; Ogawa, Takahira; Matsuoka, Masayoshi

2018-06-08

Photosystem II complex embedded in thylakoid membrane performs oxygenic photosynthesis where the reaction center D1/D2 heterodimer accommodates all components of the electron transport chain. To express thermostable D1/D2 heterodimer in a cyanobacterium Synechococcus elongatus PCC 7942, we constructed a series of mutant strains whose psbA1 and psbD1 genes encoding, respectively, the most highly expressed D1 and D2 polypeptides were replaced with those of a thermophilic strain, Thermosynechococcus vulcanus. Because the C-terminal 16 amino acid sequences of D1 polypeptides should be processed prior to maturation but diverge from each other, we also constructed the psbA1ΔC-replaced strain expressing a thermostable D1 polypeptide devoid of the C-terminal extension. The psbA1/psbD1-replaced strain showed decreased growth rate and oxygen evolution rate, suggesting inefficient photosystem II. Immunoblot analyses for thermostable D1, D2 polypeptides revealed that the heterologous D1 protein was absent in thylakoid membrane from any mutant strains with psbA1, psbA1ΔC, and psbA1/psbD1-replacements, whereas the heterologous D2 protein was present in thylakoid membrane as well as purified photosystem II complex from the psbA1/psbD1-replaced strain. In the latter strain, the compensatory expression of psbA3 and psbD2 genes was elevated. These data suggest that heterologous D2 polypeptide could be combined with the host D1 polypeptide to form chimeric D1/D2 heterodimer, whereas heterologous D1 polypeptide even without the C-terminal extension was unable to make complex with the host D2 polypeptide. Since the heterologous D1 could not be detected even in the whole cells of psbA1/psbD1-replaced strain, the rapid degradation of unprocessed or unassembled heterologous D1 was implicated. Copyright © 2018 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

Marine mollusca of oxygen isotope stages of the last 2 million years in New Zealand. Part 1, Revised generic positions and recognition of warm-water and cool-water migrants

International Nuclear Information System (INIS)

Beu, A.G.

2004-01-01

Warm-water molluscs were transported to Wanganui Basin from the northeastern North Island during Pleistocene time as planktotrophic larvae. This is not possible at present, so their occurrence in Wanganui Basin correlates with breaches of the Auckland isthmus during high sea levels. The end of Nukumaruan time is clearly defined by the extinction of 29 genera of molluscs (most only locally) during this stage, including 15 at the end. The extinction likely was caused by the initial closure of the Auckland isthmus. Migrants to Wanganui from the northeastern North Island indicate that breaches of the isthmus during interglacials commenced in oxygen isotope stage (OIS) 25, just before the mid-Pleistocene transition (MPT). Appearances of taxa from Australia at Wanganui during OIS 17-9 therefore indicate that warm-water taxa were transported to New Zealand during interglacial maxima after the MPT. The migrants provide the first molluscan biostratigraphy at the OIS scale. The Castlecliffian/Nukumaruan boundary, at the base of Ototoka tephra at Ototoka Beach, Wanganui, falls within OIS 57, with an age of c. 1.63 Ma. It is also dated at 1.63 Ma by the position with respect to the geomagnetic polarity time-scale of three chemically indistinguishable tephra in ODP core 1123. This paper presents the first results of a reassessment of the taxonomy and time ranges of the fossil marine molluscan fauna that occupied New Zealand during the last 2 m.y. (latest Pliocene-Holocene). Time ranges are compiled in oxygen isotope stages rather than in the traditional 'local' (or regional) stages in use in New Zealand. This should provide precision in time ranges of the order of 40,000-100,000 yr, rather than the 0.34-1.3 m.y. duration of New Zealand local stages of the latest Neogene (Nukumaruan, Castlecliffian, and Haweran Stages). The reassessment is aimed also, though, at providing evidence from Mollusca of climate change over this period. Much useful information on paleoclimates can be

Genetic variability of wild populations of Leporinus elongatus in the São Domingos River - MS Brazil: a preliminary view on the construction of the hydroelectric plant

Directory of Open Access Journals (Sweden)

Ricardo Pereira Ribeiro

2016-09-01

Full Text Available Most of the electricity used in Brazil comes from hydroelectric plants, mainly due to the great availability of its water resources. However, the construction of these plants denotes serious problems related to migration of native fish and the genetic conservation of stocks. Current study evaluates two wild population of Leporinus elongatus (piapara located downstream (Population A - PopA and upstream (Population B - PopB of the Cachoeira Branca before the construction of the São Domingos hydroelectric plant (HPP in the Mato Grosso do Sul State, Brazil. Thirty samples from caudal fins were collected and analyzed for each population. Eighty-nine fragments, including 72 polymorphic ones (80.9%, were analyzed. Low fragments (less than 0.100 in both populations (PopA = 2 and PopB = 3 were identified. Nine fixed fragments (frequency 1.000 (PopA = 3 and PopB = 6, and four exclusive fragments (PopA = 3 and PopB = 1 were also reported. The genetic variability within populations, calculated by Shannon Index and by percentage of polymorphic fragments, indicated high rates of intrapopulation variability (PopA = 0.309 and 61.80% and PopB = 0.392 and 71.90%, respectively. Genetic distance and identity rates (0.089 and 0.915, respectively were different between populations, whilst AMOVA showed that most variations lie within the populations and not between them. Fst and Nm rates showed moderate genetic differentiation with low numbers of migrants. Results reveal populations with high intra-population genetic variability and genetic differentiation, with low gene flow. The passage ladders of São Domingos HPP should control fish transposition to preserve genetic variability.

A revised geographical range for Liolaemus elongates Koslowsky, 1896 (Squamata: Liolaemini in Argentina: review of reported and new-data based distribution with new localities

Directory of Open Access Journals (Sweden)

Ignacio Minoli

2013-12-01

Full Text Available Estimating the effective geographical ranges of species is central to species-oriented conservation and management. In this paper, we review the geographical distribution of Liolaemus elongatus Koslowsky, 1896 with three new records for northern Chubut and southern Río Negro provinces, Argentina. Based on detailed locality records pooled from multiple data sources, including new records obtained for this study, we revise the range of L. elongatus sensu stricto and provide geographical distribution maps comparing the previously recognized range to that proposed herein. Our results show that L. elongatus possesses a much more limited geographic distribution than previously thought, being restricted to areas south of 38°S latitude; the newly proposed range is merely half the species formerly recognized geographical distribution.

Seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep – numerical simulations

Directory of Open Access Journals (Sweden)

L. Dzierzbicka-Głowacka

2006-01-01

Full Text Available A population dynamics model for copepods is presented, describing the seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep. The copepod model was coupled with a one-dimensional physical and biological upper layer model for nutrients (total inorganic nitrogen, phosphate, phytoplankton, microzooplankton, and an early juvenile of herring as a predator. In this model, mesozooplankton (herbivorous copepods has been introduced as an animal having definite patterns of growth in successive stages, reproduction and mortality. The populations are represented by 6 cohorts in different developmental stages, thus assuming that recruitment of the next generation occurs after a fixed period of adult life. The copepod model links trophic processes and population dynamics, and simulates individual growth within cohorts and the changes in biomass between cohorts. The simulations of annual cycles of copepods contain one complete generation of Pseudocalanus and two generations of Acartia in the whole column water, and indicate the importance of growth in the older stages of 6 cohorts of each species, to arrive at a total population biomass. The peaks of copepods' biomass are larger at the turn of June and July for Pseudocalanus and smaller in July for Acartia, lagging that of phytoplankton by ca. two mouths, due to the growth of cohorts in successive stages and egg production by females. The numerical results show that the investigated species could not be the main factor limiting the spring phytoplankton bloom in the Gdańsk Deep, because the initial development was slow for Acartia and faster for Pseudocalanus, but the main development formed after the bloom, in both cases. The phytoplankton bloom is very important in the diet of the adults of the copepods, but it is not particularly important for the youngest part of new generation (early nauplii. However, the simulated microzooplankton biomass was

The role of lantern fish (Myctophidae) in the life-cycle of cetacean parasites from western Mediterranean waters

Science.gov (United States)

Mateu, Paula; Nardi, Valentina; Fraija-Fernández, Natalia; Mattiucci, Simonetta; Gil de Sola, Luis; Raga, Juan Antonio; Fernández, Mercedes; Aznar, Francisco Javier

2015-01-01

Myctophids (lantern fish) and cephalopods play a key role in trophic webs from the continental slope and oceanic waters linking the zooplankton to top predators. Many cetaceans feed on both lantern fish and cephalopods, and such prey would thus be expected to bridge the trophic gap in the life-cycles of helminths infecting cetaceans. However, information on the life-cycles of most of these helminths is extremely scanty. We examined the parasite fauna of myctophids and cephalopods in two areas from the western Mediterranean where at least 21 helminth taxa from cetaceans have been reported and both cetacean diversity and abundance is high. A total of 1012 individuals of 8 lantern fish species, namely, Ceratoscopelus maderensis, Lampanyctus crocodilus, Notoscopelus elongatus, Benthosema glaciale, Myctophum punctatum, Lobianchia dofleini, Diaphus holti and Hygophum benoiti, and 792 individuals of 2 cephalopod species, Alloteuthis media and Sepietta oweniana, were collected from the Gulf of Valencia and Alboran Sea (Spanish Mediterranean) during 2010-2012 and examined for larval helminths. All these species have been reported as prey for at least some cetacean species in the area. Only five helminth taxa were found. The nematodes Anisakis pegreffii and Anisakis physeteris were detected in N. elongatus and C. maderensis (overall prevalence for Anisakis: 8.1% and 0.5%, respectively). Their prevalence in N. elongatus was significantly higher than that from the other three myctophid species with n>50 individuals. A single individual of Hysterothylacium sp. was found in N. elongatus (prevalence: 0.5%) and Raphidascarididae gen. spp. in N. elongatus and L. crocodilus (prevalence: 20.3% and 0.7%, respectively). Juvenile didymozoid digeneans (Torticaecum type) were detected in N. elongatus and L. crocodilus (prevalence: 18.5% and 4.3%, respectively). Two unidentified cestode plerocercoids were collected from N. elongatus. Our study suggests, for the first time, that myctophids

Recombinant thermoactive phosphoenolpyruvate carboxylase (PEPC) from Thermosynechococcus elongatus and its coupling with mesophilic/thermophilic bacterial carbonic anhydrases (CAs) for the conversion of CO2 to oxaloacetate.

Science.gov (United States)

Del Prete, Sonia; De Luca, Viviana; Capasso, Clemente; Supuran, Claudiu T; Carginale, Vincenzo

2016-01-15

With the continuous increase of atmospheric CO2 in the last decades, efficient methods for carbon capture, sequestration, and utilization are urgently required. The possibility of converting CO2 into useful chemicals could be a good strategy to both decreasing the CO2 concentration and for achieving an efficient exploitation of this cheap carbon source. Recently, several single- and multi-enzyme systems for the catalytic conversion of CO2 mainly to bicarbonate have been implemented. In order to design and construct a catalytic system for the conversion of CO2 to organic molecules, we implemented an in vitro multienzyme system using mesophilic and thermophilic enzymes. The system, in fact, was constituted by a recombinant phosphoenolpyruvate carboxylase (PEPC) from the thermophilic cyanobacterium Thermosynechococcus elongatus, in combination with mesophilic/thermophilic bacterial carbonic anhydrases (CAs), for converting CO2 into oxaloacetate, a compound of potential utility in industrial processes. The catalytic procedure is in two steps: the conversion of CO2 into bicarbonate by CA, followed by the carboxylation of phosphoenolpyruvate with bicarbonate, catalyzed by PEPC, with formation of oxaloacetate (OAA). All tested CAs, belonging to α-, β-, and γ-CA classes, were able to increase OAA production compared to procedures when only PEPC was used. Interestingly, the efficiency of the CAs tested in OAA production was in good agreement with the kinetic parameters for the CO2 hydration reaction of these enzymes. This PEPC also revealed to be thermoactive and thermostable, and when coupled with the extremely thermostable CA from Sulphurhydrogenibium azorense (SazCA) the production of OAA was achieved even if the two enzymes were exposed to temperatures up to 60 °C, suggesting a possible role of the two coupled enzymes in biotechnological processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Unique attributes of cyanobacterial metabolism revealed by improved genome-scale metabolic modeling and essential gene analysis

Science.gov (United States)

Broddrick, Jared T.; Rubin, Benjamin E.; Welkie, David G.; Du, Niu; Mih, Nathan; Diamond, Spencer; Lee, Jenny J.; Golden, Susan S.; Palsson, Bernhard O.

2016-01-01

The model cyanobacterium, Synechococcus elongatus PCC 7942, is a genetically tractable obligate phototroph that is being developed for the bioproduction of high-value chemicals. Genome-scale models (GEMs) have been successfully used to assess and engineer cellular metabolism; however, GEMs of phototrophic metabolism have been limited by the lack of experimental datasets for model validation and the challenges of incorporating photon uptake. Here, we develop a GEM of metabolism in S. elongatus using random barcode transposon site sequencing (RB-TnSeq) essential gene and physiological data specific to photoautotrophic metabolism. The model explicitly describes photon absorption and accounts for shading, resulting in the characteristic linear growth curve of photoautotrophs. GEM predictions of gene essentiality were compared with data obtained from recent dense-transposon mutagenesis experiments. This dataset allowed major improvements to the accuracy of the model. Furthermore, discrepancies between GEM predictions and the in vivo dataset revealed biological characteristics, such as the importance of a truncated, linear TCA pathway, low flux toward amino acid synthesis from photorespiration, and knowledge gaps within nucleotide metabolism. Coupling of strong experimental support and photoautotrophic modeling methods thus resulted in a highly accurate model of S. elongatus metabolism that highlights previously unknown areas of S. elongatus biology. PMID:27911809

Two new Liolaemus lizards from the Andean highlands of Southern Chile (Squamata, Iguania, Liolaemidae)

Science.gov (United States)

Troncoso-Palacios, Jaime; Diaz, Hugo A.; Puas, German I.; Riveros-Riffo, Edvin; Elorza, Alvaro A.

2016-01-01

Abstract Liolaemus is a diverse genus of lizards, subdivided into two subgenera: Liolaemus (sensu stricto) and Eulaemus, distributed mainly in Chile and Argentina. The Liolaemus elongatus-kriegi complex is the most diverse group within Liolaemus (sensu stricto), especially the species closely related to Liolaemus elongatus, which form a clade currently comprising nine species. Several Chilean species of this group have been recently described, mainly from volcanoes and poorly explored mountains. Here molecular and morphological evidence are provided for a new species of the Liolaemus elongatus clade, which is characterized by its small size and lack of dorsal pattern, unusual features for the species of this group of lizards. Additionally, the lack of precloacal pores in males of Liolaemus (sensu stricto) is a trait found in few species, which do not constitute a monophyletic group. A second new southern Chilean species is also described, without precloacal pores and supported by molecular phylogenetics to be related to Liolaemus villaricensis. Both new species were found in the same locality, near a lake located in a pre-Andean zone with Araucaria and Nothofagus forest. The two species are dedicated to prominent Lonkos (tribal chiefs) of the Mapuche and Pehuenche people: Janequeo and Leftraru. Additionally, the phylogenetic results suggest that Liolaemus lonquimayensis is a synonym of Liolaemus elongatus. PMID:27920609

Atypical feeding behavior of Long-tailed Ducks in the wake of a commercial fishing boat while clamming

Science.gov (United States)

Perry, Matthew; Osenton, Peter C.; White, Timothy P.

2017-01-01

A foraging group of Clangula hyemalis (Long-tailed Duck) was observed on 10 February 2010 diving behind a commercial boat that was clamming near Monomoy Island, Nantucket Sound, MA. We used a shotgun to collect 9 of the ducks, and our analyses of gizzard and gullet (esophagus and proventriculus) revealed 37 food items in the gizzard and 16 in the gullet. Mollusca were the dominant food in the gizzard (49%), whereas Crustacea were dominant in the gullet (57%). Crustacea were the second most important food in the gizzard (38%), whereas Mollusca were the second most important food in the gullet (31%). Relatively high volumes of the Amphipoda Caprella sp. (skeleton shrimp) and the Decopoda Crangon septemspinosa (Sand Shrimp) were recorded in the gullet and gizzard. Ensis directus (Atlantic Jackknife Clam) formed the greatest volume of Mollusca in the gizzard (15%) and in the gullet (15%). Long-tailed Ducks had fed on this Bivalvia and several other species of Mollusca that had no shell or broken shell when consumed. Many of the food organisms were apparently dislodged and some damaged by the clamming operation creating an opportunistic feeding strategy for the Long-tailed Ducks.

Megafauna of the UKSRL exploration contract area and eastern Clarion-Clipperton Zone in the Pacific Ocean: Annelida, Arthropoda, Bryozoa, Chordata, Ctenophora, Mollusca.

Science.gov (United States)

Amon, Diva J; Ziegler, Amanda F; Drazen, Jeffrey C; Grischenko, Andrei V; Leitner, Astrid B; Lindsay, Dhugal J; Voight, Janet R; Wicksten, Mary K; Young, Craig M; Smith, Craig R

2017-01-01

There is growing interest in mining polymetallic nodules from the abyssal Clarion-Clipperton Zone (CCZ) in the tropical Pacific Ocean. Despite having been the focus of environmental studies for decades, the benthic megafauna of the CCZ remain poorly known. To predict and manage the environmental impacts of mining in the CCZ, baseline knowledge of the megafauna is essential. The ABYSSLINE Project has conducted benthic biological baseline surveys in the UK Seabed Resources Ltd polymetallic-nodule exploration contract area (UK-1). Prior to ABYSSLINE research cruises in 2013 and 2015, no biological studies had been done in this area of the eastern CCZ. Using a Remotely Operated Vehicle and Autonomous Underwater Vehicle (as well as several other pieces of equipment), the megafauna within the UK Seabed Resources Ltd exploration contract area (UK-1) and at a site ~250 km east of the UK-1 area were surveyed, allowing us to make the first estimates of megafaunal morphospecies richness from the imagery collected. Here, we present an atlas of the abyssal annelid, arthropod, bryozoan, chordate, ctenophore and molluscan megafauna observed and collected during the ABYSSLINE cruises to the UK-1 polymetallic-nodule exploration contract area in the CCZ. There appear to be at least 55 distinct morphospecies (8 Annelida, 12 Arthropoda, 4 Bryozoa, 22 Chordata, 5 Ctenophora, and 4 Mollusca) identified mostly by morphology but also using molecular barcoding for a limited number of animals that were collected. This atlas will aid the synthesis of megafaunal presence/absence data collected by contractors, scientists and other stakeholders undertaking work in the CCZ, ultimately helping to decipher the biogeography of the megafauna in this threatened habitat.

Influence of weather variables and plant communities on grasshopper density in the Southern Pampas, Argentina.

Science.gov (United States)

de Wysiecki, María Laura; Arturi, Marcelo; Torrusio, Sandra; Cigliano, María Marta

2011-01-01

A study was conducted to evaluate the influence of weather (precipitation and temperature) and plant communities on grasshopper density over a 14-year period (1996-2009) in Benito Juárez County, Southern Pampas, Argentina. Total density strongly varied among plant communities. Highest values were registered in 2001 and 2003 in highly disturbed pastures and in 2002 and 2009 in halophilous grasslands. Native grasslands had the lowest density values. Seasonal precipitation and temperature had no significant effect on total grasshopper density. Dichroplus elongatus (Giglio-Tos) (Orthoptera: Acridoidea), Covasacris pallidinota (Bruner), Dichroplus pratensis Bruner, Scotussa lemniscata Stål, Borellia bruneri (Rehn) and Dichroplus maculipennis (Blanchard) comprised, on average, 64% of the grasshopper assemblages during low density years and 79% during high density years. Dichroplus elongatus, S. lemniscata and C. pallidinota were the most abundant species in 2001, 2002 and 2003, while D. elongatus, B. brunneri and C. pallidinota in 2009. Dichroplus elongatus and D. pratensis, mixed feeders species, were positively affected by summer rainfall. This suggests that the increase in summer precipitation had a positive effect on the quantity and quality forage production, affecting these grasshopper populations. Scotussa lemniscata and C. pallidinota were negatively affected by winter and fall temperature, possibly affecting the embryonic development before diapause and hatching. Dichroplus elongatus and D. pratensis were associated with highly disturbed pastures, S. lemniscata with pastures and B. bruneri and D. maculipennis with halophilous grasslands. Covasacris pallidinota was closely associated with halophilous grasslands and moderately disturbed pastures. Weather conditions changed over the years, with 2001, 2002 and 2003 having excessive rainfall while 2008 and 2009 were the driest years since the study started. We suggest that although seasonal precipitation and

Comunidad de moluscos asociados al mejillón verde Perna viridis (Mollusca: Bivalvia y sus relaciones tróficas en la costa norte de la Península de Araya, Estado Sucre, Venezuela

Directory of Open Access Journals (Sweden)

Sioliz Villafranca

2006-12-01

Full Text Available Perna viridis es un bivalvo procedente del Indo-Pacífico que habita en la zona intermareal y ha invadido varios ecosistemas de la costa norte del estado Sucre, Venezuela. Con la finalidad de realizar un estudio sobre las comunidades de moluscos asociadas a esta especie y sus relaciones tróficas, se llevaron a cabo muestreos bimensuales entre octubre/97 y agosto/98, en un banco natural de mejillones a dos metros de profundidad en la costa norte de la península de Araya (10°40’N -48°63’W. Los organismos fueron recolectados delimitando el área con una cuadrícula de 0.25 m². Se identificaron los organismos hasta la categoría de especies utilizando claves específicas para moluscos y bibliográficamente se les determinó categoría trófica.Se capturó un total de 1 235 individuos de P. viridis y asociados a la especie 3 163 especímenes pertenecientes al phylum Mollusca, contenidos en tres clases: Bivalvia,Gastropoda y Polyplacophora. Éstas estuvieron representadas por 50 especies correspondientes a 10 órdenes, 24 familias; para los gasterópodos se contabilizaron 25 especies, para los bivalvos 22 y tres para los poliplacóforos. Del total de las especies, 40% fueron filtradoras, 26% carnívoras, 24% herbívoras y el 10% restante presentó dos categorías.De las filtradoras las más representativas fueron: Perna perna, Musculus lateralis, Crassostrea rhizophorae y Ostrea equestris; en el grupo de los carnívoros dominaron tres especies de la familia Columbellidae:Mitrella lunata, Anachis obesa y Nitidella ocellata y para el grupo de los herbívoros destacaron dos especies de la familia Fisurellidae: Diodora cayenensis y D. minuta. Se registraron dos especies filtradoras-detritívoras, y tres especies herbívoras-filtradoras representantes del género C repidula. El alto porcentaje de filtradores sería un indicativo de que dentro de este sistema probablemente hay una mayor disponibilidad de fracciones alimenticias para este grupo

Structural determinants of the outer shell of β-carboxysomes in Synechococcus elongatus PCC 7942: roles for CcmK2, K3-K4, CcmO, and CcmL.

Directory of Open Access Journals (Sweden)

Benjamin D Rae

Full Text Available Cyanobacterial CO(2-fixation is supported by a CO(2-concentrating mechanism which improves photosynthesis by saturating the primary carboxylating enzyme, ribulose 1, 5-bisphosphate carboxylase/oxygenase (RuBisCO, with its preferred substrate CO(2. The site of CO(2-concentration is a protein bound micro-compartment called the carboxysome which contains most, if not all, of the cellular RuBisCO. The shell of β-type carboxysomes is thought to be composed of two functional layers, with the inner layer involved in RuBisCO scaffolding and bicarbonate dehydration, and the outer layer in selective permeability to dissolved solutes. Here, four genes (ccmK2-4, ccmO, whose products were predicted to function in the outer shell layer of β-carboxysomes from Synechococcus elongatus PCC 7942, were investigated by analysis of defined genetic mutants. Deletion of the ccmK2 and ccmO genes resulted in severe high-CO(2-requiring mutants with aberrant carboxysomes, whilst deletion of ccmK3 or ccmK4 resulted in cells with wild-type physiology and normal ultrastructure. However, a tandem deletion of ccmK3-4 resulted in cells with wild-type carboxysome structure, but physiologically deficient at low CO(2 conditions. These results revealed the minimum structural determinants of the outer shell of β-carboxysomes from this strain: CcmK2, CcmO and CcmL. An accessory set of proteins was required to refine the function of the pre-existing shell: CcmK3 and CcmK4. These data suggested a model for the facet structure of β-carboxysomes with CcmL forming the vertices, CcmK2 forming the bulk facet, and CcmO, a "zipper protein," interfacing the edges of carboxysome facets.

Protein (Cyanobacteria): 71044 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available erase Synechococcus elongatus PCC 6301 MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRLEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRG...GYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRGGFRGRDDRGSSGSYRGRDDRG

ORF Sequence: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ferase [Synechococcus elongatus PCC 6301] MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRLEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRG...GYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRGGFRGRDDRG...SSGSYRGRDDRGGFRGRDDRRDDRDNFRPSRDRELNREVNTSPAGDQEATDHELIYGRHAVLAALQ

Active prey selection in two pelagic copepods feeding on potentially toxic and non-toxic dinoflagellates

DEFF Research Database (Denmark)

Schultz, Mette; Kiørboe, Thomas

2009-01-01

Grazing on two red tide dinoflagellates, the potentially toxic Karenia mikimotoi and the non-toxic Gyrodinium instriatum, was examined in two species of marine copepods, Pseudocalanus elongatus and Temora longicornis. Both copepods cleared K. mikimotoi at rates that were a little lower but compar......Grazing on two red tide dinoflagellates, the potentially toxic Karenia mikimotoi and the non-toxic Gyrodinium instriatum, was examined in two species of marine copepods, Pseudocalanus elongatus and Temora longicornis. Both copepods cleared K. mikimotoi at rates that were a little lower...

Espécie invasora em unidade de conservação: Achatina fulica (Bowdich, 1822 no Parque Estadual Carlos Botelho, Sete Barras, SP, Brasil (Nota Científica. Invasive species in conservation unit: Achatina fulica (Bowdich, 1822 in Carlos Botelho State Park, Sete Barras, SP, Brazil (Scientific Note.

Directory of Open Access Journals (Sweden)

Marilda Rapp de ESTON

2006-12-01

Full Text Available O caramujo-gigante-africano, Achatinafulica (Mollusca-Achatinidae, considerado umadas cem piores espécies invasoras do mundo,causando sérios danos ambientais, é registrado pelaprimeira vez para o Parque Estadual CarlosBotelho, município de Sete Barras, Estado de SãoPaulo, Brasil.The Giant African Snail, Achatina fulica(Mollusca-Achatinidae, considered as one of ahundred worst world’s invasive species, causingserious environmental damages, is registered forthe first time for Carlos Botelho State Park, countyof Sete Barras, state of São Paulo, Brazil.

On Pomacea sordida (Swainson, 1823 (Prosobranchia, Ampullariidae Sobre Pomacea sordida (Swaison, 1823 (Prosobranchia, Ampullariidae

Directory of Open Access Journals (Sweden)

Silvana Carvalho Thiengo

1989-09-01

Full Text Available A description of Pomacea sordida (Swainson, 1823 collected in Caxias and Nova Iguaçu, state of Rio de Janeiro, is presented. The shell is globose, heavy, whith greenish or horn-colored periostracum and dark spinal bands; apex subelevated, 4-5 moderately shoudered whorls, increasing rather rapidly and separated by deep suture. Aperture large, moderately round, yellowish or violaceous; lip thick and sometimes dark brown; umbilicus large and deep; operculum corneous and heavy, entirely closing the aperture. Ratios: shell width/shell length = 0.81-0.91 (mean 0.86; aperture length/shell length = 0.66-0.75 (mean 0.70. Testis, spermiduct and penis pouch as in Pomacea lineata (Spix, 1827. Seminal vesicle whitish and bean-shaped. Prostate cylindric and narrow, cream in coloar as the testis. Penis whiplike whith a closed circular spermiduct. Penial sheath elongated and tapered, with its distal tip turned to the right; outer basal gland situated on the left; inner median gland rounded; apical gland elongated and wrinkled. Ovary composed of branched whitish tubules lying superficially on the digestive gland; oviduct and seminal receptacle as in P. lineata; albumen gland yellowish - orange. Vestigial male copulatory apparatus (penis and its sheath present in all females examined.Nesse trabalho é apresentada a descrição de Pomacea sordida (Swainson, 1823, coletada em Caxias e Nova Iguaçu, Estado do Rio de Janeiro. Concha globosa, espessa, com perióstraco esverdeado ou castanho e com faixas espirais escuras; ápice pouco elevado, 4-5 giros moderadamente arredondados, crescendo relativamente rápido, separados por suturas profundas. Abertura grande, moderadamente arredondada, amarelada ou violácea; lábio espesso e algumas vezes marrom escuro; umbílico grande e profundo; opérculo córneo e espesso, fechando completamente a abertura. Razões: largura da concha/comprimento da concha=0.81-0.91 (média 0.86; comprimento da abertura/comprimento da concha=0.66-0.75 (média 0.70. Testículo, espermiduto e bolsa do pênis como em Pomacea lineata (Spix, 1827. Vesícula seminal esbranquiçada e em forma de feijão. Próstata cilíndrica e estreita, de cor creme como o testículo. Pênis em forma de chicote, com espermiduto circular e fechado. Bainha do pênis alongada tendo sua largura diminuída da base para a extremidade, sendo esta última voltada para a direita; glândula basal extrema situada à esquerda; glândula mediana interna arredondada; glândula apical alongada e com sulcos. Ovário composto de túbulos brancos ramificados dispostos superficialmente sobre a glândula digestiva verde. Oviduto e receptáculo seminal como em P. lineata; glândula de albume de cor alaranjada; ovos prismáticos e calcáreos de cor alaranjada. Aparelho copulador masculino vestigial (pênis e sua bainha presente em todas as fêmeas examinadas.

On the role of water and forage in penetration of some radionuclides into the Limnaea organism

International Nuclear Information System (INIS)

Marchyulenene, D.P.; Polikarpov, G.G.; AN Ukrainskoj SSR, Sevastopol. Inst. Biologii Yuzhnykh Morej)

1976-01-01

The objective of this work was to study under laboratory conditions the significance of elodea (Elodea canadensis Rich.) and aqueous medium in accumulation of strontium-90, cesium-137, cerium-144 and ruthenium-106 by limnetic gastropods (Limnaea Stagnalis L.). The study revealed that only 2 and 5% of strontium-90 and cerium-144 respectively were accumulated in molluscs shell from radioactive food, and 4 and 26% - in the body. The authors believed that higher accumulation levels of cerium-144 and ruthenium-106 in mollusca body when the molluscs are fed with radioactive elodea were caused by high accumulation coefficients (AC) of radionuclides in food, i.e. elodea, and their accumulation in the gastrointestinal tracts of molluscs. To appreciates the significance of elodea and water as sources of radionuclide accumulation by mollusca, strontium-90 and cerium-144 AC in molluscs were estimated in relation to water and elodea. The results obtained indicated that AC of these radionuclides in mollusca was much lower in relation to food than to water

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ECEASDVKSLLEALEQSFPGIKARLCDEQGQLRRFLNVYVN 62 ... ITVLIPTPLQKFTNNQASLECEASDVKS...LLEALEQSFPGIKARLCDEQGQLRRFLNVYVN Sbjct: 1 ... ITVLIPTPLQKFTNNQASLECEASDVKSLLEALEQSFPGIKARLCDEQGQLRRFLNVYVN 60 ... ...subunit ... [Synechococcus elongatus PCC 7942] ... Length = 89 ... Query: 3 ... ITVLIPTPLQKFTNNQASL

ORF Alignment: NC_004113 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se ... [Thermosynechococcus elongatus BP-1] ... Length = 99 ... Query: 9 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVI...LNDILVSRYHAELSCYRDPENLGRWFLKSLG 68 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVI...LNDILVSRYHAELSCYRDPENLGRWFLKSLG Sbjct: 1 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVILNDILVSRYHAELSCYRDPENLGRWFLKSLG 60 ...

ORF Alignment: NC_004113 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... elongatus BP-1] ... Length = 211 ... Query: 1 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPF...PHPYVAQ 60 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPFPHPYVA...Q Sbjct: 1 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPFPHPYVAQ 60 ... Query: 121 AVGLRLPLAGLLVFSGYLV

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available occus ... elongatus PCC 6301] ... Length = 168 ... Query: 361 RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIY...SPEMSDRTXXXXXXXXXXXXXXXXX 420 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMS...DRT ... Sbjct: 17 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMSDRTYGRLLYLGLGLAQAGYR 76 ... Query: 481

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ccus ... elongatus PCC 6301] ... Length = 155 ... Query: 2 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDR...AGLLVMFICQHCPFVKHVEEELAA 61 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVM...FICQHCPFVKHVEEELAA Sbjct: 1 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVMFICQHCPFVKHVEEELAA 60 ... Query: 122 DF

Tolerance to air exposure of the New Zealand mudsnail Potamopyrgus antipodarum (Hydrobiidae, Mollusca as a prerequisite to survival in overland translocations

Directory of Open Access Journals (Sweden)

Alvaro Alonso

2012-08-01

Full Text Available Spreading throughout a new ecosystem is the last step of an exotic species to become invasive. In the case of invasive aquatic molluscs, tolerance to air exposure is one of the main mechanisms allowing overland translocation and spreading. The mudsnail Potamopyrgus antipodarum (Hydrobiidae, Mollusca is native to New Zealand but it has spread worldwide, invading ecosystems in Europe, Australia, America and Asia. The aim of our study is to assess mudsnail tolerance to air exposure, which may contribute to the successful overland translocation of this species. We conducted a laboratory experiment with four levels of air exposure (9, 18, 24 and 36 hours in a controlled climatic chamber. Snails were placed for 60 seconds in a laboratory paper filter to remove surface snail water. Then they were placed back in empty vessels during the four periods of air exposure, except the control group, which was immediately returned to water. At the end of each period of air exposure all vessels were filled with water and the cumulative mortality was monitored after 24, 96, 168 and 264 hours of rehydration. The calculated Lethal Times (i.e. the time of air exposure (in hours necessary to cause the death of 50% (LT50 or 99% (LT99 of the population and their 95% confidence limits at 24, 96, 168 and 264 hours were 28.1 (25.2–31.9, 26.9 (24.2–30.1, 25.9 (23.4–28.9 and 25.9 (23.4–28.9 hours, respectively for LT50, and 49.6 (42.7–63.3, 45.6 (39.9–56.5, 43.2 (38.0–53.0 and 43.2 (38.0–53.0 hours, respectively for LT99. Therefore an air exposure time over 43 hours caused the death of all studied individuals during all monitoring periods. Extending the monitoring period beyond 24 hours did not significantly change lethal times. Therefore, we recommend exposing fishing tools or boats at open air during at least 53 hours as a low cost measure to control mudsnail spread in early stages of invasion.

[Evaluation of ten fish species to be included as part of renal diet, due to their protein, phosphorus and fatty acids content].

Science.gov (United States)

Castro-González, Maria Isabel; Maafs-Rodríguez, Ana Gabriela; Pérez-Gil Romo, Fernando

2012-06-01

Because renal disease is highly complex, its nutritional treatment is complicated and many foods are restricted, including fish because its phosphorus content. The aim of the present study was to analyze ten fillet fish species, commonly consumed in Mexico (Cyprinus carpio carpio, Ophichthus rex, Symphurus elongatus, Eucinostomus entomelas, Chirostoma patzcuaro, Bairdiella chrysoura, Salmo salar Oreochromis urolepis hornorum, Sphyraena guachancho, Istiophorus albicans), to determine their phosphorus (P), protein (Pr), cholesterol, sodium, potassium, vitamins D3 and E, and n-3 PUFA (EPA+DHA) according to the AOAC techniques, in order to identify which species could be included in renal diet; particularly because of their risk:benefit relations (calculated with those results). Protein values ranged from 16.5 to 33.5g/100 g of fillet; the specie with the highest phosphorus contest was Salmo salar, and with the lowest, Symphurus elongatus. EPA+DHA quantity ranged from 79.64 mg/100 g to 1,381.53 mg/100 g. Considering de P/Pr relation recommended to renal patients, all analyzed species (except Salmo salar, Ophichthus rex and Istiophorus albicans) could be included in their diet. As for the P/EPA+DHA relation, the species most recommended to renal patients are Symphurus elongatus, Bairdiella chrysoura and Sphyraena guachancho.

Měkkýši údolí Vltavy (Čechy)

Czech Academy of Sciences Publication Activity Database

Horáčková, J.; Ložek, V.; Beran, L.; Juřičková, L.; Podroužková, Š.; Peterka, Jiří; Čech, Martin

2014-01-01

Roč. 13, - (2014), s. 12-105 ISSN 1336-6939 Institutional support: RVO:60077344 Keywords : faunistics * inventory * Mollusca * river floodplain * Lucilla scintilla * Margaritifera margaritifera Subject RIV: EH - Ecology, Behaviour

Caracterización de las comunidades de acridios (Orthoptera: Acridoidea del partido de Benito Juárez, sudeste de la provincia de Buenos Aires, Argentina Grasshopper (Orthoptera: Acridoidea community structure in Benito Juárez county, in outhern Buenos Aires province, Argentina

Directory of Open Access Journals (Sweden)

María Laura de Wysiecki

2004-12-01

Full Text Available Se analizó la riqueza, densidad, constancia y distribución de especies de acridios, en distintas comunidades vegetales (1997-2002 en el partido de Benito Juárez, sudeste de la provincia de Buenos Aires. Las comunidades vegetales se categorizaron en pastizales nativos, comunidades halófilas, pasturas sin disturbio, pasturas con moderado disturbio y pasturas con alto disturbio. En total se registraron 23 especies de acridios. Los melanoplinos dominaron en casi todas las comunidades vegetales, excepto en las halófilas que se caracterizaron por la presencia de un acridino, Covasacris pallidinota (Bruner. La riqueza de especies promedio por sitio por año, varió entre 2,10 ± 0,60 especies en las pasturas con moderado disturbio y 6,20 ± 0,58 especies en las comunidades halófilas. La riqueza de especies acumulada fue de 17 en los pastizales nativos, 14 en las comunidades halófilas, 19 en las pasturas sin disturbio, 18 en las pasturas con moderado disturbio y 14 en las pasturas con alto disturbio. La densidad promedio de acridios fue máxima en el 2001 y 2002. Dichroplus pratensis Bruner y Dichroplus elongatus Giglio-Tos dominaron en los pastizales nativos y en las pasturas con alto disturbio, C. pallidinota en las comunidades halófilas, D. elongatus y Scotussa lemniscata (Stål en las pasturas sin disturbio y en las pasturas con moderado disturbio. La estructura taxonómica de las comunidades de acridios fue constante en los pastizales nativos, las comunidades halófilas y las pasturas. Hubo pocas especies de amplia distribución e intermedias y las raras fueron las más numerosas. De las 23 especies registradas en todos los sitios, D. elongatus fue la única de amplia distribución. Históricamente, para la zona de estudio, Dichroplus maculipennis (Blanch fue señalada como la especie dominante. Sin embargo, nuestros resultados sugieren que en la actualidad la especie dominante es D. elongatus. Si bien resulta imposible conocer las causas

Mobile acoustic telemetry data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

Tag effect data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

’n Vergelyking van die Mollusca-diversiteit in die Mooirivier (Noordwes-Provinsie soos gevind met opnames wat gemaak is in 1963 en weer 50 jaar later

Directory of Open Access Journals (Sweden)

Cornelius T. Wolmarans

2015-02-01

Full Text Available Die hoogste getal gedokumenteerde uitsterwings van enige belangrike taksonomiese groepword aan die Mollusca toegedig. Faktore wat hoofsaaklik hiervoor verantwoordelik is, sluitonder meer omgewingsveranderinge en antropogeniese impakte in wat tot die tot niet gaanvan die habitat aanleiding gee. Daarbenewens is die bewaringstatus van minder as 2% van dieongeveer 7000 molluskspesies wêreldwyd bekend tot dusver nog nie behoorlik geassesseernie. Die doel van die huidige ondersoek wat in 2014 uitgevoer is, was om die molluskdiversiteitvan die Mooirivier met die resultate van 1963 te vergelyk. Dit is gedoen deur ’n opnameuit te voer van die molluskdiversiteit by dieselfde lokaliteite as in 1963. Twee opnames isgemaak tydens ’n vroeë- en laatlaagvloeiperiode in 2014 by agt lokaliteite wat met dié vandie 1963-opnames ooreenstem. Die pH, elektriese geleiding (EG en temperatuur is ook byelk van die lokaliteite gemeet. Die identiteit van die 14 slakspesies wat in 1963 gevind is, hetooreengestem met 14 van die 15 in 2014. Die uitheemse indringerspesie Physa acuta is tydensdie 2014-opname vir die eerste keer in hierdie rivier gevind, waarskynlik weens ’n toename inorganiese verryking. In die 1963-opname is Burnupia mooiensis en Pisidium langlyanum by diemeeste lokaliteite gevind, en in 2014 Gyraulus connollyi en Ferrissia cawstoni. Die meeste van diemolluske uit hierdie gebied wat voorheen op rekord gestel is, is in 2014 gevind. Die pH watin 2014 ’n geringe tot aansienlike verlaging getoon het, word aan mynversuring toegeskryfen het nie ’n merkbare invloed op die molluskdiversiteit gehad nie. Die hoër elektriesegeleiding wat tydens die 2014-opname gemeet is, het vanweë die verdraagsaamheid vanvarswatermolluske in hierdie verband, ook geen verandering in die molluskdiversiteit teweeggebring nie. Die temperatuur was in die laatlaagvloei deurgaans hoër. Ondanks die feit dathierdie studies vyf dekades uitmekaar gedoen is en antropogeniese impakte

Description of a new genus and species of the Coleopterous family Colydidae

NARCIS (Netherlands)

Reitter, E.

1882-01-01

Corpus valde elongatum, convexum. Antennae 11-articulatae, sub frontis margine ante oculos insertae, apicem versus sensim incrassatae, articulo ultimo rotundato. Fronte tateribus elevata. Oculi antice emarginati. Prothorax elongatus, carinatus. Scutellum minutum. Elytra punctatostriata, interstitiis

Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

International Nuclear Information System (INIS)

Gonzalez-Barreiro, O.; Rioboo, C.; Herrero, C.; Cid, A.

2006-01-01

The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides

Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

Energy Technology Data Exchange (ETDEWEB)

Gonzalez-Barreiro, O. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Rioboo, C. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Herrero, C. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Cid, A. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain)]. E-mail: cid@udc.es

2006-11-15

The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides.

Molluscan shell evolution with review of shell calcification hypothesis

Czech Academy of Sciences Publication Activity Database

Furuhashi, T.; Schwarzinger, C.; Mikšík, Ivan; Smrž, Miloslav; Beran, A.

2009-01-01

Roč. 154, č. 3 (2009), s. 351-371 ISSN 1096-4959 Institutional research plan: CEZ:AV0Z50110509 Keywords : mollusca * shell * biomineralization Subject RIV: CE - Biochemistry Impact factor: 1.607, year: 2009

Estudos higiênicos sôbre os crustáceos e moluscos da Baía de Guanabara (Rio de Janeiro

Directory of Open Access Journals (Sweden)

Lejeune Pacheco Henriques de Oliveira

1944-04-01

Full Text Available Revisão da literatura médica sôbre higiene de crustáceos e moluscos marinhos. Intoxicações por elementos extranhos às carnes de crustáceos e moluscos: por sais de cobre, vegetais tóxicos; estranho e chumbo nas conservas de crustáceos; botulismo. Putrefação de ostras e doenças de ostras provocadas por cogumelos; crustáceos e moluscos guardados em geladeiras bolorentas. Lista das espécies de moluscos comestíveis da Bahia de Guanabara. Lista das espécies de crustáceos comestíveis da Bahia de Guanabara. Veiculação de micro-organismos patogênicos ao homem por intermédio das carnes de crustáceos e de moluscos: veiculação do vibrião colérico, dos bacilos tíficos e paratíficos e de germes do grupo coli e do gênero Proteus. Vitalidade dos bacilos tíficos nas ostras. Listas dos moluscos veiculadores dos agentes causadores das febres tíficas e paratíficas. Conceitos antigos e modernos sõbre intoxicações por crustáceos; partidas de crustáceos salubres ou não conforme o local de venda. Estudos experimentais sôbre a "talassina" princípio tóxico existente em alguns crustáceos. "Mitilotoxina", intoxicações por mexilhões e outros acidentes incriminados aos moluscos. Enterotoxina estavfilocócica em ostras. Métodos de determinação da salubridade dos moluscos; verificações nas ostras brasileiras. Depuração dos crustáceos pelas soluções cloradas. Estabulação de caranguejos denominados vulgarmente de "guaiamus" e "ussás".Recording main medical publication on Hygiene of Mollusca and Crustacea. Food-poisoning. Decomposing oysters, and shell-fish sickness by fungi. Catalogue of eatable Crustacea and Mollusca of Rio de Janeiro. Significance of Mollusca and Crustacea in the spread of diseases. Longevity of Vibrio comma, Eberthella typhosa, Salmonella schottmuelleri, Salmonella paratiphi. Escherichia coli in oysters, Microorganisms in marked oysters. Comparison old written papers with moderns publications on food

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

Plankton composition in the coastal waters between Jaigarh and Rajapur along west coast of India

Digital Repository Service at National Institute of Oceanography (India)

Nair, S.R.S.; Achuthankutty, C.T.; Nair, V.R.; Devassy, V.P.

, Mollusca, Decapoda, Chaetognatha, Tunicata and fish eggs and larvae were the major groups in the zooplankton population. The highest secondary production values were obtained off Ratnagiri and the average production for the Konkan coastal waters was found...

PipY, a Member of the Conserved COG0325 Family of PLP-Binding Proteins, Expands the Cyanobacterial Nitrogen Regulatory Network

Directory of Open Access Journals (Sweden)

José I. Labella

2017-07-01

Full Text Available Synechococcus elongatus PCC 7942 is a paradigmatic model organism for nitrogen regulation in cyanobacteria. Expression of genes involved in nitrogen assimilation is positively regulated by the 2-oxoglutarate receptor and global transcriptional regulator NtcA. Maximal activation requires the subsequent binding of the co-activator PipX. PII, a protein found in all three domains of life as an integrator of signals of the nitrogen and carbon balance, binds to PipX to counteract NtcA activity at low 2-oxoglutarate levels. PII-PipX complexes can also bind to the transcriptional regulator PlmA, whose regulon remains unknown. Here we expand the nitrogen regulatory network to PipY, encoded by the bicistronic operon pipXY in S. elongatus. Work with PipY, the cyanobacterial member of the widespread family of COG0325 proteins, confirms the conserved roles in vitamin B6 and amino/keto acid homeostasis and reveals new PLP-related phenotypes, including sensitivity to antibiotics targeting essential PLP-holoenzymes or synthetic lethality with cysK. In addition, the related phenotypes of pipY and pipX mutants are consistent with genetic interactions in the contexts of survival to PLP-targeting antibiotics and transcriptional regulation. We also showed that PipY overexpression increased the length of S. elongatus cells. Taken together, our results support a universal regulatory role for COG0325 proteins, paving the way to a better understanding of these proteins and of their connections with other biological processes.

Toward solar biodiesel production from CO2 using engineered cyanobacteria.

Science.gov (United States)

Woo, Han Min; Lee, Hyun Jeong

2017-05-01

Metabolic engineering of cyanobacteria has received attention as a sustainable strategy to convert carbon dioxide to various biochemicals including fatty acid-derived biodiesel. Recently, Synechococcus elongatus PCC 7942, a model cyanobacterium, has been engineered to convert CO2 to fatty acid ethyl esters (FAEEs) as biodiesel. Modular pathway has been constructed for FAEE production. Several metabolic engineering strategies were discussed to improve the production levels of FAEEs, including host engineering by improving CO2 fixation rate and photosynthetic efficiency. In addition, protein engineering of key enzyme in S. elongatus PCC 7942 was implemented to address issues on FAEE secretions toward sustainable FAEE production from CO2. Finally, advanced metabolic engineering will promote developing biosolar cell factories to convert CO2 to feasible amount of FAEEs toward solar biodiesel. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Molluscan shell colour.

Science.gov (United States)

Williams, Suzanne T

2017-05-01

The phylum Mollusca is highly speciose, and is the largest phylum in the marine realm. The great majority of molluscs are shelled, including nearly all bivalves, most gastropods and some cephalopods. The fabulous and diverse colours and patterns of molluscan shells are widely recognised and have been appreciated for hundreds of years by collectors and scientists alike. They serve taxonomists as characters that can be used to recognise and distinguish species, however their function for the animal is sometimes less clear and has been the focus of many ecological and evolutionary studies. Despite these studies, almost nothing is known about the evolution of colour in molluscan shells. This review summarises for the first time major findings of disparate studies relevant to the evolution of shell colour in Mollusca and discusses the importance of colour, including the effects of visual and non-visual selection, diet and abiotic factors. I also summarise the evidence for the heritability of shell colour in some taxa and recent efforts to understand the molecular mechanisms underpinning synthesis of shell colours. I describe some of the main shell pigments found in Mollusca (carotenoids, melanin and tetrapyrroles, including porphyrins and bile pigments), and their durability in the fossil record. Finally I suggest that pigments appear to be distributed in a phylogenetically relevant manner and that the synthesis of colour is likely to be energetically costly. © 2016 Cambridge Philosophical Society.

Benthos off Cochin, Southwest coast of India

Digital Repository Service at National Institute of Oceanography (India)

Harkantra, S.N.; Parulekar, A.H.

Macro-invertebrate benthic fauna off Cochin mainly composed of polychaeta (82.45%), crustacea (7.62%), mollusca (5.92%), sipuncula (2.25%), nemertinea (0.96%) and echinodermata (0.80%). The maximum population density and biomass values were 304 plus...

Early development of the aplacophoran mollusc Chaetoderma

DEFF Research Database (Denmark)

Nielsen, Claus; Haszprunar, Gerhard; Ruthensteiner, Bernhard

2007-01-01

The early development of the trochophore larva of the aplacophoran Chaetoderma nitidulum (Mollusca: Caudofoveata = Chaetodermomorpha) is described using scanning and transmission electron microscopy and using fluorescence staining and confocal laser scanning microscopy of the muscle system...

Description d’une nouvelle espèce de Gyrinide du Musée de Leyde

NARCIS (Netherlands)

Regimbart, M.

1884-01-01

Long. 6 3/4 mm. (ano excepto). — Oblongo-ovalis, elongatus, mediocriter convexus; supra in regionibus glabris purpureocupreus, nitidus, subtilissime reticulatus, in regionibus punctato-tomentosis obscure cœruleus et subopacus, anguste pallide testaceo limbatus; infra pallide testaceus, pedibus

New synonymy in Cuban Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini)

Science.gov (United States)

Examination of holotypes of Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini) in the Fernando de Zayas collection (Havana, Cuba) and the Museum of Comparative Zoology, Harvard University reveals that T. elongatus Zayas (1975) is a new synonym of T. rufipes Fisher (1942)....

(Lamark) (Mollusca: Bivalvia)

African Journals Online (AJOL)

Figure 2 Mean monthly surface water temperature and salinity values ..... Excluding the effect of the flood, the progression of the .... Growth and metabolism of Mactra lilacea. Abstract ... tolerance and osmoregulation in some estuarine bivalves.

Species-specific differences of the spectroscopic properties of P700 - Analysis of the influence of non-conserved amino acid residues by site-directed mutagenesis of photosystem I from Chlamydomonas reinhardtii

NARCIS (Netherlands)

Witt, H.; Bordignon, E.; Carbonera, D.; Dekker, J.P.; Karapetyan, N.; Teutloff, C.; Webber, A.; Lubitz, W.; Schlodder, E.

2003-01-01

We applied optical spectroscopy, magnetic resonance techniques, and redox titrations to investigate the properties of the primary electron donor P700 in photosystem I (PS I) core complexes from cyanobacteria (Thermosynechococcus elongatus, Spirulina platensis, and Synechocystis sp. PCC 6803), algae

Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride

NARCIS (Netherlands)

Guskov, Albert; Kern, Jan; Gabdulkhakov, Azat; Broser, Matthias; Zouni, Athina; Saenger, Wolfram

Photosystem II (PSII) is a large homodimeric protein-cofactor complex located in the photosynthetic thylakoid membrane that acts as light-driven water:plastoquinone oxidoreductase. The crystal structure of PSII from Thermosynechococcus elongatus at 2.9-A resolution allowed the unambiguous assignment

Intragenomic sequence variation at the ITS1 - ITS2 region and at the 18S and 28S nuclear ribosomal DNA genes of the New Zealand mud snail, Potamopyrgus antipodarum (Hydrobiidae: mollusca)

Science.gov (United States)

Hoy, Marshal S.; Rodriguez, Rusty J.

2013-01-01

Molecular genetic analysis was conducted on two populations of the invasive non-native New Zealand mud snail (Potamopyrgus antipodarum), one from a freshwater ecosystem in Devil's Lake (Oregon, USA) and the other from an ecosystem of higher salinity in the Columbia River estuary (Hammond Harbor, Oregon, USA). To elucidate potential genetic differences between the two populations, three segments of nuclear ribosomal DNA (rDNA), the ITS1-ITS2 regions and the 18S and 28S rDNA genes were cloned and sequenced. Variant sequences within each individual were found in all three rDNA segments. Folding models were utilized for secondary structure analysis and results indicated that there were many sequences which contained structure-altering polymorphisms, which suggests they could be nonfunctional pseudogenes. In addition, analysis of molecular variance (AMOVA) was used for hierarchical analysis of genetic variance to estimate variation within and among populations and within individuals. AMOVA revealed significant variation in the ITS region between the populations and among clones within individuals, while in the 5.8S rDNA significant variation was revealed among individuals within the two populations. High levels of intragenomic variation were found in the ITS regions, which are known to be highly variable in many organisms. More interestingly, intragenomic variation was also found in the 18S and 28S rDNA, which has rarely been observed in animals and is so far unreported in Mollusca. We postulate that in these P. antipodarum populations the effects of concerted evolution are diminished due to the fact that not all of the rDNA genes in their polyploid genome should be essential for sustaining cellular function. This could lead to a lessening of selection pressures, allowing mutations to accumulate in some copies, changing them into variant sequences.                   

Rostrokonchy z devonských sedimentů moravskoslezské pánve

Czech Academy of Sciences Publication Activity Database

Weinerová, Hedvika; Weiner, Tomáš; Hladil, Jindřich

2017-01-01

Roč. 50, č. 1 (2017), s. 153-157 ISSN 0514-8057 R&D Projects: GA ČR GA14-18183S Institutional support: RVO:67985831 Keywords : Rostroconchia * Mollusca * Devonian * Moravo-Silesian Basin Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology

Identification of Genes Related to Learning and Memory in the Brain Transcriptome of the Mollusc, "Hermissenda Crassicornis"

Science.gov (United States)

Tamvacakis, Arianna N.; Senatore, Adriano; Katz, Paul S.

2015-01-01

The sea slug "Hermissenda crassicornis" (Mollusca, Gastropoda, Nudibranchia) has been studied extensively in associative learning paradigms. However, lack of genetic information previously hindered molecular-level investigations. Here, the "Hermissenda" brain transcriptome was sequenced and assembled de novo, producing 165,743…

Micrallecto uncinata n. gen., n.sp., a parasitic copepod from a remarkable host, the pteropod Pneumoderma

NARCIS (Netherlands)

Stock, Jan H.

1971-01-01

A new genus and species of copepod crustacean parasite, Micrallecto uncinata, is described from Pneumoderma pygmaeum (Tesch, 1903), a gymnosome pteropod (Mollusca) collected West of Bermuda. The parasite probably belongs to the family Splanchnotrophidae and is the first copepod associate reported

Genome Engineering of the 2,3-Butanediol Biosynthetic Pathway for Tight Regulation in Cyanobacteria.

Science.gov (United States)

Nozzi, Nicole E; Atsumi, Shota

2015-11-20

Cyanobacteria have gained popularity among the metabolic engineering community as a tractable photosynthetic host for renewable chemical production. However, though a number of successfully engineered production systems have been reported, long-term genetic stability remains an issue for cyanobacterial systems. The genetic engineering toolbox for cyanobacteria is largely lacking inducible systems for expression control. The characterization of tight regulation systems for use in cyanobacteria may help to alleviate this problem. In this work we explore the function of the IPTG inducible promoter P(L)lacO1 in the model cyanobacterium Synechococcus elongatus PCC 7942 as well as the effect of gene order within an operon on pathway expression. According to our experiments, P(L)lacO1 functions well as an inducible promoter in S. elongatus. Additionally, we found that gene order within an operon can strongly influence control of expression of each gene.

AN EVALUATION OF THREE CONVENTIONAL HISTOLOGICAL TECHNIQUES FOR STAINING THE CERATA OF CRATENA PILATA

Science.gov (United States)

Fixation and staining methods for different types of tissue in the marine nudibranch Cratena pilata were evaluated. Cratena pilata, a marine snail in the Phylum Mollusca, has the ability to take stinging cells, called nematocysts, from ingested animals belonging to another phylum...

Phylogenetic study of the oxytocin-like immunoreactive system in invertebrates.

Science.gov (United States)

Mizuno, J; Takeda, N

1988-01-01

1. A phylogenetic study of oxytocin (OXT)-like immunoreactive cells was performed by the PAP method in the central nervous system of invertebrates. 2. The immunoreactivity was detected in the nerve cells of Hydra magnipapillata of the Coelenterata; Neanthes japonica and Pheretima communissima of the Annelida; Oncidium verrucosum, Limax marginatus and Meretrix lamarckii of the Mollusca; and Baratha brassica of the Arthropoda. 3. No immunoreactive cells were found in Bipalium sp. of the Platyhelminthes; Pomacea canaliculata, Aplysia kurodai, Bradybaena similaris and Achatina fulica of the Mollusca; and Gnorimosphaeroma rayi, Procambarus clarkii, Hemigrapsus sanguineus, Helice tridens and Gryllus bimaculatus of the Arthropoda; Asterina pectinifera of the Echinodermata; and Halocynthia roretzi of the Protochordata. 4. These results demonstrate that an OXT-immunoreactive substance is widely present not only in vertebrates but also in invertebrates. 5. OXT seems to have been introduced into these invertebrates at an early stage of their phylogenetic history.

Coléoptères nouveaux de l’Afrique du Musée de Leyde

NARCIS (Netherlands)

Fairmaire, L.

1888-01-01

Long. 22 à 25 mill. — Elongatus, convexus, fuscus aut brunneo-castaneus, modice nitidus, fulvo-pubescens; capite dense punctato, inter oculos sat late impresso, antice declivi, margine obtuse rotundato; antennis fuscis, medium corporis attingentibus, articulo 1° punctato, 2° minuto, 3° vix majore,

Electric field effects on red chlorophylls, b-carotenes and P700 in cyanobacterial photosystem I complexes.

NARCIS (Netherlands)

Frese, R.N.; Palacios, M.A.; Azzizi, A.; van Stokkum, I.H.M.; Kruip, J.; Rögner, M.; Karapetyan, N.V.; Schlodder, E.; van Grondelle, R.; Dekker, J.P.

2002-01-01

We have probed the absorption changes due to an externally applied electric field (Stark effect) of Photosystem I (PSI) core complexes from the cyanobacteria Synechocystis sp. PCC 6803, Synechococcus elongatus and Spirulina platensis. The results reveal that the so-called C719 chlorophylls in S.

Some Silurian (Llandovery) monograptids from Saudi Arabia

NARCIS (Netherlands)

El-Khayal, A.A.

1985-01-01

Three species of Monograptus are recognized from Qusayba, Al-Qasim Province, Saudi Arabia. The Qusayba Shales Member of the Tabuk Formation in central Saudi Arabia contains M. decipiens decipiens, M. ex gr. barrandei and M. elongatus, associated with other graptolites. This assemblage is indicative

Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

DEFF Research Database (Denmark)

Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf

2014-01-01

A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...

Food selection preference of different ages and sizes of black tiger ...

African Journals Online (AJOL)

Yomi

2012-03-15

Mar 15, 2012 ... Key words: Aquaculture, natural food, Penaeus monodon, Malaysia. INTRODUCTION ... Many researchers who reported on the diet of Penaeus species in ..... matter, annelida, mollusca and small fish in estuarine water. .... planktonic and benthic communities to fertilizer and feed application in shrimp ...

Stratigrafie a malakofauna holocenní výplně jeskyně Pod valem (Zádielská tiesňava, NP Slovenský kras)

Czech Academy of Sciences Publication Activity Database

Ložek, Vojen

2011-01-01

Roč. 2010, - (2011), s. 62-65 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Slovak Karst * cave fill * extreme habitat * Holocene * Mollusca * Zebrina detrita Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2010/zpravy-2010-14.pdf

Chronostratigrafická revize a paleoklimatický význam osypu pod stěnou Martinky (CHKO) v Biosférické rezervaci Pálava

Czech Academy of Sciences Publication Activity Database

Ložek, Vojen

2011-01-01

Roč. 2010, - (2011), s. 66-69 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Pálava Mils * talus deposit * Mollusca * Climatic Optimum * erosion Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2010/zpravy-2010-15.pdf

Water SA - Vol 43, No 2 (2017)

African Journals Online (AJOL)

Sensitivity to selected contaminants in a biological early warning system using Anodonta woodiana (Mollusca) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Luisa Giari, Fabio Vincenzi, Elisa Anna Fano, Ivano Graldi, Fernando Gelli, Giuseppe Castaldelli, 200-208.

Applicability of the black slug Arion ater for monitoring exposure to polycyclic aromatic hydrocarbons and their subsequent bioactivation into DNA binding metabolites

NARCIS (Netherlands)

Hamers, T.; Kalis, E.J.J.; Berg, van den J.H.J.; Maas, L.M.; Schooten, van F.J.; Murk, A.J.

2004-01-01

The applicability of terrestrial black slugs Arion ater (Mollusca, Gastropoda) was studied for biomonitoring environmental exposure to polycyclic aromatic hydrocarbons (PAHs). In laboratory experiments, slugs were orally exposed to benzo[a]pyrene (BaP) for a short term (3 days) or a long term (119

Two new species of Colletteidae (Crustacea: Tanaidacea: Tanaidomorpha from Bransfield Strait, Antarctica

Directory of Open Access Journals (Sweden)

Juliana L. Segadilha

2017-11-01

Full Text Available Samples from deep benthic areas in the Bransfield Strait, Antarctica, revealed the presence of two new species of Colletteidae: Filitanais elongatus sp. nov. and Macrinella lavradoae sp. nov. Filitanais elongatus sp. nov. resembles F. moskalevi in its habitus; it can, however, be distinguished by characters such as the pleonites and pleotelson with lateral margins parallel and the uropod exopod being longer than half of the first endopod article. Macrinella lavradoae sp. nov. differs from the other species of Macrinella in the shape of the uropod and the pleotelson, with the uropod exopod shorter than the first article of the endopod, the uropod about as long as the pleotelson and the pleotelson with a rounded tip. The number of species of Tanaidacea recorded from Antarctica increases to 162, while the colletteids are now represented by 16 species. Moreover, the diagnosis of the genus Filitanais is herein modified.

Vertigo substriata Jeffreys, faunae neerlandicae nova species, een zoogenaamd glaciaalrelikt

NARCIS (Netherlands)

Sunier, A.L.J.

1926-01-01

I. HET NEDERLANDSCHE MATERIAAL VAN VERTIGO SUBSTRIATA JEFFR.. Onder het vaak interessante materiaal van Nederlandsche Mollusca, dat den laatsten tijd door de Heeren W. F. van Hell en J. A. Nijkamp, studenten in de biologie te Leiden, aan 's Rijks Museum van Natuurlijke Historie werd afgestaan, trof

The oyster genome reveals stress adaptation and complexity of shell formation

DEFF Research Database (Denmark)

Zhang, Guofan; Fang, Xiaodong; Guo, Ximing

2012-01-01

The Pacific oyster Crassostrea gigas belongs to one of the most species-rich but genomically poorly explored phyla, the Mollusca. Here we report the sequencing and assembly of the oyster genome using short reads and a fosmid-pooling strategy, along with transcriptomes of development and stress re...

Malakostratigrafie vchodového valu Medvědí jeskyně ve Slovenském ráji

Czech Academy of Sciences Publication Activity Database

Ložek, Vojen

2012-01-01

Roč. 2011, podzim (2012), s. 219-222 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Slovenský raj * Medvedia Cave * entrance rampart * Holocene * Mollusca * foam sinter Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2011/zpravy_2011-49.pdf

Bivalve wood borings of the ichnogenus Teredolites Leymerie from the Bohemian Cretaceous Basin (Upper Cretaceous, Czech Republic)

Czech Academy of Sciences Publication Activity Database

Kříž, J.; Mikuláš, Radek

2006-01-01

Roč. 13, č. 3 (2006), s. 159-174 ISSN 1042-0940 Institutional research plan: CEZ:AV0Z30130516 Keywords : Borings * Mollusca * sedimentary environment Subject RIV: EG - Zoology http://rzblx1.uni-regensburg.de/ezeit/detail.phtml?bibid=CASCR& colors =7&lang=en&jour_id=41560

Hawaii Energy Resource Overviews. Volume 3. Hawaiian ecosystem and its environmental determinants with particular emphasis on promising areas for geothermal development

Energy Technology Data Exchange (ETDEWEB)

Siegel, S.M.

1980-06-01

A brief geobiological history of the Hawaiian Islands is presented. Climatology, physiography, and environmental degradation are discussed. Soil types and associations, land use patterns and ratings, and vegetation ecology are covered. The fauna discussed include: ancient and recent vertebrate life, land mollusca, marine fauma, and insect fauna. (MHR)

The role of host specificity in explaining the invasion success of the freshwater mussel Anodonta woodiana in Europe

Czech Academy of Sciences Publication Activity Database

Douda, K.; Vrtílek, Milan; Slavík, O.; Reichard, Martin

2012-01-01

Roč. 14, č. 1 (2012), s. 127-137 ISSN 1387-3547 R&D Projects: GA AV ČR KJB600930802 Institutional research plan: CEZ:AV0Z60930519 Keywords : aquatic habitat * Bivalvia * host-parasite relationship * host specificity * Mollusca Subject RIV: EG - Zoology Impact factor: 2.509, year: 2012

Physico-chemical characteristics and abundance of aquatic ...

African Journals Online (AJOL)

Macroinvertebrates abundance shows that, out of the total number of species identified, 14 were arthropods, distributed among 3 classes; 10 species were of class Insecta, 2 species from class Arachnida and 2 species from the class Crustacean. Phylum Mollusca and phylum Annelida had 2 and 1 species, respectively.

The evolution of shell form in tropical terrestrial microsnails

NARCIS (Netherlands)

Liew, Thor Seng

2014-01-01

Mollusca form an important animal phylum that first appeared in the Cambrian, and today is,after Arthropoda, the second largest animal phylum, with more than 100,000 extant species(Bieler, 1992, Brusca and Brusca, 2003), with the class Gastropoda accounting for 80% of the extant species in the

Minimal tool set for a prokaryotic circadian clock.

Science.gov (United States)

Schmelling, Nicolas M; Lehmann, Robert; Chaudhury, Paushali; Beck, Christian; Albers, Sonja-Verena; Axmann, Ilka M; Wiegard, Anika

2017-07-21

Circadian clocks are found in organisms of almost all domains including photosynthetic Cyanobacteria, whereby large diversity exists within the protein components involved. In the model cyanobacterium Synechococcus elongatus PCC 7942 circadian rhythms are driven by a unique KaiABC protein clock, which is embedded in a network of input and output factors. Homologous proteins to the KaiABC clock have been observed in Bacteria and Archaea, where evidence for circadian behavior in these domains is accumulating. However, interaction and function of non-cyanobacterial Kai-proteins as well as homologous input and output components remain mainly unclear. Using a universal BLAST analyses, we identified putative KaiC-based timing systems in organisms outside as well as variations within Cyanobacteria. A systematic analyses of publicly available microarray data elucidated interesting variations in circadian gene expression between different cyanobacterial strains, which might be correlated to the diversity of genome encoded clock components. Based on statistical analyses of co-occurrences of the clock components homologous to Synechococcus elongatus PCC 7942, we propose putative networks of reduced and fully functional clock systems. Further, we studied KaiC sequence conservation to determine functionally important regions of diverged KaiC homologs. Biochemical characterization of exemplary cyanobacterial KaiC proteins as well as homologs from two thermophilic Archaea demonstrated that kinase activity is always present. However, a KaiA-mediated phosphorylation is only detectable in KaiC1 orthologs. Our analysis of 11,264 genomes clearly demonstrates that components of the Synechococcus elongatus PCC 7942 circadian clock are present in Bacteria and Archaea. However, all components are less abundant in other organisms than Cyanobacteria and KaiA, Pex, LdpA, and CdpA are only present in the latter. Thus, only reduced KaiBC-based or even simpler, solely KaiC-based timing systems

Ecology of benthic production in the coastal zone of Goa

Digital Repository Service at National Institute of Oceanography (India)

Harkantra, S.N.; Parulekar, A.H.

was comprised of Polychaeta (58.5%), Mollusca (18.1%), Crustacea (9.1%), Echinodermata (7.1%) and other minor taxa (7.3%) Population count and biomass varied from 25 to 7823 m-2 (X- = 1256 m-2) and 0.2 to 2251.25 g m-2 (X- = 67.07 g m-2) respectively The higher...

Natural Diet of Callinectes ornatus Ordway, 1863 (Decapoda, Portunidae in the Itapocoroy Inlet, Penha, SC, Brazil

Directory of Open Access Journals (Sweden)

Joaquim Olinto Branco

2002-03-01

Full Text Available From January to December 1995, 332 individuals of the Callinectes ornatus species were collected from the Itapocoroy inlet in Penha, Sta. Catarina, Brazil to study its natural diet and the seasonal variations of diet. Results showed a diversified trophic spectrum with a generalized dietary strategy comprising the algae, macrophyta, foraminiferida, mollusca, polychaeta, crustacea, echinodermata, Osteichthyes and NIOM (Nonidentified Organic Matter groups.Alimentação natural de Callinectes ornatus Ordway, 1863 (Decapoda, Portunidae na Armação do Itapocoroy, Penha, SC - Brasil. No período de janeiro a dezembro de 1995, foram coletados 332 indivíduos de Callinectes ornatus, procedentes da Armação do Itapocoroy (Penha, SC. Foi estudada a alimentação natural da espécie e as variações sazonais da dieta. Os resultados mostram um espectro trófico diversificado, com estratégia alimentar generalista, sendo Algas, Macrófitas, Foraminiferida, Mollusca, Polychaeta, Crustacea, Echinodermata, Osteichthyes e matéria orgânica não identificada, os grupos que compõem sua dieta.

Larval trematodes in freshwater molluscs from the Elbe to Danube rivers (Southeast Germany): before and today

Czech Academy of Sciences Publication Activity Database

Faltýnková, Anna; Haas, W.

2006-01-01

Roč. 99, č. 5 (2006), s. 572-582 ISSN 0932-0113 R&D Projects: GA AV ČR IAA6022404; GA ČR GD524/03/H133; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Trematoda * cercariae * Mollusca Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.140, year: 2006

Toward the crystallization of photosystem II core complex from Pisum sativum L

Czech Academy of Sciences Publication Activity Database

Prudnikova, T.; Gavira, J. A.; Řezáčová, Pavlína; Molina, E.P.; Hunalová, Ivana; Sviridova, E.; Schmidt, V.; Kohoutová, J.; Kutý, Michal; Kaftan, D.; Vácha, F.; Garcia-Ruiz, J. M.; Kutá-Smatanová, Ivana

2010-01-01

Roč. 10, č. 8 (2010), s. 3391-3396 ISSN 1528-7483 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50510513; CEZ:AV0Z60870520; CEZ:AV0Z40550506 Keywords : crystal-structure * cyanobacterial * elongatus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.390, year: 2010

Determination of shell deposition rates of Arctica islandica from the New York Bight using natural 228Ra and 228Th and bomb-produced 14C

International Nuclear Information System (INIS)

Turekian, K.K.; Cochran, J.K.; Nozaki, Y.; Thompson, I.; Jones, D.S.

1982-01-01

Shell deposition rates of specimens of Arctica islandica (Mollusca: Bivalvia) from the New York Bight were determined using natural 228 Ra and 228 Th and bomb 14 C. The specimens from deep (>55 m) offshore waters show annual growth banding. A shell obtained from the inner bight at <30-m depth seems to be younger than indicated by band counting

Towards a synthetic chloroplast.

Directory of Open Access Journals (Sweden)

Christina M Agapakis

2011-04-01

Full Text Available The evolution of eukaryotic cells is widely agreed to have proceeded through a series of endosymbiotic events between larger cells and proteobacteria or cyanobacteria, leading to the formation of mitochondria or chloroplasts, respectively. Engineered endosymbiotic relationships between different species of cells are a valuable tool for synthetic biology, where engineered pathways based on two species could take advantage of the unique abilities of each mutualistic partner.We explored the possibility of using the photosynthetic bacterium Synechococcus elongatus PCC 7942 as a platform for studying evolutionary dynamics and for designing two-species synthetic biological systems. We observed that the cyanobacteria were relatively harmless to eukaryotic host cells compared to Escherichia coli when injected into the embryos of zebrafish, Danio rerio, or taken up by mammalian macrophages. In addition, when engineered with invasin from Yersinia pestis and listeriolysin O from Listeria monocytogenes, S. elongatus was able to invade cultured mammalian cells and divide inside macrophages.Our results show that it is possible to engineer photosynthetic bacteria to invade the cytoplasm of mammalian cells for further engineering and applications in synthetic biology. Engineered invasive but non-pathogenic or immunogenic photosynthetic bacteria have great potential as synthetic biological devices.

Algal and invertebrate bioindicators detect sewage effluent along the coast of Titahi Bay, Wellington, New Zealand

International Nuclear Information System (INIS)

Dudley, B.D.; Shima, J.S.

2010-01-01

Sewage effluent contains both dissolved and particulate matter that can affect coastal ecosystems and cascade through food webs. We used δ 15 N and δ 13 C ratios to explore performance of a kelp (Carpophyllum maschalocarpum) and two invertebrates (a grazing isopod, Amphoroidea media, and a filter-feeding crab, Petrolisthes elongatus) as bioindicators along a gradient of sewage exposure. These species vary in trophic status and, consequently, are likely to assimilate sewage constituents differently into food webs. δ 15 N values in C. maschalocarpum and A. media were highest near the sewage outfall and decreased with increasing distance from the outfall. δ 13 C values in these two species did not appear to be reliable predictors of sewage concentrations in seawater. In contrast, δ 13 C ratios for P. elongatus were consistently depleted at sites nearest the sewage outfall, indicating the consumption of δ 13 C-depleted sewage particulates. These results suggest there is value in multiple-isotope and multi-species bioindicator approaches both for detecting sewage dispersal patterns and understanding the incorporation of sewage-derived nutrients into food webs. (author). 79 refs., 3 figs.

Dynamics of macrozoobenthos in the Southern Bulgarian Black Sea coastal and open-sea areas

Directory of Open Access Journals (Sweden)

S. STOYKOV

2001-06-01

Full Text Available The paper presents results of analysis of 96 macrozoobenthic samples, collected on a seasonal basis in Bourgas Bay and in open-sea areas offshore Cape Emine (Bulgarian Black Sea in 1996 and 1998. In total 96 taxa were established, distributed in four groups: Polychaeta, Mollusca, Crustacea and “Diversa”. The average density of populations was 1756 ind.m-2 with a predominating abundance of Polychaeta species. The average biomass estimated was 183.02 g.m-2, formed mainly by representatives of Mollusca. The latter species were measured together with the shells, which appraised their individual weights. Seven of the species found had a coefficient of constancy more than 50%. These were the most adapted species to the environmental conditions of the investigated areas. The quantitative and qualitative assessments in this study demonstrate an increasing tendency in the parameters obtained (density, biomass, species diversity in comparison with previous investigations in the early 1990-s, when intensive anthropogenic influence was widely perceived to misbalance the Black Sea ecosystem. The method of Warwick (1986 applied to characterize the water quality of the studied areas allowed us to define them as rather clean or moderately polluted aquatories.

Lego clocks: building a clock from parts.

Science.gov (United States)

Brunner, Michael; Simons, Mirre J P; Merrow, Martha

2008-06-01

A new finding opens up speculation that the molecular mechanism of circadian clocks in Synechococcus elongatus is composed of multiple oscillator systems (Kitayama and colleagues, this issue, pp. 1513-1521), as has been described in many eukaryotic clock model systems. However, an alternative intepretation is that the pacemaker mechanism-as previously suggested-lies primarily in the rate of ATP hydrolysis by the clock protein KaiC.

A new species of Parichoronyssus (Acari: Dermanyssoidea: Macronyssidae) from bats of the genus Phyllostomus (Chiroptera: Phyllostomidae) in Peru and Venezuela, with keys to the species of Parichoronyssus.

Science.gov (United States)

Morales-Malacara, Juan B; Guerrero, Ricardo

2007-01-01

Parichoronyssus bakeri new species was found on two phyllostomid bats species, the greater spear-nosed bat, Phyllostomus hastatus (Pallas), and the lesser spear-nosed bat, Phyllostomus elongatus (E. Geoffroy), in Pakitza, National Park Manu, Madre de Dios, Peru, including additional material examined from Venezuela. The female, male, deutonymph, and protonymph are described and illustrated. A key to the seven species of Parichoronyssus is provided.

Live microbial cells adsorb Mg2+ more effectively than lifeless organic matter

Science.gov (United States)

Qiu, Xuan; Yao, Yanchen; Wang, Hongmei; Duan, Yong

2018-03-01

The Mg2+ content is essential in determining different Mg-CaCO3 minerals. It has been demonstrated that both microbes and the organic matter secreted by microbes are capable of allocating Mg2+ and Ca2+ during the formation of Mg-CaCO3, yet detailed scenarios remain unclear. To investigate the mechanism that microbes and microbial organic matter potentially use to mediate the allocation of Mg2+ and Ca2+ in inoculating systems, microbial mats and four marine bacterial strains ( Synechococcus elongatus, Staphylococcus sp., Bacillus sp., and Desulfovibrio vulgaris) were incubated in artificial seawater media with Mg/Ca ratios ranging from 0.5 to 10.0. At the end of the incubation, the morphology of the microbial mats and the elements adsorbed on them were analyzed using scanning electronic microscopy (SEM) and energy diffraction spectra (EDS), respectively. The content of Mg2+ and Ca2+ adsorbed by the extracellular polysaccharide substances (EPS) and cells of the bacterial strains were analyzed with atomic adsorption spectroscopy (AAS). The functional groups on the surface of the cells and EPS of S. elongatus were estimated using automatic potentiometric titration combined with a chemical equilibrium model. The results show that live microbial mats generally adsorb larger amounts of Mg2+ than Ca2+, while this rarely is the case for autoclaved microbial mats. A similar phenomenon was also observed for the bacterial strains. The living cells adsorb more Mg2+ than Ca2+, yet a reversed trend was observed for EPS. The functional group analysis indicates that the cell surface of S. elongatus contains more basic functional groups (87.24%), while the EPS has more acidic and neutral functional groups (83.08%). These features may be responsible for the different adsorption behavior of Mg2+ and Ca2+ by microbial cells and EPS. Our work confirms the differential Mg2+ and Ca2+ mediation by microbial cells and EPS, which may provide insight into the processes that microbes use to

Antimicrobial peptides in marine invertebrate health and disease

OpenAIRE

Destoumieux-Garzón, Delphine; Rosa, Rafael Diego; Schmitt, Paulina; Barreto, Cairé; Vidal-Dupiol, Jeremie; Mitta, Guillaume; Gueguen, Yannick; Bachère, Evelyne

2016-01-01

Aquaculture contributes more than one-third of the animal protein from marine sources worldwide. A significant proportion of aquaculture products are derived from marine protostomes that are commonly referred to as ‘marine invertebrates’. Among them, penaeid shrimp (Ecdysozosoa, Arthropoda) and bivalve molluscs (Lophotrochozoa, Mollusca) are economically important. Mass rearing of arthropods and molluscs causes problems with pathogens in aquatic ecosystems that are exploited by humans. Remark...

Stonlach content analyses of Gilchristella aestuarius and Hepsetia ...

African Journals Online (AJOL)

Apseudes digitalis. 80 2,2. 6. 5. Decapoda. Zoea larvae. 6 1,0. 3. 2. Unidentified larvae. 0,3. 2. 0. Insecta. Chironomidae larvae. 810 8,1. 67. 0. 13,5. 65. 13. Terrestrial insects. 2 0,4. 4. 0. Pupae. 22 1,1. 4. 2. Arachnida. Araneida. <0,05. 2. 0. Mollusca. Lamellibranch veligers. 9 <0,05. 8. 0 2240 7,5. 69. 6. Gastropod veligers.

Fauna Europaea: Mollusca – Bivalvia

Directory of Open Access Journals (Sweden)

Rafael Araujo

2015-07-01

European freshwater bivalves belong to the Orders Unionoida and Cardiida. All the European unionoids are included in the superfamily Unionoidea, the freshwater mussels or naiads. The European cardiids belong to the following three superfamilies: Cardioidea, Cyrenoidea and Dreissenoidea. Among the Unionoidea there are the most imperilled animal groups on the planet while the Cardioidea includes the cosmopolitan genus Pisidium, the Cyrenoidea the Asiatic clam (Corbicula fluminea and the Dreissenoidea the famous invasive zebra mussel (Dreissena polymorpha. Basic information is summarized on their taxonomy and biology. Tabulations include a complete list of the current estimated families, genera and species.

Pectinoidea (Mollusca: Bivalvia) from Iceland

NARCIS (Netherlands)

Dijkstra, H.H.; Waren, A.; Gudmundsson, G.

2009-01-01

The Icelandic pectinoid fauna is reviewed, based on material from the benthic survey programme BIOICE and 17 species are recorded. Similipecten oskarssoni is proposed as a replacement name for Pecten groenlandicus var. minor Locard, 1898 (Propeamussiidae), which is considered a valid species.

¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez? Does the direct tillage practice in soybean crops favour grasshopper populations (Orthoptera: Acrididae, in Benito Juárez county?

Directory of Open Access Journals (Sweden)

Daniel Scuffi

2012-12-01

Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.Considering the development of the soybean crops using direct tillage in Benito Juárez county, and taking into account that for some authors this practice favours the grasshopper populations, the abundance and species richness in soybean with direct and conventional tillage were evaluated. Seven species were registered (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner and Scotussa lemniscata (Stål. The accumulated richness was similar (p> 0.05, along the different crops; 2.3 ± 0.19 species were registered in

Macroepizoísmo em Libinia ferreirae (Crustacea, Brachyura, Majidae Macroepizoites on Libinia ferreirae (Crustacea, Brachyura, Majidae

Directory of Open Access Journals (Sweden)

Vanessa C. Winter

2006-06-01

Full Text Available Um estudo de distribuição dos macroepizóicos foi realizado numa população do caranguejo-aranha Libinia ferreirae Brito Capello, 1871 proveniente do litoral dos estados do Paraná e de Santa Catarina. O material biológico foi obtido junto aos pescadores, e faz parte do rejeito de pesca. Os caranguejos foram mensurados e os macroepizóicos identificados e contados. Os seguintes macroepizóicos sésseis foram registrados: Calliactis tricolor (Lesueur, 1817 (Cnidaria; Actiniaria (Cnidaria; Arca sp. (Mollusca; Ostreidae (Mollusca; Acanthodesia tenuis (Desor, 1848 (Bryozoa; Cirripedia e duas espécies tubícolas de Gammaridea (Crustacea. Além destes organismos ocorreram dois tubos desabitados e quatro animais vágeis. A anêmona C. tricolor foi a espécie mais abundante e freqüente, sendo, provavelmente, utilizada como mecanismo de camuflagem pelo caranguejo. O macroepizoísmo em L. ferreirae está relacionado com a idade ou tamanho do caranguejo, tendo maior incidência naqueles mais velhos ou de maior porte. Entretanto, a densidade dos macroepizóicos por caranguejo se mantém em torno de três. Não há relação entre o macroepizoísmo e o sexo do hospedeiro; somente fêmeas ovígeras utilizam desse recurso mais freqüentemente do que as não-ovígeras. Devido à maior área de fixação, os macroepizóicos colonizam principalmente a carapaça do caranguejo, enquanto nos pereiópodos há predominância de Bryozoa.A study of the distribution of the macroepizoites was carried out on a population of the spider crab Libinia ferreirae Brito Capello, 1871 from the Southern Brazilian coast. Crabs were obtained from shrimps and fishes by-catch. They were measured, and their macroepizoites were identified and counted. The following sessile macroepizoites were registered: Calliactis tricolor (Lesueur, 1817 (Cnidaria; Actiniaria (Cnidaria; Arca sp. (Mollusca; Ostreidae (Mollusca; Acanthodesia tenuis (Desor, 1848 (Bryozoa; Cirripedia and two species

First report of two species of scarab beetles (Coleoptera, Scarabaeidae inside nests of Azteca cf. chartifex Forel (Hymenoptera, Formicidae in Brazilian Amazonian Rainforest

Directory of Open Access Journals (Sweden)

João Rafael Alves-Oliveira

Full Text Available ABSTRACT We report for the first time the occurrence of two species of scarab beetles, Phileurus carinatus declivis Prell, 1914 (Scarabaeidae: Dynastinae and Cyclidius elongatus (Olivier, 1789 (Cetoniinae: Cremastocheilini inside nests of Azteca cf. chartifex Forel, 1896, a neotropical arboreal ant species. This report indicates that these two beetle species are associated, at least as inquilines, to this ant species, although the nature of this relationship remains unclear.

Effects of CO-60 gamma radiation on the embryonary development of Biomphalaria Glabrata (Say, 1818)

International Nuclear Information System (INIS)

Okazaki, K.

1988-01-01

Some aspects of the effects of the ionizing radiation on the embryo and on the genetical material of Biomphalaria glabrata (Mollusca: Gastropoda) are presented. The embryos weresubmitted at various stages of development to doses of 5,10,15,20 and 25 Gy of Co-60 gamma radiation. As a criteia of evaluation of the embryos radiosensitivity, four biological parameters were used: mortality, malformation, hatching and chromossomal aberrations. (M.A.C.) [pt

Larval trematodes (Digenea) of the great pond snail, Lymnaea stagnalis (L.), (Gastropoda, Pulmonata) in Central Europe: a survey of species and key to their identification

Czech Academy of Sciences Publication Activity Database

Faltýnková, Anna; Našincová, Vanda; Kablásková, Lenka

2007-01-01

Roč. 14, č. 1 (2007), s. 39-51 ISSN 1252-607X R&D Projects: GA AV ČR IAA6022404; GA ČR GP524/07/P086; GA ČR GD524/03/H133; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Trematoda * Mollusca * cercaria * metacercaria * Lymnaea stagnalis Subject RIV: EG - Zoology Impact factor: 0.713, year: 2007

Physiological and biochemical responses to cold and drought in the rock-dwelling pulmonate snail, Chondrina avenacea

Czech Academy of Sciences Publication Activity Database

Košťál, Vladimír; Rozsypal, Jan; Pech, P.; Zahradníčková, Helena; Šimek, Petr

2013-01-01

Roč. 183, č. 6 (2013), s. 749-761 ISSN 0174-1578 R&D Projects: GA ČR GA206/07/0269; GA MZd(CZ) NT11513 Grant - others:GA JU(CZ) 04-062/2011/P Institutional support: RVO:60077344 Keywords : Mollusca * estivation * hibermation Subject RIV: ED - Physiology Impact factor: 2.530, year: 2013 http://link.springer.com/content/pdf/10.1007%2Fs00360-013-0749-0.pdf

Enlightenment of old ideas from new investigations: more questions regarding the evolution of bacteriogenic light organs in squids

OpenAIRE

Nishiguchi, M. K.; Lopez, J. E.; Boletzky, S. v.

2004-01-01

Bioluminescence is widespread among many different types of marine organisms. Metazoans contain two types of luminescence production, bacteriogenic (symbiotic with bacteria) or autogenic, via the production of a luminous secretion or the intrinsic properties of luminous cells. Several species in two families of squids, the Loliginidae and the Sepiolidae (Mollusca: Cephalopoda) harbor bacteriogenic light organs that are found central in the mantle cavity. These light organs are exceptional in ...

Genetic diversity of pacu and piapara broodstocks in restocking programs in the rivers Paraná and Paranapanema (Brazil

Directory of Open Access Journals (Sweden)

Nelson Mauricio Lopera-Barrero

2016-09-01

Full Text Available The genetic diversity of Piaractus mesopotamicus (pacu and Leporinus elongatus (piapara broodstocks used in restocking programs in the rivers Paraná and Paranapanema is analyzed. One hundred and twenty specimens (two broodstocks of each species from fish ponds in Palotina PR Brazil and in Salto Grande SP Brazil were assessed. Ten primers produced 96 fragments, comprising 68 (70.83% and 94 (97.92% polymorphic fragments for P. mesopotamicus and L. elongatus broodstocks, respectively. Differences (p < 0.05 in the frequency of 15 and 27 fragments were detected for each species, without exclusive fragments. Shannon Index (0.347 - 0.572 and the percentage of polymorphic fragments (57.3% - 94.8% revealed high intra-population genetic variability for all broodstocks. Results of molecular variance analyses (AMOVA showed that most variations do not lie between the broodstocks but within each broodstock (89%. Genetic (0.088 and 0.142 and identity (0.916 and 0.868 distance rates demonstrated similarity between the broodstocks of each species, corroborated by Fst (0.1023 and 010.27 and Nm (4.18 and 4.33 rates, with a slight genetic difference due to genic flux. High intrapopulation genetic variability and similarity between the broodstocks of each species was also detected, proving a common ancestry.

Structural analysis of the α subunit of Na(+)/K(+) ATPase genes in invertebrates.

Science.gov (United States)

Thabet, Rahma; Rouault, J-D; Ayadi, Habib; Leignel, Vincent

2016-01-01

The Na(+)/K(+) ATPase is a ubiquitous pump coordinating the transport of Na(+) and K(+) across the membrane of cells and its role is fundamental to cellular functions. It is heteromer in eukaryotes including two or three subunits (α, β and γ which is specific to the vertebrates). The catalytic functions of the enzyme have been attributed to the α subunit. Several complete α protein sequences are available, but only few gene structures were characterized. We identified the genomic sequences coding the α-subunit of the Na(+)/K(+) ATPase, from the whole-genome shotgun contigs (WGS), NCBI Genomes (chromosome), Genomic Survey Sequences (GSS) and High Throughput Genomic Sequences (HTGS) databases across distinct phyla. One copy of the α subunit gene was found in Annelida, Arthropoda, Cnidaria, Echinodermata, Hemichordata, Mollusca, Placozoa, Porifera, Platyhelminthes, Urochordata, but the nematodes seem to possess 2 to 4 copies. The number of introns varied from 0 (Platyhelminthes) to 26 (Porifera); and their localization and length are also highly variable. Molecular phylogenies (Maximum Likelihood and Maximum Parsimony methods) showed some clusters constituted by (Chordata/(Echinodermata/Hemichordata)) or (Plathelminthes/(Annelida/Mollusca)) and a basal position for Porifera. These structural analyses increase our knowledge about the evolutionary events of the α subunit genes in the invertebrates. Copyright © 2016 Elsevier Inc. All rights reserved.

Study on the Tribe Ochyromerini (Coleoptera, Curculionidae) from East Asia I, Descriptions of New Species of the Genera Endaeus and Endaenidius

OpenAIRE

Kojima, Hiroaki; Morimoto, Katsura

1995-01-01

This is the first part of our systematic study on the tribe Ochyromerini (=Endaeini) from East Asia with descriptions of 28 new species of the weevils in the genera Endaeus Schoenherr and Endaenidius Morimoto as follows: Endaeus albolineatus sp. nov. (E. Malaysia), Endaeus niger sp. nov. (E. Malaysia), Endaeus zonatus sp. nov. (E. Malaysia), Endaeus robustus sp. nov. (Thailand), Endaeus longipes sp. nov. (E. Malaysia), Endaeus formosanus sp. nov. (Taiwan), Endaeus elongatus sp. nov. (Taiwan),...

Iron Limitation and the Role of Siderophores in Marine Synechococcus

Science.gov (United States)

2009-06-01

an equilibrium exists between free metal ions in solution and metal ions bound to a cell’s transport enzymes . In this model the metal shifts between...cyanobacterium Synechococcus PCC 6301 and the thermophilic cyanobacterium Synechococcus elongatus. Planta 205: 73-81. Michel, K.P., Pistorius, E.K., and...and nitrogen metabo- lism enzymes (Dean et al., 1993; Geider and La Roche, 1994; Lin and Stewart, 1998), it is a key element with the potential to

Furcocercous cercariae (Trematoda) from freshwater snails in Central Finland

Czech Academy of Sciences Publication Activity Database

Faltýnková, Anna; Niewiadomska, K.; Santos, M. J.; Valtonen, E. T.

2007-01-01

Roč. 52, č. 4 (2007), s. 310-317 ISSN 1230-2821 R&D Projects: GA AV ČR IAA6022404; GA ČR GP524/07/P086; GA ČR GD524/03/H133; GA MŠk LC522 Grant - others: Portuguese FCT(PT) SFRH/BSAB/492/2005 Institutional research plan: CEZ:AV0Z60220518 Keywords : cercariae * Mollusca * Finland * Trematoda * Pulmonata * Prosobranchia * Valvata macrostoma Subject RIV: EG - Zoology Impact factor: 0.814, year: 2007

Water Quality Criteria for Colored Smokes: Solvent Yellow 33

Science.gov (United States)

1987-11-01

Wr e. a benthic crustacean (e.g, ostracod, isopod, or amphipod): f. an insect (e.g., mayfly, midge, stonefly)- g. a family in a phylum other than...Arthropoda or Chordata (e.g, Annelida or Mollusca): and h, a family in any order of insect or any phylum not represented. 2. Acute-chronic ratios (see...acute toxicity to freshwater acuatic animals should be used: a. Tests with daphnids and other cladocerans should be started with organisms < 24 hr old

Patterns of larval distribution and settlement of Concholepas concholepas (Bruguiere, 1789) (Gastropoda, Muricidae) in fjords and channels of southern Chile

OpenAIRE

MOLINET, CARLOS; ARÉVALO, ALEJANDRA; GONZÁLEZ, MARÍA TERESA; MORENO, CARLOS A.; ARATA, JAVIER; NIKLITSCHEK, EDWIN

2005-01-01

The distribution of Concholepas concholepas (Mollusca, Gastropoda, Muricidae) is limited to the coasts of Chile and southern Peru. Almost all studies of this gastropod have been carried out in open coastal systems, rather than the fjords and channels of southern Chile, despite the fact that this area represents ca. 95 % of the total coastline in this country. Although there is a large volume of background literature on C. concholepas, almost nothing is published about early larval development...

Patterns of larval distribution and settlement of Concholepas concholepas (Bruguiere, 1789) (Gastropoda, Muricidae) in fjords and channels of southern Chile Patrones de distribución de larvas y asentamiento de Concholepas concholepas (Bruguiere, 1789) (Gastropoda, Muricidae) en fiordos y canales del sur de Chile

OpenAIRE

CARLOS MOLINET; ALEJANDRA ARÉVALO; MARÍA TERESA GONZÁLEZ; CARLOS A. MORENO; JAVIER ARATA; EDWIN NIKLITSCHEK

2005-01-01

The distribution of Concholepas concholepas (Mollusca, Gastropoda, Muricidae) is limited to the coasts of Chile and southern Peru. Almost all studies of this gastropod have been carried out in open coastal systems, rather than the fjords and channels of southern Chile, despite the fact that this area represents ca. 95 % of the total coastline in this country. Although there is a large volume of background literature on C. concholepas, almost nothing is published about early larval development...

SELECTIVIDAD DEL INSECTICIDA CARTAP EMPLEANDO BIOENSAYOS CON ORGANISMOS NO DESTINATARIOS

OpenAIRE

Iannacone, José; Universidad Nacional Federico Villarreal (Perú).; Alvariño, Lorena; Universidad Nacional Federico Villarreal (Perú).

2016-01-01

El objetivo de la presente investigación fue evaluar la ecotoxicidad del cartap (Bala® 50 PS) sobre ocho organismos animales no destinatarios: 1) Melanoides tuberculata (Müller, 1774) (Mollusca), 2) Emerita analoga (Stimpson, 1857) (Crustácea), 3) Chironomus calligraphus Goeldi, 1805 (Diptera), 4) Cyprinus carpio (Linné, 1758) (Osteichyties), 5) Eisenia foetida (Savigny, 1826) (Annelida), 6) Podisus nigrispinus (Dallas, 1851) (Hemiptera), 7) Trichogramma fuentesi Torre, 1980 (Hymenoptera) y 8...

Short Communication Myosotella myosotis (Mollusca: Ellobiidae ...

African Journals Online (AJOL)

Myosotella myosotis is shown to be a well-established alien species in South Africa. Discovered in Port Elizabeth more than 100 years ago, it was initially thought to be indigenous and was described under two different names, but subsequent taxonomic work has demonstrated that these are synonyms of the variable and ...

Sea lice population and sex differences in P-glycoprotein expression and emamectin benzoate resistance on salmon farms in the Bay of Fundy, New Brunswick, Canada.

Science.gov (United States)

Igboeli, Okechukwu O; Burka, John F; Fast, Mark D

2014-06-01

Parasitic sea lice are a major challenge for salmon aquaculture. This is especially due to the recent development of resistance to emamectin benzoate (EMB) in the parasite. We investigated: (1) whether EMB treatment success in Grand Manan, Bay of Fundy, NB, Canada can be explained through EMB bioassay and P-glycoprotein (P-gp) mRNA expression studies; (2) if other populations of sea lice not under EMB selective pressure possess similar EMB sensitivity as Grand Manan sea lice populations; and (3) the heritability of EMB resistance in Lepeophtheirus salmonis. EMB bioassay results indicated population, species, sex and temporal differences in EMB EC50 values. RT-qPCR analyses revealed population and sex differences in P-gp mRNA levels, correlating with the bioassay results. Laboratory-reared sea lice maintained their EMB sensitivity status up to the F3 generation. Caligus elongatus, collected from Grand Manan showed more than twofold lower EMB EC50 values compared with L. salmonis collected from the same site. Concurrent exposure to EMB and verapamil yielded no increase in C. elongatus sensitivity to the parasiticide. Sea lice bioassay and P-gp mRNA studies can be used to track EMB resistance and sex differences in EMB sensitivity and P-gp mRNA levels exist in the parasite. © 2013 Society of Chemical Industry.

¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez?

Directory of Open Access Journals (Sweden)

Daniel SCUFFI

2012-01-01

Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.

Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae

Directory of Open Access Journals (Sweden)

Ramírez Pinilla Martha Patricia

1992-09-01

Full Text Available Sympatric species Liolaemus bibroni (oviparous, Liolaemus elongatus and Liolaemus ruibali (viviparous have partial fall reproductive activity for males and females. Males are reproductively active between fall and spring, females are vitellogenic especially during this season, they are gravid in spring and the oviposition/parturition occur at the end of spring and early summer. Reproductive cycles of males and females have not a long rest phase, and apparently are continuous. The incidence of  environmental and endogenous factors over the partial fall reproductive pattern in Liolaemus species is discussed. Machos y hembras de las especies simpátricas Liolaemus bibroni (ovípara, Liolaemus elongatus y Liolaemus ruibali (vivíparas tienen actividad reproductiva parcial de otoño. Los machos son reproductivos entre otoño y primavera, período en el que las hembras son vitelogénicas; las hembras están grávidas en primavera y el parto/oviposición sucede al final de esta estación y verano temprano. Los ciclos reproductivos de machos y hembras no tienen un período de receso prolongado, y tienden a ser continuos. Se discute la incidencia de factores ambientales y endógenos en el patrón reproductivo parcial de otoño en especies de Liolaemus.

Hydrobiological study of the small stream on the Czech–Moravian Highlands

Directory of Open Access Journals (Sweden)

Ivo Sukop

2010-01-01

Full Text Available Zoobenthos of the Fryšávka Rivulet was investigated in the years 2007–2008. Research included also physico-chemical factors of water (temperature, pH, conductivity, oxygen saturation. Altogether, 144 taxa of zoobenthos were determined in the Fryšávka Rivulet: Coelenterata (1 taxon, Turbellaria (1 taxon, Oligochaeta (6 taxa, Hirudinea (1 taxon, Mollusca (5 taxa, Amphipoda (1 taxon, Decapoda (1 taxon, Acari (1 taxon, Ephemeroptera (18 taxa, Plecoptera (18 taxa, Heteroptera (1 taxon, Megaloptera (1 taxon, Planipennia (1 taxon, Trichoptera (36 taxa, Coleoptera (8 taxa, Diptera (44 taxa. Altogether, 76 taxa of zoobenthos were determined in Medlovka brook: Coelenterata (1 taxon, Turbellaria (1 taxon, Oligochaeta (2 taxa, Mollusca (1 taxon, Isopoda (1 taxon, Amphipoda (1 taxon, Acari (1 taxon, Ephemeroptera (14 taxa, Plecoptera (8 taxa, Megaloptera (1 taxon, Trichoptera (17 taxa, Coleoptera (6 taxa, Diptera (22 taxa.The average abundance of zoobenthos of the Fryšávka Rivulet was 3208 ind.m−2, the average biomass was 7.5 g . m−2, respectively. The same values for the Medlovka brook were: abundance 3238 ind.m−2 and biomass 5.8 g . m−2. The average value of the saprobic index for the whole Fryšávka Rivulet was 1.25 (oligosaprobity, for the Medlovka brook 1.42 (oligosaprobity.

Clinical profile of HIV infection

Directory of Open Access Journals (Sweden)

Khopkar Uday

1992-01-01

Full Text Available HIV seropositivity rate of 14 percent was observed amongst STD cases. Heterosexual contact with prostitutes was the main risk factor. Fever, anorexia, weight loss, lymphadenopathy and tuberculosis were useful clinical leads. Genital ulcers, especially chancroid, were common in seropositivies. Alopecia of unknown cause, atypical pyoderma, seborrhea, zoster, eruptive mollusca and sulfa-induced erythema multiforme were viewed with suspicion in high risk groups. Purpura fulminans, fulminant chancroid, vegetating pyoderma and angioedema with purpura were unique features noted in this study.

Effects of impoundment and regulation upon the stomach contents of fish at Cow Green, Upper Teesdale

Energy Technology Data Exchange (ETDEWEB)

Crisp, D.T.; Mann, R.H.K.; McCormack, J.C.

1978-04-01

The stomach contents of 1003 brown trout, 1551 bullheads and 800 minnows taken from the reservoir basin and below the dam, before and after impoundment of the river Tees, were examined. Their composition reflected observations by other workers on river and reservoir benthos, except for the increase in numbers of Hydra and Nais below the dam, and Mollusca, Hirudinea and oligochaetes in the reservoir. Trout below the dam ate more Ephemeroptera nymphs and Chironomidae larvae but fewer terrestrial casualties after river regulation, whereas bullheads ate more Mollusca but fewer Plecoptera nymphs. In both species Baetidae nymphs increased in numerical importance relative to Ecdyonuridae. Trout, but not bullheads, took zooplankton discharged from the reservoir. Before impoundment, trout within the reservoir basin ate chiefly benthic organisms and terrestrial casualties. Inundated terrestrial material, mainly earthworms, formed the bulk of their food for at least three years after impoundment, whilst from the second year onwards Chironomidae and, in some years, Gammarus became increasingly important. Zooplankton was taken by all sizes of reservoir trout. Bullheads within the reservoir basin ate chiefly river benthos before impoundment, with Ephemeroptera and Plecoptera nymphs predominant in older fish, and aquatic Diptera and Coleoptera also important in the fry. After impoundment, Chironomidae and Gammarus were the main items taken by older bullheads, and Chironomidae and micro-crustacea by the fry. Among all sizes of minnow, Chironomidae, micro-crustacea and detritus increased in numerical importance after impoundment.

Concentration of radioactive cobalt by seaweeds in the food chain

International Nuclear Information System (INIS)

Nakahara, Motokazu; Koyanagi, Taku; Saiki, Masamichi

1976-01-01

On the pathway of radioactive substances in marine environments, seaweeds play an important role because of their higher concentration factors for many radionuclides and because they constitute a link of food chain in the sea. In the present work, uptake, distribution and excretion of radioactive cobalt were studied on several kinds of seaweeds by radioisotope tracer experiments under laboratory conditions and concentration factors were calculated. The concentration factors were also estimated from the results of stable cobalt determination by activation analysis or atomic absorption spectrometry on seaweeds and seawater, and compared with the results of tracer expts. The seaweeds showed the species specificity for the concentration of stable and radioactive cobalt with diverse values of concentration factors and biological half-lives. The transfer of radioactive cobalt in the food chain from contaminated seaweeds to mollusca was examined by feeding abalones, Haliotis discus, with four kinds of seaweed labelled with 60 Co and observing retention. Absorption rate for radioactive cobalt by abalones calculated at two days after feeding showed diverse values depending upon the species of seaweed, as follows: 47% through Laminaria japonica and Ulva pertusa, 31% through Undaria pinnatifida and 26 through Eisenia bicyclis, respectively. From the results, it was assumed that the accumulation of radioactive cobalt by mollusca is affected by the species of seaweeds as food. A very high concentration of ingested radioactive cobalt in the midgut gland was seen on the autoradiograph of abalone samples. (auth.)

Concentration of radioactive cobalt by seaweeds in the food chain

International Nuclear Information System (INIS)

Nakahara, M.; Koyanagi, T.; Saiki, M.

1975-01-01

On the pathway of radioactive substances in marine environments, seaweeds play an important role because of their higher concentration factors for many radionuclides and because they constitute a link in the food chain. In the present work, uptake, distribution and excretion of radioactive cobalt were studied on several kinds of seaweeds by radioisotope tracer experiments under laboratory conditions and concentration factors were calculated. The concentration factors were also estimated from the results of stable cobalt determination by activation analysis or atomic absorption spectrometry on seaweeds and seawater, and compared with the results of tracer experiments. The seaweeds showed the species specificity for the concentration of stable and radioactive cobalt with diverse values of concentration factors and biological half-lives. The transfer of radioactive cobalt in the food chain from contaminated seaweeds to mollusca was examined by feeding abalones, Haliotis discus, with four kinds of seaweed labelled with 60 Co and observing retention. Absorption rate for radioactive cobalt by abalones calculated at two days after feeding showed diverse values depending upon the species of seaweed, as follows: 47% through Laminaria japonica and Ulva pertusa, 31% through Undaria pinnatifida and 26% through Eisenia bicyclis, respectively. From the results, it was assumed that the accumulation of radioactive cobalt by mollusca is affected by the species of seaweeds as food. A very high concentration of ingested radioactive cobalt in the midgut gland was seen on the autoradiograph of abalone samples. (author)

Inhibitory activities of microalgal extracts against Epstein-Barr Virus (EBV antigen expression in lymphoblastoid cells

Directory of Open Access Journals (Sweden)

Koh Yih Yih

2014-01-01

Full Text Available The inhibitory activities of microalgal extracts against the expression of three EBV antigens, latent membrane protein (LMP1, Epstein-Barr nuclear antigen (EBNA1 and Z Epstein-Barr reactivation activator (ZEBRA were assessed by immunocytochemistry. The observation that the methanol extracts and their fractions from Ankistrodesmus convolutus, Synechococcus elongatus and Spirulina platensis exhibited inhibitory activity against EBV proteins in three Burkitt’s lymphoma cell lines at concentrations as low as 20 μg/ml suggests that microalgae could be a potential source of antiviral compounds against EBV.

The Paramyxea Levine 1979: An original example of evolution towards multicellularity

Science.gov (United States)

Desportes, Isabelle

1984-03-01

The Paramyxea are parasitic in marine invertebrates. Their development is a sporulation involving the differentiation within a stem cell of several sporonts which produce spores made of cells enclosed inside each other. Three genera are recognized according to the number of spores and sporal cells, and the taxonomic position of the host (Polychaeta, Mollusca, Crustacea). The Paramyxea exhibit both protistan and metazoan characters. Their nine singlets centrioles are observed in different Protoctists whereas the fact that their sporal cells acquire distinctive cytological features may be interpreted as an evolution towards multicellularity.

Results of investigating the macroinvertebrate community of the Danube River on the sector upstream from the Iron Gate (km 1083-1071

Directory of Open Access Journals (Sweden)

Paunović Momir M.

2005-01-01

Full Text Available The present work cites results of investigating aquatic macroinvertebrates of the Danube River on the sector upstream from the Iron Gate (KM 1083-1071. The investigated part is interesting from the hydrobiological standpoint above all due to differences of faunal composition in relation to higher sections that could be expected in view of differences in overall characteristics of the river. A rich macroinvertebrate community (84 taxa was observed. The diversity of taxa is primarily a result of habitat diversity within the given stretch. Oligochaeta and Mollusca were the principal components.

Assessment System for Aircraft Noise (ASAN) Citation Database. Volume 1

Science.gov (United States)

1989-12-01

kills "). Most researchers would take an opposing position on the given research topic. 2 Some elements of the publication are con-r ,ersial 14 4. Report...01.02.21.09.00.00 Mockingbirds 01.07.22.06.00.00 Mojarras 01.07.24.00.00.00 Molas 01.01.03.03.00.00 Moles 02.00.00.00.00.00 Mollusca 02.00.00.00.00.00...Bluebirds ...Robins ...Sialia ...Turdus Ol.02.2l.09.OO.OO ... Catbirds ... Mimidae -. Mockingbirds ... Thrashers 01.02.21:1.0.00. ... Motacillidae

Evaluation of the levels of Br, Cl, K, Mg, Mn and V in Perna perna mussels (Linnaeus, 1758: Mollusca Bivalvia) collected in the coast of Sao Paulo state, Brazil; Avaliacao dos teores de Br, Cl, K, Mg, Mn e V em mexilhoes Perna perna (Linnaeus, 1758: Mollusca Bivalvia) coletados no litoral do estado de Sao Paulo, Brasil

Energy Technology Data Exchange (ETDEWEB)

Seo, Daniele

2012-07-01

The coastal environment has been heavily altered by multiple environmental impacts of human activities, such as disposal of sewage from urban areas, the release of numerous chemical industries, agriculture and the flow of vessels, which can lead to accidental spills of oil and oil products, fuels and other products transported by sea. In this context, a means of determining concentrations of these potentially toxic substances in the sea water is the biomonitoring by means of different types of bivalves, which have been used by various researchers, in Brazil and other countries. With regard to bivalve mollusks, particularly mussels, their use in monitoring the marine contamination is mainly due to their wide geographic distribution, sessile habit and ability to concentrate toxic metals to 102-105 times in relation to the concentrations detected in water. In the present study, we employed the passive biomonitoring using the Perna perna bivalve mollusk with respect to the elements Br, Cl, K, Mg, Mn and V. These elements were chosen since they can be determined by INAA method (Instrumental Neutron Activation Analysis), by means of short irradiation which provides faster analyzes and also due to their importance from the standpoint of environmental or nutritional studies. The aim of this study was to evaluate the content of Br, Cl, K, Mg, Mn and V in samples of Perna perna mussels (Linnaeus, 1758: Mollusca, Bivalvia) collected in coastal regions of Sao Paulo subject to anthropogenic contamination (Ponta de Itaipu and Palmas Island, in Santos), comparing the values obtained in sites potentially impacted with the values of the control site in Praia da Cocanha, in Caraguatatuba. The collection points located in Sao Paulo coast are located in the geographical areas 23 Masculine-Ordinal-Indicator 37'S - 45 Degree-Sign 24' W (Caraguatatuba) and 23 Masculine-Ordinal-Indicator 57'S - 46 Masculine-Ordinal-Indicator 20' W (Santos). The collection of organisms was performed in all

Evaluation of the levels of Br, Cl, K, Mg, Mn and V in Perna perna mussels (Linnaeus, 1758: Mollusca Bivalvia) collected in the coast of Sao Paulo state, Brazil; Avaliacao dos teores de Br, Cl, K, Mg, Mn e V em mexilhoes Perna perna (Linnaeus, 1758: Mollusca Bivalvia) coletados no litoral do estado de Sao Paulo, Brasil

Energy Technology Data Exchange (ETDEWEB)

Seo, Daniele

2012-07-01

The coastal environment has been heavily altered by multiple environmental impacts of human activities, such as disposal of sewage from urban areas, the release of numerous chemical industries, agriculture and the flow of vessels, which can lead to accidental spills of oil and oil products, fuels and other products transported by sea. In this context, a means of determining concentrations of these potentially toxic substances in the sea water is the biomonitoring by means of different types of bivalves, which have been used by various researchers, in Brazil and other countries. With regard to bivalve mollusks, particularly mussels, their use in monitoring the marine contamination is mainly due to their wide geographic distribution, sessile habit and ability to concentrate toxic metals to 102-105 times in relation to the concentrations detected in water. In the present study, we employed the passive biomonitoring using the Perna perna bivalve mollusk with respect to the elements Br, Cl, K, Mg, Mn and V. These elements were chosen since they can be determined by INAA method (Instrumental Neutron Activation Analysis), by means of short irradiation which provides faster analyzes and also due to their importance from the standpoint of environmental or nutritional studies. The aim of this study was to evaluate the content of Br, Cl, K, Mg, Mn and V in samples of Perna perna mussels (Linnaeus, 1758: Mollusca, Bivalvia) collected in coastal regions of Sao Paulo subject to anthropogenic contamination (Ponta de Itaipu and Palmas Island, in Santos), comparing the values obtained in sites potentially impacted with the values of the control site in Praia da Cocanha, in Caraguatatuba. The collection points located in Sao Paulo coast are located in the geographical areas 23 Masculine-Ordinal-Indicator 37'S - 45 Degree-Sign 24' W (Caraguatatuba) and 23 Masculine-Ordinal-Indicator 57'S - 46 Masculine-Ordinal-Indicator 20' W (Santos). The collection of organisms

Miocene freshwater Mollusca from western Brazilian Amazonia

NARCIS (Netherlands)

Wesselingh, F.P.; Ranzi, A.; Räsänen, M.E.

2006-01-01

Thirteen species of fossil molluscs are reported from the Solimões Formation of western Brazilian Amazonia. Based on mammalian chronology of the Solimões Formation and radiometric ages reported from coeval deposits in adjacent Peru, the age of the fauna is established as Late Miocene. The fauna

Lorentz Spengler's descriptions of chitons (Mollusca: Polyplacophora)

NARCIS (Netherlands)

Kaas, P.; Knudsen, J.

1992-01-01

The present paper deals with an important Danish paper on the Polyplacophora, published in 1797 by Lorentz Spengler: Udförlig Beskrivelse over det mangeskallede Konkylie-Slaegt, af Linnaeus kaldet Chiton; med endeel nye Arter og Varieteter. -Skrivter af Naturhistorie-Selskabet, 4e Bind, Ie Hefte,

Zoogeografía de macroinvertebrados bentónicos de la costa de Chile: contribución para la conservación marina Zoogeography of benthic macroinvertebrates of the Chilean coast: contribution for marine conservation

Directory of Open Access Journals (Sweden)

DOMINGO A. LANCELLOTTI

2000-03-01

Full Text Available La diversidad de macroinvertebrados marinos ha recibido una atención creciente, no obstante, con un escaso tratamiento en el contexto biogeográfico. Este estudio analiza los registros de 1.601 especies de macroinvertebrados bentónicos pertenecientes a: Demospongiae, Anthozoa, Polychaeta, Mollusca, Crustacea, Echinodermata y Ascideacea, agrupados en 10 zonas y tratados desde una perspectiva zoogeográfica. Mollusca (611 especies, Polychaeta (403 y Crustacea (370 corresponden a los grupos mejor representados a lo largo de la costa chilena, determinantes en el patrón global de la biodiversidad. Este aumenta suavemente de norte a sur, interrumpido por máximos que sugieren esfuerzos diferenciales de estudio más que un comportamiento natural de la biodiversidad. El grado de agrupamiento entre las zonas muestra las tres unidades biogeográficas definidas recientemente por Lancellotti & Vásquez. Este arreglo, que representa lo exhibido por los grupos más diversos, se ve alterado en los grupos menos representados donde las diferencias obedecen al patrón de afinidades mostradas por las zonas comprendidas dentro de la Región Templada Transicional. El quiebre zoogeográfico alrededor de los 41º S, sugerido largamente en la literatura, sólo ocurre en Echinodermata y Demospongiae, evidenciando en los otros taxa la existencia de un área de transición entre los 35º y 48º S, caracterizada por un reemplazo gradual de especies. Dentro de las regiones la biodiversidad muestra homogeneidad, contrario al endemismo, el que alcanza un máximo de 52% en la Región Templada Fría y que parece ser consecuencia del alto número de especies con registros únicos (38,2% de especies citadas para una sóla zona. Esto sugiere un desconocimiento de los macroinvertebrados chilenos (distribución y diversidad, sobrestimando el endemismo regional y distorsionando los patrones locales de biodiversidadThe diversity of marine macroinvertebrates has received increasing

New agnostina (Trilobita from the Llanvirn (Ordovician of Spain

Directory of Open Access Journals (Sweden)

Rábano, I.

1985-12-01

Full Text Available The agnostids from the Lower Llanvirn shales of the Southern Central-Iberian Zone (Mounts of Toledo, Villuercas and Almadén district are described. Seven localities are new for Ordovician agnostids and two are revised. Three new species, belonging to the genera Geragnostella and Geragnostus, are described: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. and Geragnostus ninhursagae n. sp. The new names Geragnostus pilleti nom. nov. and Geragnostus abdullaevi nom. nov. are proposed to rename, respectively, the species G. howelli PILLET, 1978 and G. elongatus ABDULLAEV, 1972, regarded herein as junior objective homonyms of other previously defined species.

Se estudian los trilobites agnóstidos procedentes de nueve localidades, siete de ellas nuevas para estas faunas, situadas en las pizarras del Llanvirn inferior de la parte meridional de la Zona Centroibérica (Montes de Toledo, Villuercas y región de Almadén. Se determina la presencia de los géneros Geragnostella y Geragnostus, y se describen tres nuevas especies: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. y Geragnostus ninhursagae n. sp. Se proponen también los nuevos nombres Geragnostus pilleti nom. nov. y Geragnostus abdullaevi nom. nov. para designar, respectivamente, las especies G. howelli PILLET, 1978, y G. elongatus ABDULLAEV, 1972, consideradas ambas homónimos objetivos primarios de otras especies definidas con anterioridad.

Estrutura da comunidade de macroinvertebrados bentônicos de um riacho de serra em Itatinga, São Paulo, Brasil Structure of a benthic macroinvertebrates community in a mountain stream in Itatinga, São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Ludmilla O. Ribeiro

2005-09-01

Full Text Available A comunidade de macroinvertebrados bentônicos de um riacho de terceira ordem foi analisada em duas estações do ano, chuvosa e seca. Substratos artificiais foram amostrados semanalmente, ao longo de 56 dias para a coleta de macroinvertebrados, nas duas estações do ano. A composição da comunidade foi caracterizada por uma baixa diversidade, ou seja, presença de muitas espécies raras e poucas espécies abundantes nas duas estações do ano. Uma alta dominância de Chironomidae (Diptera nas duas estações, seguida de Baetidae (Ephemeroptera e Ancylidae (Mollusca, respectivamente nas estações chuvosa e seca, foi característico. Os resultados obtidos reforçam a grande importância de Chironomidae na comunidade bentônica de riachos e salientam a influência da sazonalidade sobre a estruturação destes organismos.The benthic macroinvertebrates community of a third order stream was studied during the wet and dry seasons. The community was analyzed using artificial substrates sampled weekly during 56 days in each season. The community composition was characterized by low species diversity, with high number of rare species and few abundant species for both seasons. A high dominance of Chinonomidae (Diptera for both seasons, followed by Baetidae (Ephemeroptera and Ancylidae (Mollusca, respectively for the wet and dry seasons, was found. The results reinforced the high importance of Chironomidae and the seasonal effect determining the stream benthic community structure.

Phylogeny and mitochondrial gene order variation in Lophotrochozoa in the light of new mitogenomic data from Nemertea

Directory of Open Access Journals (Sweden)

von Döhren Jörn

2009-08-01

Full Text Available Abstract Background The new animal phylogeny established several taxa which were not identified by morphological analyses, most prominently the Ecdysozoa (arthropods, roundworms, priapulids and others and Lophotrochozoa (molluscs, annelids, brachiopods and others. Lophotrochozoan interrelationships are under discussion, e.g. regarding the position of Nemertea (ribbon worms, which were discussed to be sister group to e.g. Mollusca, Brachiozoa or Platyhelminthes. Mitochondrial genomes contributed well with sequence data and gene order characters to the deep metazoan phylogeny debate. Results In this study we present the first complete mitochondrial genome record for a member of the Nemertea, Lineus viridis. Except two trnP and trnT, all genes are located on the same strand. While gene order is most similar to that of the brachiopod Terebratulina retusa, sequence based analyses of mitochondrial genes place nemerteans close to molluscs, phoronids and entoprocts without clear preference for one of these taxa as sister group. Conclusion Almost all recent analyses with large datasets show good support for a taxon comprising Annelida, Mollusca, Brachiopoda, Phoronida and Nemertea. But the relationships among these taxa vary between different studies. The analysis of gene order differences gives evidence for a multiple independent occurrence of a large inversion in the mitochondrial genome of Lophotrochozoa and a re-inversion of the same part in gastropods. We hypothesize that some regions of the genome have a higher chance for intramolecular recombination than others and gene order data have to be analysed carefully to detect convergent rearrangement events.

Higher fish intake is associated with a lower risk of hip fractures in Chinese men and women: a matched case-control study.

Science.gov (United States)

Fan, Fan; Xue, Wen-Qiong; Wu, Bao-Hua; He, Ming-Guang; Xie, Hai-Li; Ouyang, Wei-Fu; Tu, Su-Lan; Chen, Yu-Ming

2013-01-01

Fish is rich in nutrients that are favorable to bone health, but limited data are available regarding the relationship between fish intake and hip fractures. Our study examined the association between habitual fish intake and risk of hip fractures. A case-control study was performed between June 2009 and June 2012 in Guangdong Province, China. Five hundred and eighty-one hip fracture incident cases, aged 55 to 80 years (mean: 71 years), were enrolled from four hospitals. 1∶1 matched controls by gender and age (±3 years) were also recruited from communities and hospitals. Face-to-face interviews were used to obtain habitual dietary intake and information on various covariates. Univariate conditional logistic regression analyses showed significantly dose-dependent inverse correlations between the risk of hip fractures and the intake of fresh-water fish, sea fish, mollusca, shellfish, and total fish in all of the subjects (p-trend: water fish (p = 0.553). The ORs (95%CI) of hip fractures for the highest (vs. lowest) quartile were 0.80 (0.48-1.31) for fresh-water fish, 0.31 (0.18-0.52) for sea fish, 0.55 (0.34-0.88) for mollusca and shellfish, and 0.47 (0.28-0.79) for total fish, respectively. Stratified and interaction analyses showed that the association was more significant in males than in females (p-interaction = 0.052). Higher intake of seafood is independently associated with lower risk of hip fractures in elderly Chinese. Increasing consumption of sea fish may benefit the prevention of hip fractures in this population.

Culturing photosynthetic bacteria through surface plasmon resonance

Energy Technology Data Exchange (ETDEWEB)

Ooms, Matthew D.; Bajin, Lauren; Sinton, David [Department of Mechanical and Industrial Engineering and Centre for Sustainable Energy, University of Toronto, Toronto M5S 3G8 (Canada)

2012-12-17

In this work, cultivation of photosynthetic microbes in surface plasmon enhanced evanescent fields is demonstrated. Proliferation of Synechococcus elongatus was obtained on gold surfaces excited with surface plasmons. Excitation over three days resulted in 10 {mu}m thick biofilms with maximum cell volume density of 20% vol/vol (2% more total accumulation than control experiments with direct light). Collectively, these results indicate the ability to (1) excite surface-bound cells using plasmonic light fields, and (2) subsequently grow thick biofilms by coupling light from the surface. Plasmonic light delivery presents opportunities for high-density optofluidic photobioreactors for microalgal analysis and solar fuel production.

Population dynamics of calanoid copepods and the implications of their predation by clupeid fish in the Central Baltic Sea

DEFF Research Database (Denmark)

Möllmann, C.; Köster, Fritz

2002-01-01

. Additionally this study investigated the effect of predation by the major planktivorous fish species herring (Clupea harengus) and sprat (Sprattus sprattus) for the period 1977-1996 in the Gotland Basin (Central Baltic Sea). Examination of consumption by these fish species in relation to copepod production...... by sprat on CV/CVI of both copepod species in spring resulted in higher copepod mortality rates. In consequence, based on these results we suggest that the increase in the sprat stock since the late 1980s contributed to a decline of P. elongatus, and additionally prevented an even more pronounced...

Effects of elevated pH on marine copepods in mass cultivation systems

DEFF Research Database (Denmark)

Hansen, Benni Winding; Hansen, Per Juel; Nielsen, Torkel Gissel

2017-01-01

both Acartia spp. and C. typicus had higher mortality at pH 9.5 than at the other pH regimes while E. affinis nauplii were not affected by pH. Wild Acartia spp. and A. tonsa from a culture showed some differences in response although of minor practical importance for aquaculture; both produced no eggs......Female tolerance to pH (8.0–9.5) by six marine copepods, Oithona similis, Temora longicornis, Acartia spp., Centropages typicus, Pseudocalanus elongatus and Eurytemora affinis was investigated to identify robust species for live feed production. The species with the most oceanic...

Ultrastructural studies of Biomphalaria glabrata (Say, 1818) embryo

International Nuclear Information System (INIS)

Kikuchi, O.K.; Okazaki, K.; Kawano, T.; Ribeiro, A.A.G.F.C.

1988-09-01

Ultrastructural studies of Biomphalaria glabrata embryos (MOllusca: Gastropoda), and important snail vector of schistosomiasis has not been explored. In the present work it was evaluated a suitable electron microscopical technique for embryos processing. Promising results was obtained with double fixation in 1% glutaraldehyde plus 1% osmium tetroxide in 0.05 M cacodylate buffer (pH 7.4), preliminary staining overnight in 1% uranyl acetate and embedding in EPON or Polylite under vacuum. It was used embryos at young trochophore stage wich is characterized by active organogenesis. Some ultrastructural aspects of B. glabrata embryos cells are presented. (author) [pt

Evaluation of algal biofilms on indium tin oxide (ITO for use in biophotovoltaic platforms based on photosynthetic performance.

Directory of Open Access Journals (Sweden)

Fong-Lee Ng

Full Text Available In photosynthesis, a very small amount of the solar energy absorbed is transformed into chemical energy, while the rest is wasted as heat and fluorescence. This excess energy can be harvested through biophotovoltaic platforms to generate electrical energy. In this study, algal biofilms formed on ITO anodes were investigated for use in the algal biophotovoltaic platforms. Sixteen algal strains, comprising local isolates and two diatoms obtained from the Culture Collection of Marine Phytoplankton (CCMP, USA, were screened and eight were selected based on the growth rate, biochemical composition and photosynthesis performance using suspension cultures. Differences in biofilm formation between the eight algal strains as well as their rapid light curve (RLC generated using a pulse amplitude modulation (PAM fluorometer, were examined. The RLC provides detailed information on the saturation characteristics of electron transport and overall photosynthetic performance of the algae. Four algal strains, belonging to the Cyanophyta (Cyanobacteria Synechococcus elongatus (UMACC 105, Spirulina platensis. (UMACC 159 and the Chlorophyta Chlorella vulgaris (UMACC 051, and Chlorella sp. (UMACC 313 were finally selected for investigation using biophotovoltaic platforms. Based on power output per Chl-a content, the algae can be ranked as follows: Synechococcus elongatus (UMACC 105 (6.38×10(-5 Wm(-2/µgChl-a>Chlorella vulgaris UMACC 051 (2.24×10(-5 Wm(-2/µgChl-a>Chlorella sp.(UMACC 313 (1.43×10(-5 Wm(-2/µgChl-a>Spirulina platensis (UMACC 159 (4.90×10(-6 Wm(-2/µgChl-a. Our study showed that local algal strains have potential for use in biophotovoltaic platforms due to their high photosynthetic performance, ability to produce biofilm and generation of electrical power.

Chitons (Mollusca, Polyplacophora from Alacranes Reef, Yucatan, Mexico

Directory of Open Access Journals (Sweden)

Adriana Reyes-Gómez

2017-04-01

Full Text Available This study represents the first comprehensive chiton study from Alacranes Reef, the largest reef system in the Gulf of Mexico. Nine chiton species were found in seven localities within the area, in the intertidal and subtidal to 12 m depth. SEM examination of C. janeirensis, A. hemphilli, T. schrammi and C. floridanus, showed variations in the sculpture and radular teeth morphology when compared to specimens of the same species from Florida Keys, Bahamas and Puerto Rico. The distribution ranges of T. schrammi, L. liozonis and S. floridana are extended into the south-western area of the Gulf of Mexico. Altogether, combining previous literature and the present survey, reports eleven chiton species which have now been recorded within the Alacranes reef area.

Variation in foraging activity of Acanthochitona garnoti (Mollusca ...

African Journals Online (AJOL)

Foraging activity of Acanthochitona gamoti was studied during spring and neap tides in three different habitats: an aeolian sandstone ... mm) during a spring tide new moon and least on a spring tide full moon (x = 4.0 h; x = 182 rnm). Chitons on the boulder ..... BECKLEY, L.E. 1994. Two Oceans: A guide to Marine Life of.

On Pomacea canaliculata (Lamarck, 1822 (Mollusca; Pilidae: Ampullariidae

Directory of Open Access Journals (Sweden)

Silvana C. Thiengo

1993-03-01

Full Text Available This paper deals with the morphology of Pomacea caniculata (Lamarck, 1822 collected at Corrientes, Argentina. Comparison is made with Pomacea lineata (Spix, 1827 and Pomacea sordida (Swainson, 1823. The shell is globose, heavy, with greenish or horn-colored periostracum and dark spiral bands; apex subelevated, 5-6 whorls increasing rather rapidly and separated by very deep suture. Aperture large, rounded to subelongated; lip sometimes reddish; umbilicus large and deep; operculum corneous, entirely closing the aperture. Ratios: shell width/shell length = 0.78-0.96 (mean 0.86; aperture length/shell length = 0.68-0.77 (mean 0.72. Radula similar to other congeneric species. Testis and spermiduct as in P. lineata and P. sordida; prostate cylindric and short, cream in color as the testis. Penial sheath straight bearing a central outer gland deeply embedded in the tissue of its basal portion and a large wrinkled gland occupying 2/3 of the distal tip of its inner surface; the rigth margin of the sheath overlaps the left one until 2/3 of its proximal end. Female reproductive apparatus similar to that P. lineata; vestigial male copulatory apparatus (penis and its sheath present in all females examined.

Octopus tetricus (Mollusca: Cephalopoda as an ecosystem engineer

Directory of Open Access Journals (Sweden)

David Scheel

2014-12-01

Full Text Available The Sydney octopus (Octopus tetricus occurs in unusual numbers on a shell bed of its prey remains that have accumulated as an extended midden where additional octopuses excavate dens. Here, O tetricus are ecosystem engineers, organisms that modulate availability of resources to other species and to their own species by causing physical state changes in materials. A community of invertebrate grazers and scavengers has developed on the shell bed. Fishes are attracted to the shell bed in numbers significantly greater than in nearby habitats. Large predators, including wobbegong sharks, were attracted to and fed on concentrations of fish, inhibiting the activities of the original engineers, the octopuses. Positive feedbacks included the accumulation of shell debris, increasing shelter availability for additional octopuses and aggregating fish. Negative feedbacks included reductions of nearby prey size and availability, aggression among octopuses, and predator limitation to octopus activity that would otherwise maintain the shell bed.

Planaxidae (Mollusca, Gastropoda) from the South China Sea

Science.gov (United States)

Chen, Zhiyun; Zhang, Junlong; Lian, Xiping; Tan, Yehui

2018-03-01

Planaxidae is a family of tropical and subtropical marine gastropods that are adapted to an intertidal, rocky environment. The present study deals with three species in the family Planaxidae from the South China Sea: Planaxis sulcatus (von Born, 1778), Angiola longispira (Smith, 1872), and Supplanaxis niger (Quoy and Gaimard, 1833), based on specimens deposited in the Marine Biodiversity Collections of the South China Sea, Chinese Academy of Sciences. The taxonomic status, main morphological characteristics of the shell and radula, distribution, and habitat of these three planaxid species are presented. We also briefly discuss their morphological differences and the biogeographic distribution.

Chitons (Mollusca, Polyplacophora) from Alacranes Reef, Yucatan, Mexico

Science.gov (United States)

Reyes-Gómez, Adriana; Ortigosa, Deneb; Simões, Nuno

2017-01-01

Abstract This study represents the first comprehensive chiton study from Alacranes Reef, the largest reef system in the Gulf of Mexico. Nine chiton species were found in seven localities within the area, in the intertidal and subtidal to 12 m depth. SEM examination of C. janeirensis, A. hemphilli, T. schrammi and C. floridanus, showed variations in the sculpture and radular teeth morphology when compared to specimens of the same species from Florida Keys, Bahamas and Puerto Rico. The distribution ranges of T. schrammi, L. liozonis and S. floridana are extended into the south-western area of the Gulf of Mexico. Altogether, combining previous literature and the present survey, reports eleven chiton species which have now been recorded within the Alacranes reef area. PMID:28769624

Evaluation of the levels of Br, Cl, K, Mg, Mn and V in Perna perna mussels (Linnaeus, 1758: Mollusca Bivalvia) collected in the coast of Sao Paulo state, Brazil

International Nuclear Information System (INIS)

Seo, Daniele

2012-01-01

The coastal environment has been heavily altered by multiple environmental impacts of human activities, such as disposal of sewage from urban areas, the release of numerous chemical industries, agriculture and the flow of vessels, which can lead to accidental spills of oil and oil products, fuels and other products transported by sea. In this context, a means of determining concentrations of these potentially toxic substances in the sea water is the biomonitoring by means of different types of bivalves, which have been used by various researchers, in Brazil and other countries. With regard to bivalve mollusks, particularly mussels, their use in monitoring the marine contamination is mainly due to their wide geographic distribution, sessile habit and ability to concentrate toxic metals to 102-105 times in relation to the concentrations detected in water. In the present study, we employed the passive biomonitoring using the Perna perna bivalve mollusk with respect to the elements Br, Cl, K, Mg, Mn and V. These elements were chosen since they can be determined by INAA method (Instrumental Neutron Activation Analysis), by means of short irradiation which provides faster analyzes and also due to their importance from the standpoint of environmental or nutritional studies. The aim of this study was to evaluate the content of Br, Cl, K, Mg, Mn and V in samples of Perna perna mussels (Linnaeus, 1758: Mollusca, Bivalvia) collected in coastal regions of São Paulo subject to anthropogenic contamination (Ponta de Itaipu and Palmas Island, in Santos), comparing the values obtained in sites potentially impacted with the values of the control site in Praia da Cocanha, in Caraguatatuba. The collection points located in São Paulo coast are located in the geographical areas 23º 37'S - 45° 24' W (Caraguatatuba) and 23º 57'S - 46º 20' W (Santos). The collection of organisms was performed in all seasons of the year, beginning in spring 2008 and ending in winter 2009. The samples

Investigation of the biota of Burgas Bay, Black Sea

Directory of Open Access Journals (Sweden)

D. Klisarova

2016-06-01

Full Text Available Abstract. Burgas Bay is the largest one on the Bulgarian Black Sea coast. Industrial plants along the coast as well as ports for liquid and solid cargoes create conditions of anthropogenic pressure on hydrobionts in that area. Macrozoobenthos and phytoplankton samples were collected under a specific scheme in connection with the construction of the Burgas-Alexandroupolis oil pipeline, at stations located around the designated places for unloading tankers. During the study period (2009 – 2010, 88 phytoplankton species distributed in 13 classes were identified and over 50 species of benthic species distributed in four main groups: Polychaeta, Mollusca, Crustacea and the mixed group Diversa

Identification and characterization of miRNAs transcriptome in the South African abalone, Haliotis midae.

Science.gov (United States)

Picone, Barbara; Rhode, Clint; Roodt-Wilding, Rouvay

2017-02-01

Aquatic animal diseases are one of the most important limitations to the growth of aquaculture. miRNAs represent an important class of small ncRNAs able to modulate host immune and stress responses. In Mollusca, a large phylum of invertebrates, miRNAs have been identified in several species. The current preliminary study identified known miRNAs from the South African abalone, Haliotis midae. The economic and ecological importance of abalone makes this species a suitable model for studying and understanding stress response in marine gastropods. Furthermore, the identification of miRNA, represents an alternative and powerful tool to combat infectious disease. Copyright © 2016 Elsevier B.V. All rights reserved.

Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?

Science.gov (United States)

Sato, Naoki

2015-10-01

Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Sinop Yarımadası (Güney Karadeniz Kıyısal Sularındaki Bazı Syngnathid Türlerinin (Syngnathus sp., Nerophis sp., Hippocampus sp. Besin Kompozisyonları

Directory of Open Access Journals (Sweden)

Şule GÜRKAN

2012-09-01

Full Text Available Bu araştırmada, Temmuz 2001 - Mayıs 2002 tarihleri arasında Sinop yarımadası (güney Karadeniz kıyısal sularının 5 – 15 m derinliklerindeki farklı biyotoplarından el direci kullanılarak yakalanan 6 deniziğnesi (Syngnathus acus Linnaeus, 1758; Syngnathus typhle Linnaeus, 1758; Syngnathus tenurostris Rathke, 1837; Syngnathus variegatus Palas, 1811; Nerophis ophidion Linnaeus, 1758; Syngnathus abaster Risso,1926 ve bir denizatı (Hippocampus hippocampus (L.,1758 türüne ait toplam 130 bireyde 105 mide içeriği incelenmiştir. Analizler sonunda mide içeriklerinde 13 av grubu tespit edilmiştir. Deniziğnesi türlerinin besin içeriğinde bulunuş frekans değeri (% F bakımından en baskın av grupları; S. acus’da % 90.9 Euterpina acutifrons, S. typhle’de % 93.3 tanımlanamamış doku parçaları, S. tenurostris’de % 87 Pseudocalanus elongatus, S. variegatus’da % 91.7 tanımlanamamış doku parçaları, N. ophidion’da % 90 Euterpina acutifrons, S. abaster’de ise % 100 Pseudocalanus elongatus, Euterpina acutifrons, Cirriped cypris, ve Cirriped nauiplius’dur. H. hippocampus ise % 25 ile Onceae sp. en baskın av grubudur. Sonuç olarak, deniziğnesi ve denizatı türlerinin esasen bentik ve planktonik krustase gruplarıyla beslendikleri görülmekle birlikte S. tenuirostris, S. abaster ve S. variegatus için besin kompozisyonu kıyılarımızdan ilk kez belirlenmiştir

The strontium inorganic mutant of the water oxidizing center (CaMn4O5) of PSII improves WOC efficiency but slows electron flux through the terminal acceptors.

Science.gov (United States)

Gates, Colin; Ananyev, Gennady; Dismukes, G Charles

2016-09-01

Herein we extend prior studies of biosynthetic strontium replacement of calcium in PSII-WOC core particles to characterize whole cells. Previous studies of Thermosynechococcus elongatus found a lower rate of light-saturated O2 from isolated PSII-WOC(Sr) cores and 5-8× slower rate of oxygen release. We find similar properties in whole cells, and show it is due to a 20% larger Arrhenius activation barrier for O2 evolution. Cellular adaptation to the sluggish PSII-WOC(Sr) cycle occurs in which flux through the QAQB acceptor gate becomes limiting for turnover rate in vivo. Benzoquinone derivatives that bind to QB site remove this kinetic chokepoint yielding 31% greater O2 quantum yield (QY) of PSII-WOC(Sr) vs. PSII-WOC(Ca). QY and efficiency of the WOC(Sr) catalytic cycle are greatly improved at low light flux, due to fewer misses and backward transitions and 3-fold longer lifetime of the unstable S3 state, attributed to greater thermodynamic stabilization of the WOC(Sr) relative to the photoactive tyrosine YZ. More linear and less cyclic electron flow through PSII occurs per PSII-WOC(Sr). The organismal response to the more active PSII centers in Sr-grown cells at 45°C is to lower the number of active PSII-WOC per Chl, producing comparable oxygen and energy per cell. We conclude that redox and protonic energy fluxes created by PSII are primary determinants for optimal growth rate of T. elongatus. We further conclude that the (Sr-favored) intermediate-spin S=5/2 form of the S2 state is the active form in the catalytic cycle relative to the low-spin S=1/2 form. Copyright © 2016 Elsevier B.V. All rights reserved.

Higher fish intake is associated with a lower risk of hip fractures in Chinese men and women: a matched case-control study.

Directory of Open Access Journals (Sweden)

Fan Fan

Full Text Available OBJECTIVES: Fish is rich in nutrients that are favorable to bone health, but limited data are available regarding the relationship between fish intake and hip fractures. Our study examined the association between habitual fish intake and risk of hip fractures. METHODS: A case-control study was performed between June 2009 and June 2012 in Guangdong Province, China. Five hundred and eighty-one hip fracture incident cases, aged 55 to 80 years (mean: 71 years, were enrolled from four hospitals. 1∶1 matched controls by gender and age (±3 years were also recruited from communities and hospitals. Face-to-face interviews were used to obtain habitual dietary intake and information on various covariates. RESULTS: Univariate conditional logistic regression analyses showed significantly dose-dependent inverse correlations between the risk of hip fractures and the intake of fresh-water fish, sea fish, mollusca, shellfish, and total fish in all of the subjects (p-trend: <0.001-0.016. After adjusting for covariates, the associations were slightly attenuated but remained significant for all (p-trend: <0.001-0.017 except for fresh-water fish (p = 0.553. The ORs (95%CI of hip fractures for the highest (vs. lowest quartile were 0.80 (0.48-1.31 for fresh-water fish, 0.31 (0.18-0.52 for sea fish, 0.55 (0.34-0.88 for mollusca and shellfish, and 0.47 (0.28-0.79 for total fish, respectively. Stratified and interaction analyses showed that the association was more significant in males than in females (p-interaction = 0.052. CONCLUSION: Higher intake of seafood is independently associated with lower risk of hip fractures in elderly Chinese. Increasing consumption of sea fish may benefit the prevention of hip fractures in this population.

Conservation and diversification of Msx protein in metazoan evolution.

Science.gov (United States)

Takahashi, Hirokazu; Kamiya, Akiko; Ishiguro, Akira; Suzuki, Atsushi C; Saitou, Naruya; Toyoda, Atsushi; Aruga, Jun

2008-01-01

Msx (/msh) family genes encode homeodomain (HD) proteins that control ontogeny in many animal species. We compared the structures of Msx genes from a wide range of Metazoa (Porifera, Cnidaria, Nematoda, Arthropoda, Tardigrada, Platyhelminthes, Mollusca, Brachiopoda, Annelida, Echiura, Echinodermata, Hemichordata, and Chordata) to gain an understanding of the role of these genes in phylogeny. Exon-intron boundary analysis suggested that the position of the intron located N-terminally to the HDs was widely conserved in all the genes examined, including those of cnidarians. Amino acid (aa) sequence comparison revealed 3 new evolutionarily conserved domains, as well as very strong conservation of the HDs. Two of the three domains were associated with Groucho-like protein binding in both a vertebrate and a cnidarian Msx homolog, suggesting that the interaction between Groucho-like proteins and Msx proteins was established in eumetazoan ancestors. Pairwise comparison among the collected HDs and their C-flanking aa sequences revealed that the degree of sequence conservation varied depending on the animal taxa from which the sequences were derived. Highly conserved Msx genes were identified in the Vertebrata, Cephalochordata, Hemichordata, Echinodermata, Mollusca, Brachiopoda, and Anthozoa. The wide distribution of the conserved sequences in the animal phylogenetic tree suggested that metazoan ancestors had already acquired a set of conserved domains of the current Msx family genes. Interestingly, although strongly conserved sequences were recovered from the Vertebrata, Cephalochordata, and Anthozoa, the sequences from the Urochordata and Hydrozoa showed weak conservation. Because the Vertebrata-Cephalochordata-Urochordata and Anthozoa-Hydrozoa represent sister groups in the Chordata and Cnidaria, respectively, Msx sequence diversification may have occurred differentially in the course of evolution. We speculate that selective loss of the conserved domains in Msx family

Imposex in endemic volutid from Northeast Brazil (Mollusca: Gastropoda

Directory of Open Access Journals (Sweden)

Ítalo Braga de Castro

2008-10-01

Full Text Available Imposex is characterized by the development of masculine sexual organs in neogastropod females. Almost 120 mollusk species are known to present imposex when exposed to organic tin compounds as tributyltin (TBT and triphenyltin (TPT. These compounds are used as biocide agents in antifouling paints to prevent the incrustations on boats. Five gastropod species are known to present imposex in Brazil: Stramonita haemastoma, Stramonita rustica, Leucozonia nassa, Cymathium parthenopeum and Olivancillaria vesica. This paper reports the first record of imposex observed in the endemic gastropod Voluta ebraea from Pacheco Beach, Northeast Brazil. Animals presenting imposex had regular female reproductive organs (capsule gland, oviduct and sperm-ingesting gland and an abnormal penis. As imposex occurs in mollusks exposed to organotin compounds typically found at harbors, marinas, shipyards and areas with high shipping activities, probably contamination of Pacheco Beach is a consequence of a shipyard activity located in the nearest areas.O imposex caracteriza-se pelo surgimento de estruturas sexuais masculinas, em fêmeas de gastrópodes. Cerca de 120 espécies de moluscos que exibem o fenômeno quando expostas a contaminação por compostos orgânicos de estanho tais como o Tributilestanho (TBT e o Trifenilestanho (TPT. Esses compostos são utilizados, sobretudo em embarcações, no intuito de evitar a bioincrustração que danifica as embarcações e eleva os custos das viagens marítimas. No Brasil se conhecem 5 espécies de moluscos gastrópodes que manifestam imposex, são elas: Stramonita haemastoma, Stramonita rustica, Leucozonia nassa, Cymathium parthenopeum e Olivancillaria vesica. No Nordeste, monitoramentos da contaminação por organoestânicos foram realizados utilizando o imposex em gastrópodes como biomarcador. O presente estudo tem por objetivo notificar a primeira ocorrência de imposex na espécie endêmica do Nordeste brasileiro, Voluta ebraea. De um total de 11 animais observados, duas fêmeas apresentaram imposex, provenientes da Praia do Pacheco no litoral do Ceará. Observou-se nesses indivíduos a presença de glândula de cápsulas, ovidutos e receptáculo seminal concomitantemente ao pênis o que caracteriza o imposex. Como o imposex só se manifesta em moluscos expostos a compostos organoestânicos tipicamente encontrados em portos, marinas, estaleiros e locais com grande fluxo de embarcações atribui-se a origem dessa contaminação provavelmente a um estaleiro localizado nas proximidades da área de coleta.

Parasitism by a Digenea in Lucina pectinata (Mollusca: Lucinidae

Directory of Open Access Journals (Sweden)

M. M. Ribeiro

2017-06-01

Full Text Available Abstract Lucina pectinata is an important economic resource in the Brazilian coast. This study reports parasitism caused by a Digenea in this species. The specimens (n = 470 were collected in December 2012 in a mangrove swamp of the Cachoeira River estuary, Bahia, Brazil. They were measured along the anterior-posterior axis (length, and after macroscopic analysis for parasites and diseases cuts of 5 mm were fixated in Carnoy’s solution and processed by routine histology technique wherein sessions of 7 μm were stained with Harris hematoxylin and eosin (H&E. The tissues were examined using an optical microscope. The mean length of L. pectinata was 4.0 ± 0.53 cm. Microscopic analysis showed sporocysts containing both germ balls as cercariae of an unidentified Digenea (Platyhelminthes, these in various stages of development. The prevalence was 1.48% (7/470. In a parasitized specimen was macroscopic evidence of tissue densification of gills. The sporocysts were observed in mantle, gills, digestive gland and gonads, with evident alteration/destruction of tissues, including parasitic castration. There were no other parasites found, which is probably related to inaccessibility and chemical conditions in which lives L. pectinata, i.e., between 10 and 20 cm in mangrove sediment.

Vanadium, rubidium and potassium in Octopus vulgaris (Mollusca: Cephalopoda

Directory of Open Access Journals (Sweden)

Sónia Seixas

2005-06-01

Full Text Available The levels of vanadium, rubidium and potassium were determined in Octopus vulgaris caught during commercial fishing activities at three locations (Cascais, Santa Luzia and Viana do Castelo in Portugal in autumn and spring. We determined the concentration of these elements in digestive gland, branchial heart, gills, mantle and arms in males and females. At least five males and five females were assessed for each season/location combination. Elemental concentrations were determined by Particle Induced X-ray Emission (PIXE. Vanadium was detectable only in digestive gland and branchial heart samples. Its concentration was not correlated with total weight, total length or mantle length. There were no differences in concentrations of V, Rb and K between sexes. There were significant differences in vanadium concentrations in branchial hearts in autumn between samples from Viana do Castelo and those from the other two sites. We found a significant positive relationship between the concentration of vanadium and those of potassium and rubidium in branchial hearts. Branchial hearts appear to play an important role in decontamination of V.

A new species of Indo-Pacific Modulidae (Mollusca: Caenogastropoda).

Science.gov (United States)

Lozouet, Pierre; Krygelmans, Anouchka

2016-04-12

Modulidae is a littoral cerithioid family exclusively encountered in tropical and subtropical regions. It contains 12 to 15 living species (some species are not clearly delimited). Only one species is known to occur in the vast Indo-Pacific region (Bouchet 2015) and two species in the eastern Atlantic. By comparison, the tropical American regions are relatively rich with at least eleven living species (two or three species in the eastern Pacific and nine or more in the western Atlantic), and an equivalent number or more of fossil species (Landau et al. 2014).

Diversity of Indo-West Pacific Siphonaria (Mollusca: Gastropoda: Euthyneura).

Science.gov (United States)

Dayrat, Benoît; Goulding, Tricia C; White, Tracy R

2014-03-14

Species of the limpet genus Siphonaria (Gastropoda: Euthyneura) are commonly found in the rocky intertidal, worldwide, except in the Arctic. In total, 205 species-group names are available and not permanently invalid. However, estimating the actual species diversity of Siphonaria has remained challenging, mainly because past authors have interpreted differently the variation of shell characters, resulting in different taxonomic accounts. Species diversity of Siphonaria is evaluated for the first time here based on DNA sequence data (three mitochondrial gene fragments: COI, 12S, and 16S) and a large sampling focusing on the tropical and subtropical Indo-West Pacific (from eastern Africa to Hawaii): new sequences are provided for 153 individuals, 123 of which were collected from 93 locations throughout the Indo-West Pacific. In total, 41 species (molecular units) are recognized worldwide (31 from the Indo-West Pacific), all of which are strongly supported. Potential names are discussed for those 41 species, based on traditional taxonomy. The shells of 66 of the individuals from which DNA was extracted are illustrated: intra- and inter-specific variation is documented in detail and discussed in the light of new molecular results. It is shown that many species could hardly be identified based on the shell only, because the variation of shell characters is too high and overlaps between species. Geographically, no species is found across the entire Indo-West Pacific, where quite a few species seem to be endemic to restricted areas. The biogeography of Siphonaria in the Indo-West Pacific is compared to other groups.

The non-marine Mollusca of St. Martin (Lesser Antilles)

NARCIS (Netherlands)

Coomans, H.E.

1967-01-01

After our studies about the marine mollusks of St. Martin, (COOMANS 1963a, 1963b), this publication will deal with the land and freshwater shells of the island. The non-marine mollusks of St. Martin were already fairly well known at the end of the last century (MAZÉ 1890, p. 22—34), who mentioned 36

The Genus Theba (Mollusca: Gastropoda: Helicidae), Systematics and Distribution

NARCIS (Netherlands)

Gittenberger, E.; Ripken, Th. E.J.

1987-01-01

Our knowledge concerning taxonomy and zoogeography of the fossil and recent species of the helicid genus Theba is summarized and enlarged. The fossil T. arinagae spec. nov. is described from Gran Canaria. The recent T. andalusica spec. nov. and T. sacchii spec. nov. are described from the

Diet and feeding strategies of mesopelagic fishes in the western Mediterranean

Science.gov (United States)

Bernal, Ainhoa; Olivar, M. Pilar; Maynou, Francesc; Fernández de Puelles, M. Luz

2015-06-01

Myctophids, gonostomatids and sternoptychids are the most abundant teleosteans worldwide and constitute an important assemblage of the mesopelagic ecosystem, functioning as vehicles of energy and matter through trophic webs. This study concentrates on the trophic ecology of the most abundant mesopelagic fishes of the western Mediterranean (WM) based on stomach content analysis. The myctophids (in this study: Benthosema glaciale, Ceratoscopelus maderensis, Lobianchia dofleini, Myctophum punctatum, Hygophum benoiti, Hygophum hygomii, Lampanyctus crocodilus, Lampanyctus pusillus and Notoscopelus elongatus) perform extensive diel migrations across the water column, between the surface to as deep as 1000 m, interacting with plankton and micronekton at multiple depths, and generally feeding in the epipelagic layers at night. In contrast, the gonostomatids Cyclothone braueri, Cyclothone pygmaea, and the sternoptychid Argyropelecus hemigymnus remain below epipelagic layers, feeding at different times throughout the day and night. The diet composition, trophic niche breadth and prey selectivity of 11 of these fish species were determined for juvenile and adult individuals from two surveys performed in December 2009 and July 2010 in the western Mediterranean Sea. The number of prey items varied among species, e.g. Myctophum punctatum was the species with the highest feeding intensity, reaching ca. 700 prey items in a stomach, whereas the mean number of prey in Cyclothone braueri was low (usually 1 or 2 prey per stomach). A dietary shift towards larger prey was evident from juveniles to the largest and oldest adult individuals, despite trophic niche breadths did not increase with body length for any of these mesopelagic species. The diets of the small gonostomatids, sternoptychid and early juveniles of myctophids were dominated by non-calanoid copepods, ostracods, and other small zooplankton, whereas medium-sized myctophids, e.g. L. dofleini or H. benoiti, preyed mainly on

Cd2+ Effect on Photosynthetic Apparatus in Synechococcus elongatus and Spinach (Spinacia oleracea L.)

Czech Academy of Sciences Publication Activity Database

Nováková, Marie; Matějová, E.; Sofrová, D.

2004-01-01

Roč. 42, č. 3 (2004), s. 425-430 ISSN 0300-3604 R&D Projects: GA ČR GA525/02/0301 Institutional research plan: CEZ:AV0Z5038910 Keywords : cyanobacteria * heavy metals * photochemical activity Subject RIV: ED - Physiology Impact factor: 0.734, year: 2004

Coprorhexy, coprophagy, and coprochaly in the copepods Calanus helgolandicus, Pseudocalanus elongatus, and Oithona similis

DEFF Research Database (Denmark)

Iversen, Morten; Poulsen, Louise K.

2007-01-01

Studies of fecal pellet flux show that a large percentage of pellets produced in the upper ocean is degraded within the surface waters. It is therefore important to investigate these degradation mechanisms to understand the role of fecal pellets in the oceanic carbon cycle. Degradation of pellets...

Blind dating - mate finding in planktonic copepods. II. The pheromone cloud of Pseudocalanus elongatus

DEFF Research Database (Denmark)

Kiørboe, Thomas; Bagøien, E.; Thygesen, Uffe Høgsbro

2005-01-01

mm away from her. The multiple excursions define a near-spherical volume around the female within which he is capable of navigating back to her. During courtship the female hovers, but she frequently changes her body orientation and, thus, the direction of her feeding current, which also causes her...

Perfil de lípidos y ácidos grasos de Perna viridis, mejillón verde (Mollusca: Bivalvia en el oriente venezolano y la costa oeste de Trinidad

Directory of Open Access Journals (Sweden)

Tamar Koftayan

2011-03-01

Full Text Available Los lípidos totales fueron extraídos, identificados y cuantificados por gravimetría, mediante TLC/FID (sistema Iatroscan. Los ácidos grasos de los lípidos totales, fosfolípidos y triacilgliceroles fueron identificados y cuantificados por cromatografía de gases. Las mayores concentraciones de lípidos totales se presentaron en las muestras de Los Cedros, La Brea y Chaguaramas con valores de 7.92, 7.74 y 7.53%; respectivamente y los valores mínimos en las de La Restinga (6.08%. En la composición lípidica, las muestras de Chacopata presentaron la menor concentración de fosfolípidos (48.86% y los máximos valores de colesterol (38.87% y triacilgliceroles (12.26%, y las muestras de La Esmeralda y Río Caribe exhibieron concentraciones máximas de fosfolípidos (88.71-84.93%, respectivamente y mínimas de colesterol (6.50-4.42%. En los lípidos totales, los ácidos grasos saturados se encontraron entre 15.04 y 65.55%, con máximos en muestras de La Esmeralda y mínimos en Chacopata y los poliinsaturados estuvieron entre 7.80 y 37.18%, con máximos valores en la Brea y mínimos en la Esmeralda. En los fosfolípidos, la concentración de ácidos grasos saturados estuvo entre 38.81 y 48.68% para las muestras de Chaguaramas y Chacopata, respectivamente; los ácidos grasos poliinsaturados se encontraron entre no detectado y 34.51%, con altas concentraciones en muestras de Los Cedros (27.97% y Chaguaramas (34.51%. En los triacilgliceroles, la composición de ácidos grasos saturados variaron entre 14.27 y 53.80%, con baja concentración en Chacopata y alta concentración en La Restinga; los ácidos grasos poliinsaturados estuvieron entre 4.66 y 35.55%, con valores menores en las muestras de Chacopata (4.66% y mayores en Chaguaramas. El consumo frecuente de Perna viridis es recomendable, debido a su alto contenido de fosfolípidos y ácidos grasos insaturados.Lipid and fatty acid profile of Perna viridis, Green Mussel (Mollusca: Bivalvia in

Observations on the morphology of Pomacea lineata (Spix, 1827 (Mollusca, Ampullariidae Observações sobre a morfologia de Pomacea lineata (Spix, 1827 (Mollusca, Ampullaridae

Directory of Open Access Journals (Sweden)

Silvana Carvalho Thiengo

1987-12-01

Full Text Available This paper deals with the morpholgy of Pomacea lineata (Spix, 1827 collected at its type locality. The shell is globose, moderately heavy, horn-colored with brown spiral bands; apex subelevated; 4 - 5 rounded whorls increasing in diameter rather rapidly, separated by deep suture. Aperture large and ovoid; outer lip sharp; umbilicus narrow and deep; operculum concentric, corneous. Ratios: shell width/shell length = 0.74 - 0.83 (mean 0.78; spire length/shell length = 0.10 - 0.18 (mean 0.13; aperture length/shell length = 0.70 - 0.77 (mean 0.73. The animal is longisiphonate. Renal organ brownish with marked invagination at its right edge. Ureter elongated with its long axis transverse to the main axis of the kidney. The radula is taenioglossate (2.1.1.1.2 and has on average 35 transverse rows of teeth. The form and arrangement of the radula teeth are nearly the same as in other Ampullariidae. The testis is cream-colored and lies in the first three whorls of the spire. Spermiduct uniformly narrow, running to the base of the spire. Seminal vesicle whitish, slightly pressed dorsoventrally. Prostate cylindric and thick, similar in color to the testis. Penis whiplike, with a closed circular spermiduct. Penis pouch ovoid completely envelping the penis. Penis sheath elongated, broad prosimally, tapering distally. Its inner surface shows a longitudinal channel along its proximal half and two glands, one on the middle and the other apical. Ovary composed of branched whitish tubules situated on the surface of the digestive gland. Oviduct slender running along the columellar axis toward the base of the spire. Seminal receptalble tubiform, thick-walled and rounded proximally. Albumen gland large, pink, enclosing the receptacle and the spiral capsule gland. Vestigial male copulatory apparatus (penis and its sheath present in all females examined.Neste trabalho e estudada a morfologia de Pomacea lineata (Spix, 1827 baseada em material coletado na localidade-tipo. Concha com espessura moderada, globosa, castanha, com faixas espirais castanhas-escuras; ápice pouco elevado, 4-5 giros arredondados crescendo rapidamente em diâmetro, separados por suturas profundas. Abertura grande oval; lábio externo simples; umbigo pequeno e profundo; opérculo concêntrico, córneo. Razão: largura da concha/comprimento da concha = 0.74 - 0.83 (média 0.78; comprimento da espira/comprimento da concha = 0.10 - 0.18 (média 0.13; comprimento da abertura/comprimento da concha = 0.70 - 0.77 (média 0.73. Animal com sifão bem desenvolvido. A rádula é tenioglossa (2.1.1.1.2 e tem em média 35 fileiras transversais de dentes. A forma e a disposição dos dentes radulares são semelhantes ao padrão dos ampularídeos. Rim de cor castanha apresentando uma invaginação acentuada na parede direita. Ureter alongado e transversal ao eixo principal do rim. Testículo constituído por uma massa cor creme, ocupando as três primeiras voltas da espira. Espermiduto estreito e uniforme, correndo para a base da espira. Vesícula seminal esbranquiçada levemente achatada dorso-ventralmente. Próstata cilíndrica e compacta com coloração semelhante à do testículo. Pênis em forma de chicote com canal espermático fechado e de contorno circular. Bolsa do pênis ovalada, envolvendo-o completamente. Bainha do pênis alongada tendo sua largura diminuída gradualmente da base para a extremidade; sua superfície interna apresenta um canal mediano em sua metade proximal e duas glândulas, uma mediana e outra apical. Ovário constituído por túbulos ramificados branco-amarelados situados superficilamente sobre a glândula digestiva. Oviduto estreito correndo pelo eixo columelar até a base da espira. Receptáculo seminal tubular com parede espessa e extremidade proximal alargada. Glândula de albume volumosa e rosada envolvendo o receptáculo seminal e a glândula da casca em espiral. Vestígio do aparelho copulador masculino (pênis e sua bainha presente em todas as fêmeas examinadas.

Comportamento agregativo em Subulina octona (Brugüière (Mollusca, Subulinidae Aggregative behavior in Subulina octona (Brugüière (Mollusca, Subulinidae

Directory of Open Access Journals (Sweden)

Sthefane D'ávila

2006-06-01

Full Text Available O objetivo deste trabalho foi verificar a existência de comportamento agregativo na espécie Subulina octona (Brugüière, 1789 e obter evidências da mediação química desse comportamento. Foram utilizados 150 animais adultos, distribuídos em 15 caixas com terra vegetal (10 animais por caixa. Em cada caixa foram colocados quatro discos plásticos identificados, em posição eqüidistante, os quais serviram como abrigos para os animais. No experimento I, foram colocados 10 animais no centro de cada caixa. Após 24, 48, 96, 120, 144 e 168 horas foram observados o número de agregados formados, a posição dos agregados (sob qual abrigo, o número de indivíduos por agregado e o número de indivíduos isolados. No experimento II, todos os indivíduos foram transferidos para outras caixas contendo terra vegetal, três novos discos e o disco que continha o maior agregado após as 168 horas do experimento I (denominado disco condicionado. Foi verificado, após 24 e 48 horas, o número de indivíduos sob o disco condicionado. Em todas as caixas utilizadas e em todos os intervalos de tempo observados no experimento I, houve a formação de agregados. Houve um aumento significativo do número de indivíduos por agregado e uma diminuição do número de indivíduos isolados com o passar do tempo (ANOVA, p The current study aimed to verify the existence of aggregative behavior in Subulina octona (Brugüière, 1789 and to obtain behavioral evidence of chemical mediation of this behavior. We used 150 adult animals allocated in 15 boxes with humus (10 animals per box. In each box we placed four identified plastic disks in an equidistant position. These disks worked as shelters for the animals. In experiment I, 10 animals were put in the middle of each box. After 24, 48, 96, 120, 144, and 168 hours we observed the number of formed aggregations, as well as the position of the aggregates (in each shelter, the number of individual per aggregation and the number of isolated individuals. In order to test the hypothesis of conditioning of disks by chemicals compounds, the experiment II was carried out. All the individuals were transferred to other boxes with humus, three new disks and the disk containing the larger aggregate after the 168 hours of the experiment I (denominated conditioned disk. We verified, after 24 and 48 hours, the number of individuals below the conditioned disk. In experiment I, aggregations were observed in every used box and in every time intervals. In all boxes, there was a significant increase in the number of individuals per aggregation and a reduction in the number of isolated individuals until the end of the experiment (ANOVA, p < 0.005. In experiment II, after 24 hours, six from 15 boxes presented aggregations under the conditioned disk, and after 48 hours, seven boxes presented aggregations under conditioned disk. These were the aggregations with a larger quantity of individuals, which suggests the conditioning of the used disks by some factor, possibly a chemical compound.

Perfil de ácidos grasos de diversas especies de pescados consumidos en México

Directory of Open Access Journals (Sweden)

María Isabel Castro González

2013-12-01

Full Text Available Los factores bióticos y abióticos determinan la composición de ácidos grasos AG en los peces, información relevante por la asociación existente entre su consumo y los beneficios para la salud humana. El objetivo de esta investigación fue identificar la variación en la concentración de AG, según diferentes factores, en diez especies marinas de pescado comestible en México: Euthynnus alletteratus, Sciaenops ocellatus, Bairdiella chrysoura, Sphyraena guachancho, Symphurus elongatus, Istiophorus platypterus, Ophichthus rex, Eugerres plumieri, Eucinostomus entomelas y Oreochromis mossambicus. La determinación de AG se llevó a cabo mediante cromatografía de gases. El contenido de lípidos totales varió entre 0.93 y 1.95g/100g en E. entomelas y O. mossambicus, respectivamente. E. alletteratus, B. chrysoura, S elongatus, I. platypterus, O. rex y E. plumieri presentaron el siguiente orden en la concentración de AG: AG poliinsaturados AGPAG saturados AGSAG monoinsaturados AGM. S. ocellatus, S. guachancho y E. entomelas: AGSAGPAGM; mientras que tan solo O. mossambicus presentó AGSAGMAGP. Este tuvo la mayor concentración de AGS 559.40mg/100g y AGM 422.60mg/100g, mientras que B. chrysoura presentó el mayor contenido mg/100g de AGP 663.03, AGn-3 514.03, EPA+DHA 506.10 y AGn-6 145.80. Factores bióticos y abióticos influyeron significativamente en la concentración de AG. Las especies subtropicales presentaron una concentración 42.1 mayor de EPA+DHA que las tropicales. Los valores presentados pueden cambiar según modificaciones en el ecosistema y en las características de cada especie, sin embargo, el conocimiento aquí generado es útil para mejorar las recomendaciones sobre el consumo de pescado.

Commercial trials using emamectin benzoate to control sea lice Lepeophtheirus salmonis infestations in Atlantic salmon Salmo salar.

Science.gov (United States)

Stone, J; Sutherland, I H; Sommerville, C; Richards, R H; Varma, K J

2000-06-19

Two trials were conducted at commercial salmon farms to evaluate the efficacy of emamectin benzoate (Slice, 0.2% aquaculture pre-mix, Schering-Plough Animal Health) as a treatment for sea lice Lepeophtheirus salmonis (Krøyer) and Caligus elongatus Nordmann infestations in Atlantic salmon Salmo salar L. Trials were carried out in 15 m2 commercial sea pens, at temperatures of 5.5 to 7.5 degrees C and 10.8 to 13.8 degrees C. Each pen was stocked with 14,000 to 17,500 fish with mean weights of 0.44 to 0.74 and 1.33 to 1.83 kg. Fish were naturally infested with sea lice at the start of each trial. At Day -1, samples of 10 or 15 fish were taken from each pen to determine pre-treatment numbers of lice. Emamectin benzoate was administered in feed, to 4 replicate pens, at a dose of 50 micrograms kg-1 biomass d-1 for 7 consecutive days (Days 0 to 6). Sea lice were counted again, between Days 7 and 77, and comparisons made with untreated control fish. Despite adverse weather conditions, wide variations in fish weights and exposure to new infestations, treatment was effective against chalimus and motile stages of L. salmonis. In the autumn trial, efficacy at Day 27 was 89%, and lice numbers remained lower on treated fish than on control fish 64 d from the start of treatment. In the winter trial, reductions in lice numbers at low temperatures were slower but good efficacy was achieved by Day 35. Although control fish had to be treated with hydrogen peroxide at Day 21, fish treated only with emamectin benzoate on Days 0 to 6 still had 89% fewer lice than control fish at Day 35. There were very few C. elongatus present, but at the end of both trials numbers were lower on treated fish. No adverse effects were associated with treatment of fish with emamectin benzoate.

Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

Science.gov (United States)

Russell, Shaina; Sullivan, Caroline A; Reichelt-Brushett, Amanda J

2015-01-01

Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%). Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%). Survey results revealed that Myxus elongatus (Sand mullet) and naturally recruited Saccostrea glomerata (Sydney rock oysters) continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the provisional

Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

Directory of Open Access Journals (Sweden)

Shaina Russell

Full Text Available Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%. Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%. Survey results revealed that Myxus elongatus (Sand mullet and naturally recruited Saccostrea glomerata (Sydney rock oysters continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the

The impacts of climate change and disturbance on spatio-temporal trajectories of biodiversity in a temperate forest landscape.

Science.gov (United States)

Thom, Dominik; Rammer, Werner; Dirnböck, Thomas; Müller, Jörg; Kobler, Johannes; Katzensteiner, Klaus; Helm, Norbert; Seidl, Rupert

2017-02-01

1. The ongoing changes to climate challenge the conservation of forest biodiversity. Yet, in thermally limited systems, such as temperate forests, not all species groups might be affected negatively. Furthermore, simultaneous changes in the disturbance regime have the potential to mitigate climate-related impacts on forest species. Here, we (i) investigated the potential long-term effect of climate change on biodiversity in a mountain forest landscape, (ii) assessed the effects of different disturbance frequencies, severities and sizes and (iii) identified biodiversity hotspots at the landscape scale to facilitate conservation management. 2. We employed the model iLand to dynamically simulate the tree vegetation on 13 865 ha of the Kalkalpen National Park in Austria over 1000 years, and investigated 36 unique combinations of different disturbance and climate scenarios. We used simulated changes in tree cover and composition as well as projected temperature and precipitation to predict changes in the diversity of Araneae, Carabidae, ground vegetation, Hemiptera, Hymenoptera, Mollusca, saproxylic beetles, Symphyta and Syrphidae, using empirical response functions. 3. Our findings revealed widely varying responses of biodiversity indicators to climate change. Five indicators showed overall negative effects, with Carabidae, saproxylic beetles and tree species diversity projected to decrease by more than 33%. Six indicators responded positively to climate change, with Hymenoptera, Mollusca and Syrphidae diversity projected to increase more than twofold. 4. Disturbances were generally beneficial for the studied indicators of biodiversity. Our results indicated that increasing disturbance frequency and severity have a positive effect on biodiversity, while increasing disturbance size has a moderately negative effect. Spatial hotspots of biodiversity were currently found in low- to mid-elevation areas of the mountainous study landscape, but shifted to higher

Annotated list of marine alien species in the Mediterranean with records of the worst invasive species

Directory of Open Access Journals (Sweden)

A. ZENETOS

2005-12-01

Full Text Available This collaborative effort by many specialists across the Mediterranean presents an updated annotated list of alien marine species in the Mediterranean Sea. Alien species have been grouped into six broad categories namely established, casual, questionable, cryptogenic, excluded and invasive, and presented in lists of major ecofunctional/taxonomic groups. The establishment success within each group is provided while the questionable and excluded records are commented in brief. A total of 963 alien species have been reported from the Mediterranean until December 2005, 218 of which have been classified as excluded (23% leaving 745 of the recorded species as valid aliens. Of these 385 (52% are already well established, 262 (35% are casual records, while 98 species (13% remain “questionable” records. The species cited in this work belong mostly to zoobenthos and in particular to Mollusca and Crustacea, while Fish and Phytobenthos are the next two groups which prevail among alien biota in the Mediterranean. The available information depends greatly on the taxonomic group examined. Thus, besides the three groups explicitly addressed in the CIESM atlas series (Fish, Decapoda/Crustacea and Mollusca, which are however updated in the present work, Polychaeta, Phytobenthos, Phytoplankton and Zooplankton are also addressed in this study. Among other zoobenthic taxa sufficiently covered in this study are Echinodermata, Sipuncula, Bryozoa and Ascidiacea. On the contrary, taxa such as Foraminifera, Amphipoda and Isopoda, that are not well studied in the Mediterranean, are insufficiently covered. A gap of knowledge is also noticed in Parasites, which, although ubiquitous and pervasive in marine systems, have been relatively unexplored as to their role in marine invasions. Conclusively the lack of funding purely systematic studies in the region has led to underestimation of the number of aliens in the Mediterranean. Emphasis is put on those species that are

Gundlachia dutrae: n. sp. from northwest Brazil (Mollusca: Basommatophora: Ancylidae

Directory of Open Access Journals (Sweden)

Sonia Barbosa dos Santos

1994-06-01

Full Text Available A new species of Gundlachia, Gundlachia dutrae is described from northwest Brazil. It is distinguishable from other congenerie species by characteristics of the shell, radula and internal organs. Shell relatively high. Aperture near-circular; periostracum dark brown without periostracal hairs. Apex slightly inclined to the right, projected but not hooked, with an apical depression surrounted by a sculpture of well-marked irregular punctations. Shell surface with prominent radial sculpture. No septate specimens were observed. Ratios (n= 59: shell width/shell lenght = 0,66- 0,79 (mean 0,73; shell height/shell length = 0,32- 0,45 ( mean 0,37; shell height/shell width = 0,43- 0,63 (mean 0,51. Body of normal ancylid type; mantle pigmentation dark brown or black, concentrated along the mantle collar. The dorsal surface of the right anterior muscle is elongated and medially constricted. The left anterior and the posterior muscles are almost elliptical. Adhesive area is V-shaped. Pseudobranch unpigmented bearing a very small and thin dorsal lobe. Ovotestis with more than 25 unbranched diverticula. Ovispermiduct with seminal vesicle rather developed. Elongated nidamental gland continous with the glandular wall of the uterus. Nidamental gland appendix ending into a bulbous swelling Spermathecal body almost rounded. Well-developed prostate with five long diverticula. Ejaculatory complex with long glandular flagellum, without a penis or true ultra-penis. "Penis sheath" developed. "Ultra-penis" projected as a tube inside the lumem of prepuce, with a slit between "ultra-penis" and "penis sheath". Rachidian tooth tetracuspid, with two median cusps assymmetrical and aculeated. Lateral teeth tricuspid, with a reduced endocon and a prominent mesocon. A well marked gap occurs between meso and ectocon. Marginal teeth similar to lateral ones. Jaw T-shaped, with about 28 dorsal plates.

Intramantle Inking: A Stress Behavior in Octopus bimaculoides (Mollusca: Cephalopoda)

Science.gov (United States)

Toll, Ronald B

2011-01-01

Several Pacific 2-spot octopuses (Octopus bimaculoides) shipped from California and held in a recirculating seawater system at Illinois College exhibited an unusual postshipping stress behavior not previously documented in the literature. Ink, normally ejected into the surrounding seawater, was uncharacteristically retained in the mantle cavity. We describe the resulting behaviors, discuss successful resuscitation efforts, and briefly consider the possible role(s) that ink may have played in the death of one octopus. PMID:22330791

Clio pyramidata Linnaeus, 1767 forma convexa (Boas, 1886) (Mollusca, Pteropoda)

NARCIS (Netherlands)

Spoel, van der S.

1973-01-01

The pelagic fauna of the Red Sea shows special variation induced by its isolated character (Van der Spoel, 1971). Clio pyramidata from the Red Sea is usually incorrectly referred to as the tropical forma lanceolata (Lesueur, 1813) or the typical forma pyramidata Linnaeus, 1767. Some large samples

Nematodes from Achatina fulica Bowdich, 1822 (Mollusca: Gastropoda in Argentina

Directory of Open Access Journals (Sweden)

Valente R.

2016-03-01

Full Text Available The aim of this study is to describe the nematode cysts and larvae found in Achatina fulica, the giant African snail, in the northeast of Argentina. A total of 373 snails were collected from the cities of Puerto Iguazú and Corrientes. Cysts (N= 2958 containing nematodes identified as L3 Strongyluris sp. were found in the mantle cavity of 87 snails from Puerto Iguazú City (Prevalence 23 %; Mean Intensity= 34; Mean Abundance= 8. The shell size correlated with prevalence, mean intensity and mean abundance (p < 0.05 indicating that there is an exposure-infection constant rather than an accidental one. In other hand, the absence of infection in the smallest shell size suggests a threshold of size to be infected. Taking into account that there exist records of A. fulica infected by nematodes of medical and veterinary importance such as Angiostrongylus and Aelurostrongylus in some Brazilian states near Puerto Iguazú, we emphasize the need for snail surveillance.

The genus Trematocarpus (Sarcodiaceae, Rhodophyta in southern Africa and the exclusion of Sphaerococcus (Chondrus scutellatus

Directory of Open Access Journals (Sweden)

R. H. Simons

1983-11-01

Full Text Available Trematocarpus Kützing in southern Africa is found to comprise four taxa in three species: newly described is T.  fragilis (Ag. De Toni var. divaricatus Simons, var. nov. Two of the species, T. flabellatus (J. Ag. De Toni and T.  affinis (J. Ag. De Toni are restored to independent specific rank after being regarded as synonyms of T.  scutellatus (Her. Searles. It is shown that  Sphaerococcus (Chondrus scutellatus Her., the basionym of  T.  scutellatus refers to a species of Gigartina, therefore a new combination Gigartina scutellata (Her. Simons is made for this species which was formerly known as G. fastigiata J. Ag. and G. scabiosa (Kiitz. Papenf. Trematocarpus elongatus Kiitz. is relegated to synonymy under T. fragilis var.  divaricatus.

Life-stage-specific differences in exploitation of food mixtures: diet mixing enhances copepod egg production but not juvenile development

DEFF Research Database (Denmark)

Koski, Marja; Breteler, W.K.; Schogt, N.

2006-01-01

, the copepods failed to moult past the first copepodite stage, and the mortality was high. In sharp contrast, mixing two nutritionally poor food species often resulted in egg production which was not significantly different from nutritionally high quality food, although hatching success in many mixtures was low......Development, egg production and hatching success of the calanoid copepods Temora longicornis and Pseudocalanus elongatus were measured in food mixtures to test their ability to obtain a complete nutrition by combining different nutritionally poor food species. In all the food mixtures used....... Whereas egg production was significantly correlated with particulate organic nitrogen in the diet, and independent of the highly unsaturated fatty acids (HUFAs), eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA), hatching increased with increasing DHA and EPA concentration. Growth and juvenile...

Specific Interaction between Redox Phospholipid Polymers and Plastoquinone in Photosynthetic Electron Transport Chain.

Science.gov (United States)

Tanaka, Kenya; Kaneko, Masahiro; Ishikawa, Masahito; Kato, Souichiro; Ito, Hidehiro; Kamachi, Toshiaki; Kamiya, Kazuhide; Nakanishi, Shuji

2017-04-19

Redox phospholipid polymers added in culture media are known to be capable of extracting electrons from living photosynthetic cells across bacterial cell membranes with high cytocompatibility. In the present study, we identify the intracellular redox species that transfers electrons to the polymers. The open-circuit electrochemical potential of an electrolyte containing the redox polymer and extracted thylakoid membranes shift to positive (or negative) under light irradiation, when an electron transport inhibitor specific to plastoquinone is added upstream (or downstream) in the photosynthetic electron transport chain. The same trend is also observed for a medium containing living photosynthetic cells of Synechococcus elongatus PCC7942. These results clearly indicate that the phospholipid redox polymers extract photosynthetic electrons mainly from plastoquinone. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

A new species of Tereancistrum (Monogenea, Dactylogyridae) from the gills of three Leporinus species (Characiformes, Anostomidae) and a revised description of Tereancistrum parvus.

Science.gov (United States)

Zago, Aline C; Yamada, Fábio H; Franceschini, Lidiane; Bongiovani, Marcela F; Yamada, Priscilla O F; Silva, Reinaldo J DA

2017-01-01

The present study describes Tereancistrum flabellum n. sp. (Dactylogyridae, Ancyrocephalinae) from the gills of the anostomid fishes Leporinus friderici, Leporinus amblyrhynchus and Leporinus elongatus from two freshwater ecosystems in the south east of Brazil. This new species is mainly characterized by the morphology of the copulatory complex (such as the MCO base formed by two fan-shaped structures, and accessory piece flattened, curved, rigid and channeled), a dorsal anchor with a well-developed superficial and inconspicuous deep root, and the shape of the accessory anchor sclerite with small spathulate termination. Tereancistrum flabellum n. sp. is the first record of a dactylogyrid from L. amblyrhynchus. The description of Tereancistrum parvus is also emended to correct and complement previous descriptions and the species is reported for the first time in Schizodon nasutus.

Ocean Acidification Causes Increased Calcium Carbonate Turnover during Larval Shell Formation

Science.gov (United States)

Frieder, C.; Pan, F.; Applebaum, S.; Manahan, D. T.

2016-02-01

Mollusca is a major taxon for studies of the evolution and mechanisms of calcification. Under current and future ocean change scenarios, decreases in shell size have been observed in many molluscan species during early development. The mechanistic basis for these decreases are of significant interest. In this study, Pacific oyster larvae (Crassostrea gigas) reared at aragonite undersaturation (Ω > 1). Coupling radioisotope tracer assays with mineral mass measurements allowed calculation of calcification budgets for first shell formation in veliger stage larvae. Three primary mechanisms (in order of increasing effect) contributed to the change in shell mass at undersaturation: delayed onset of calcification, increased dissolution rates, and decreased net calcification rates. The observation of dissolution indicates turnover of the newly formed shell, and physicochemical constraints of undersaturation provide a mechanistic basis for decreased calcification.

Natural diet of three species of shrimp in a tropical coastal lagoon

Directory of Open Access Journals (Sweden)

Albertoni Edélti Faria

2003-01-01

Full Text Available The gut content of 495 specimens of Farfantepenaeus brasiliensis, 131 of F. paulensis (Penaeidae and 102 of Macrobrachium acanthurus (Palaemonidae were analyzed to establish the composition of their diets F. brasiliensis had as the most important feeding items in its diet larvae of Chironomidae, Polychaeta and Heleobia australis (Mollusca. For F. paulensis, the most important items were the same as for F. brasiliensis, but the order of importance of H. australis and Polychaeta was inverted. M. acanthurus had detritus as the most important item, followed by Chironomidae larvae, Odonata nymphs, and fragments of the macroalgae Chara. The results showed that the three species were omnivorous, with a varied diet including both components of macrofauna of benthos and associated to the macroalgae Chara and plant fragments and detritus.

Distribucion arborea de los gastropodos cerithidea montagnei (mollusca potamidae y littorina Spp. (Mollusca, Littorinidae en el manglar de Mata de Limón, Costa Rica

Directory of Open Access Journals (Sweden)

Édgar Suarez B

2016-03-01

Full Text Available En el manglar de Mata de Limón, Puntarenas, Costa Rica, se estudió la distribución y preferencia por el susbtrato arbóreo de gastrópodos C. montagnei y Littorina spp. en cuatro especies de mangle, según la cantidad de moluscos observados en cada árbol y la cantidad de árboles con presencia o ausencia de ellos, en el período de setiembre de 1982 a junio de 1983. El orden de preferencia mostrado por ambos grupos de moluscos fue: 1 Rhizophora mangle, 2 Avicennia germinans, 3Pelliciera rhizophorae y 4 Laguncularia racemosa. Se discuten las posibles razones de esta preferencia. Cerithidea montagnei presentó una mayor distribución horizontal, así como una mayor abundancia respecto de Littorina spp.

Ocorrência do bivalve exótico Mytilopsis leucophaeta (Conrad (Mollusca, Bivalvia, no Brasil Occurrence of exotic bivalve Mytilopsis leucophaeta (Conrad (Mollusca, Bivalvia, in Brazil

Directory of Open Access Journals (Sweden)

José R. B. de Souza

2005-12-01

Full Text Available O molusco Mytilopsis leucophaeta (Conrad, 1831, natural da América do Norte, foi localizado no litoral de Pernambuco, Brasil, em 2004, trazido provavelmente por água de lastro de navios. Na região, sua distribuição atualmente abrange zonas estuarinas adjacentes ao Porto do Recife. Os organismos foram encontrados restritos à região entre-marés, formando agregados densos com até 176.800 ind./m².The mussel Mytilopsis leucophaeta (Conrad, 1831 is native to North America. It was found at Pernambuco Coast, northeastern Brazil, in 2004, probably brought by ships' ballast water. The distribution of this species has been now spread to estuarial area near Recife Harbour. They showed a clumped distribution with a maximum of 176,800 ind./m² only in the intertidal zone.

Especies nuevas del género Gibberula (Mollusca: Cystiscidae de Cuba y Venezuela New species of the genus Gibberula (Mollusca: Cystiscidae from Cuba and Venezuela

Directory of Open Access Journals (Sweden)

José Espinosa

2011-03-01

Full Text Available Se describen 3 especies nuevas de moluscos marinos: Gibberula palmasola sp. n., recolectada en la vegetación asociada a rocas rodeadas de sedimentos blandos en una laguna costera cercada por mangle en la península de Guanahacabibes, Cuba, y caracterizada por presentar, el animal vivo, la cabeza negra y una distribución típica de bandas negras y pardas con lunares anaranjados en el manto bajo la concha; Gibberula dosmosquises sp. n., recolectada en fondos rocosos del Caribe insular de Venezuela, se caracteriza por una discreta coloración del manto y un patrón de manchas en el pie, y Gibberula thetisae sp. n, proveniente de los pastos marinos del golfo de Batabanó, Cuba, con 3 pliegues en la columela, el último muy débil, y un labio externo casi cortante, caracteres que permiten separarla de todas las demás especies conocidas en el área antillana, aunque se desconozca la anatomía del animal. Se discute la lista de especies válidas del género para Cuba y Venezuela, y se hacen adiciones y consideraciones al complejo de especies en torno a Gibberula ubitaensis Espinosa y Ortea, 2000.Three new species of marine molluscs are described. Gibberula palmasola new species, collected in vegetation associated with rocks surrounded by soft sediments in a coastal lagoon surrounded by mangroves in Guanahacabibes Peninsula, Cuba, and characterized by a black head and typical distribution of black and brown bands and orange spots in the mantle. Gibberula dosmosquises new species, collected in rocky bottoms of a Caribbean island from Venezuela, characterized by a simple staining in the mantle and a pattern of spots on the foot, and Gibberula thetisae new species, from sea grass in the gulf of Batabano, Cuba, with shell having 3 columellar folds, the last very weak, and a sharp outer lip; although, its anatomy is not known, these conchological characters separate it from all other known species in the Antilles. Aditionally, the list of valid species for Cuba and Venezuela is discussed and some considerations about Gibberula ubitaensis Espinosa y Ortea, 2000 species complex are given.

Effects of Irregular Bimetallic Nanostructures on the Optical Properties of Photosystem I from Thermosynechococcus elongatus

Directory of Open Access Journals (Sweden)

Imran Ashraf

2015-07-01

Full Text Available The fluorescence of photosystem I (PSI trimers in proximity to bimetallic plasmonic nanostructures have been explored by single-molecule spectroscopy (SMS at cryogenic temperature (1.6 K. PSI serves as a model for biological multichromophore-coupled systems with high potential for biotechnological applications. Plasmonic nanostructures are fabricated by thermal annealing of thin metallic films. The fluorescence of PSI has been intensified due to the coupling with plasmonic nanostructures. Enhancement factors up to 22.9 and 5.1 are observed for individual PSI complexes coupled to Au/Au and Ag/Au samples, respectively. Additionally, a wavelength dependence of fluorescence enhancement is observed, which can be explained by the multichromophoric composition of PSI.

Global metabolic rewiring for improved CO2 fixation and chemical production in cyanobacteria

Science.gov (United States)

Kanno, Masahiro; Carroll, Austin L.; Atsumi, Shota

2017-03-01

Cyanobacteria have attracted much attention as hosts to recycle CO2 into valuable chemicals. Although cyanobacteria have been engineered to produce various compounds, production efficiencies are too low for commercialization. Here we engineer the carbon metabolism of Synechococcus elongatus PCC 7942 to improve glucose utilization, enhance CO2 fixation and increase chemical production. We introduce modifications in glycolytic pathways and the Calvin Benson cycle to increase carbon flux and redirect it towards carbon fixation. The engineered strain efficiently uses both CO2 and glucose, and produces 12.6 g l-1 of 2,3-butanediol with a rate of 1.1 g l-1 d-1 under continuous light conditions. Removal of native regulation enables carbon fixation and 2,3-butanediol production in the absence of light. This represents a significant step towards industrial viability and an excellent example of carbon metabolism plasticity.

Neuro-endocrine disruption in molluscs

DEFF Research Database (Denmark)

Holbech, Henrik; Bech Sanderhoff, Lene; Waller, Stine P.

The Mollusca phylum is the second largest animal phylum with around 85,000 registered mollusc species and increasing attention to effects of chemicals on the molluscan endocrine system have been given during the last years. This includes initiation of the development of OECD test guidelines (TG...... efficient and fast in vivo system using embryos of the freshwater pulmonate gastropod Lymnaea stagnalis (the great pond snail). It is known that serotonin and dopamine are involved in many reproductive processes in molluscs Incl. egg maturation and spawning and that pedal ciliary activity causing L....... stagnalis embryos to rotate in the eggs is serotonin/dopamine regulated. We have developed a system to quantify embryo rotation and present results of exposure to serotonin, dopamine and different anti-depressive pharmaceuticals (e.g. selective serotonin reuptake inhibitors, SSRI´s) using the L. stagnalis...

A new Indo-Pacific Zebina species (Mollusca: Gastropoda: Rissoidae)

OpenAIRE

Sleurs, W.J.; Van Goethem, J.L.

2002-01-01

A new, widespread, but uncommon Indo-Pacific rissoinine species, Zebina ( ? Zebina) malagazzae sp. nov. is described. It is compared with its morphologically closest relative, the tropical Eastern Pacific species Zebina axeliana (STRONG & HERTLEIN, 1951 ), with the holotype of Zebina constricta LASERON, 1956 from Christmas Island and with Zebina ( ?Zebina) japonica (WEINKAUFF, 1881).

Molecular phylogeny of pearl oysters and their relatives (Mollusca, Bivalvia, Pterioidea

Directory of Open Access Journals (Sweden)

Tëmkin Ilya

2010-11-01

Full Text Available Abstract Background The superfamily Pterioidea is a morphologically and ecologically diverse lineage of epifaunal marine bivalves distributed throughout the tropical and subtropical continental shelf regions. This group includes commercially important pearl culture species and model organisms used for medical studies of biomineralization. Recent morphological treatment of selected pterioideans and molecular phylogenetic analyses of higher-level relationships in Bivalvia have challenged the traditional view that pterioidean families are monophyletic. This issue is examined here in light of molecular data sets composed of DNA sequences for nuclear and mitochondrial loci, and a published character data set of anatomical and shell morphological characters. Results The present study is the first comprehensive species-level analysis of the Pterioidea to produce a well-resolved, robust phylogenetic hypothesis for nearly all extant taxa. The data were analyzed for potential biases due to taxon and character sampling, and idiosyncracies of different molecular evolutionary processes. The congruence and contribution of different partitions were quantified, and the sensitivity of clade stability to alignment parameters was explored. Conclusions Four primary conclusions were reached: (1 the results strongly supported the monophyly of the Pterioidea; (2 none of the previously defined families (except for the monotypic Pulvinitidae were monophyletic; (3 the arrangement of the genera was novel and unanticipated, however strongly supported and robust to changes in alignment parameters; and (4 optimizing key morphological characters onto topologies derived from the analysis of molecular data revealed many instances of homoplasy and uncovered synapomorphies for major nodes. Additionally, a complete species-level sampling of the genus Pinctada provided further insights into the on-going controversy regarding the taxonomic identity of major pearl culture species.

Molecular phylogeny of pearl oysters and their relatives (Mollusca, Bivalvia, Pterioidea)

Science.gov (United States)

2010-01-01

Background The superfamily Pterioidea is a morphologically and ecologically diverse lineage of epifaunal marine bivalves distributed throughout the tropical and subtropical continental shelf regions. This group includes commercially important pearl culture species and model organisms used for medical studies of biomineralization. Recent morphological treatment of selected pterioideans and molecular phylogenetic analyses of higher-level relationships in Bivalvia have challenged the traditional view that pterioidean families are monophyletic. This issue is examined here in light of molecular data sets composed of DNA sequences for nuclear and mitochondrial loci, and a published character data set of anatomical and shell morphological characters. Results The present study is the first comprehensive species-level analysis of the Pterioidea to produce a well-resolved, robust phylogenetic hypothesis for nearly all extant taxa. The data were analyzed for potential biases due to taxon and character sampling, and idiosyncracies of different molecular evolutionary processes. The congruence and contribution of different partitions were quantified, and the sensitivity of clade stability to alignment parameters was explored. Conclusions Four primary conclusions were reached: (1) the results strongly supported the monophyly of the Pterioidea; (2) none of the previously defined families (except for the monotypic Pulvinitidae) were monophyletic; (3) the arrangement of the genera was novel and unanticipated, however strongly supported and robust to changes in alignment parameters; and (4) optimizing key morphological characters onto topologies derived from the analysis of molecular data revealed many instances of homoplasy and uncovered synapomorphies for major nodes. Additionally, a complete species-level sampling of the genus Pinctada provided further insights into the on-going controversy regarding the taxonomic identity of major pearl culture species. PMID:21059254

Variações anatômicas em Lymnaea columella (Mollusca, Gastropoda

Directory of Open Access Journals (Sweden)

Marlene T. Ueta

1977-12-01

Full Text Available Foram estudadas variações anatômicas de espécimes de L. columella coletados de diferentes criadouros situados em diversos Municípios do Estado de São Paulo: Campinas, Americana, Atibaia, Pirassununga, Caçapava e Taubaté. As comparações morfométricas foram baseadas em estudos do aparelho genital, rim e rádula. Foram medidos, para cada criadouro, os comprimentos do conjunto útero-vagina, dueto da espermateca, prepúcio e bainha do pênis. Foram ainda calculados os índices de relação entre bainha do pênis/prepúcio e estabelecidos os coeficientes de correlação entre comprimento da concha e comprimento do prepúcio. Cortes longitudiais do complexo peniano foram também objeto de estudo. Em relação a rádula foram determinados o número de fileiras transversais e o número de dentes por fileira, e estabelecida uma fórmula radular aproximada para os diversos criadouros.Soft parts of Lymnaea columella from ten populations from the State of São Paulo were studied in order to determine morphometric variations. These morphometric cornparisons were made upon reproductive system, kidney and radula of snail samples collected in different municipalities: Campinas, Americana, Atibaia, Pirassununga, Caçapava and Taubaté. Length measurementes of uterus, duct of spermatheca, prepuce and penis sheath were taken; the ratio penis sheath/prepuce and correlation coefficients between length of shell and length of prepuce were established. Longitudinal sections of penial complex were also studied. The number of trans verse rows, number of teeth per rows and the length of shell were determined. For each sample, the radular formula was indicated.

Using DNA barcoding to differentiate invasive Dreissena species (Mollusca, Bivalvia

Directory of Open Access Journals (Sweden)

Jonathan Marescaux

2013-12-01

Full Text Available The zebra mussel (Dreissena polymorpha and the quagga mussel (Dreissena rostriformis bugensis are considered as the most competitive invaders in freshwaters of Europe and North America. Although shell characteristics exist to differentiate both species, phenotypic plasticity in the genus Dreissena does not always allow a clear identification. Therefore, the need to find an accurate identification method is essential. DNA barcoding has been proven to be an adequate procedure to discriminate species. The cytochrome c oxidase subunit 1 mitochondrial gene (COI is considered as the standard barcode for animals. We tested the use of this gene as an efficient DNA barcode and found that it allow rapid and accurate identification of adult Dreissena individuals.

Using DNA barcoding to differentiate invasive Dreissena species (Mollusca, Bivalvia).

Science.gov (United States)

Marescaux, Jonathan; Van Doninck, Karine

2013-12-30

The zebra mussel (Dreissena polymorpha) and the quagga mussel (Dreissena rostriformis bugensis) are considered as the most competitive invaders in freshwaters of Europe and North America. Although shell characteristics exist to differentiate both species, phenotypic plasticity in the genus Dreissena does not always allow a clear identification. Therefore, the need to find an accurate identification method is essential. DNA barcoding has been proven to be an adequate procedure to discriminate species. The cytochrome c oxidase subunit I mitochondrial gene (COI) is considered as the standard barcode for animals. We tested the use of this gene as an efficient DNA barcode and found that it allow rapid and accurate identification of adult Dreissena individuals.

Gonad development during the early life of Octopus maya (Mollusca: Cephalopoda).

Science.gov (United States)

Avila-Poveda, Omar Hernando; Colin-Flores, Rafael Francisco; Rosas, Carlos

2009-02-01

Gonad development during the early life of Octopus maya is described in terms of histological, morphometric, oocytes growth, and somatic-oocyte relationship data obtained from octopus cultured at the UMDI-UNAM, in Sisal, Yucatan, Mexico. This study is the first publication on gonad development during the early life of Octopus maya. A total of 83 O. maya specimens were used; their sizes ranged from 6.5 to 76 mm of total length (TL), 4 to 28 mm of dorsal mantle length (DML), 2.5 to 20 mm of ventral mantle length (VML), and 0.0180 to 7.2940 g of fixed body weight (fBW). Animals were weighed and measured only after preservation. A loss of 10% of living weight was estimated for juvenile octopuses after formalin preservation. The relation of length to weight (VML, DML, TL/fBW) pooled for both sexes had a strong positive correlation (r), as shown by a potential power function that was quite close to 1. Compound images were produced from numerous microscopic fields. The histological examination revealed that, 4 months after hatching, male octopus (24.5 mm DML and 7.2940 g fBW) were in gonad stages 2 (maturing) to 3 (mature), with spermatogonia and spermatocytes in the tubule wall and abundant spermatids and spermatozoa in the central lumen of the seminiferous tubules, suggesting the occurrence of different phases of gonad development at different maturity stages. In contrast, females (22.5 mm DML and 4.8210 g fBW) at the same time since hatching were immature (stage 1), with many oogonia, few oocytes, and germinal epithelium. This suggests that males reach maturity earlier than females, indicating a probable onset of maturity for males at around 4 months of culture or 8 g of wet body weight. Our results indicate the possibility that the size-at-weight can be recognized early with a degree of certainty that allows the sexes to be separated for culture purposes; but more detailed studies on reproduction in relation to endocrinology and nutrition are needed.

Three New Records of Gastropoda (Mollusca) from the Nansha Islands, China

Science.gov (United States)

Chen, Zhiyun; Shi, Wei; Gong, Li

2018-04-01

The Nansha Islands, China, have extremely high marine biodiversity and hundreds of mollusks have been reported there. Benthos resources investigations of the intertidal and subtidal zone around the Nansha Islands have been continuously performed for decades, and recently, dozens of new species and new records of mollusks have been reported from this area. This paper dealt with three new record species of the Gastropoda from Chinese waters: Cerithium salebrosum Sowerby II, 1855, Vexillum militare (Reeve, 1845) and Vexillum bizonale (Dautzenberg et Bouge, 1923), respectively belonging to three families: Cerithiidae Fleming, 1822, and Costellariidae MacDonald, 1860. All specimens were collected from the Nansha Islands during the benthos resources investigations on the intertidal zone of islands and reefs in the South China Sea in recent years. Diagnosis and geographic descriptions of both genus and species, illustrations of each species were given in this contribution, and discussion of taxonomy, identification features and faunal characteristics were presented. All examined specimens were deposited in the Marine Biodiversity Collections of South China Sea, Chinese Academy of Sciences.

Invertebrate shells (mollusca, foraminifera) as pollution indicators, Red Sea Coast, Egypt

Science.gov (United States)

Youssef, Mohamed; Madkour, Hashem; Mansour, Abbas; Alharbi, Wedad; El-Taher, Atef

2017-09-01

To assess the degree of pollution and its impact on the environment along the Red Sea Coast, the most abundant nine species of recent benthic foraminifera and three species of molluscan shells have been selected for the analysis of Fe, Mn, Zn, Cu, Pb, Ni, Co, and Cd concentrations. The selected foraminiferal species are: Textularia agglutinans, Amphispsorus hemprichii, Sorites marginalis, Peneroplis planatus, Borelis schlumbergeri, Amphistegina lessonii, Ammonia beccarii, Operculina gaimairdi, and Operculinella cumingii. The selected molluscan shells are: Lambis truncata and Strombus tricornis (gastropods) and Tridacana gigas (bivalves). The inorganic material analysis of foraminifera and molluscs from the Quseir and Safaga harbors indicates that foraminifera tests include higher concentrations of heavy metals such as Fe and Mn than molluscan shells. These results are supported by the black tests of porcelaneous foraminifera and reflect iron selectivity. The Cd and Pb concentrations in molluscan shells are high in the El Esh Area because of oil pollution at this site. The Cu, Zn, and Ni concentrations in the studied invertebrates are high at Quseir Harbor and in the El Esh Area because of the strong influence of terrigenous materials that are rich in these metals. The heavy metal contamination is mostly attributed to anthropogenic sources.

The sensorial structures of Spondylus americanus Hermann,1781 (Mollusca: Bivalvia, Spondylidae

Directory of Open Access Journals (Sweden)

Marina Gomes Viana

2007-09-01

Full Text Available Adult animals of Spondylus americanus were analyzed and specialized sensorial structures, the sensorial papillae and the eyes, were characterized. The sensorial papillae were projections on the edge of the mantle in form of light brown fingers which had function of percepting stimulus coming from the medium. They were constituted by loose conjunctive tissues with longitudinal muscular fibers and externally covered by ciliated cubic epithelium, which presented high amount of melanocytes that gave the coloration of the papillae. The eyes were more complex, being on small stalks histologically similar to the papillae. They exhibited a circular formate and had a metallic blue color. Theses structures were constituted by a corneo epithelium, cornea, lens, retina, basal stalk, periocular band and optical nerve. The eyes were distributed asymmetrically to both valves related with the sedentarism of the species. Right valve presented a smaller number of eyes when compared to left one.Foram examinados exemplares adultos de Spondylus. americanus Hermann, 1781 e estruturas especializadas na percepção de estímulos foram caracterizadas: as papilas sensoriais e os ocelos. As papilas sensoriais são projeções do bordo manto em forma de dedos de cor castanha e com a função de perceber estímulos vindo do meio, são constituídas por tecido conjuntivo frouxo contendo fibras musculares longitudinais e revestidas externamente por epitélio cúbico ciliado, o qual apresenta grande quantidade de melanócitos, que dão a coloração das papilas. Os ocelos são mais complexos, estando sobre pequenos pedúnculos histologicamente semelhante às papilas, têm formato circular e possui cor azul metálica. Constituí-se por um epitélio córneo, córnea, lente, retina, pedúnculo basal, banda periocular e nervo óptico. Os ocelos distribuem-se assimetricamente por ambas as valvas, o que está relacionado com o sedentarismo da espécie. A valva direita apresenta menor número de ocelos quando comparada a esquerda.

Great Lakes DNA barcode reference library: Mollusca, annelida, and minor phyla

Science.gov (United States)

In recent years, the research and development of DNA-based tools has improved both their sensitivity and costs. This technology has the potential to be useful in the early detection of aquatic invasive species, and can increase the scope of surveillance compared with traditional ...

Evolutionary position of Peruvian land snails (Orthalicidae among Stylommatophora (Mollusca: Gastropoda

Directory of Open Access Journals (Sweden)

Jorge Ramirez

2011-07-01

Full Text Available The genera Bostryx and Scutalus (Orthalicidae: Bulimulinae are endemics from South America. They are mainly distributed on the western slopes of the Peruvian Andes. The goal of the present work was to assess their evolutionary position among the stylommatophoran gastropods based on the 16S rRNA mitochondrial marker. Four sequences were obtained, and along with 28 sequences of other Stylommatophora retrieved from the GenBank, were aligned with ClustalX. The phylogenetic reconstruction was carried out using the methods of Neighbor-Joining, Maximum Parsimony, Maximum Likelihood and Bayesian inference. The multiple sequence alignment had 371 sites, with indels. The two genera of the family Orthalicidae for the first time included in a molecular phylogeny (Bostryx and Scutalus, formed a monophyletic group along with another member of the superfamily Orthalicoidea (Placostylus, result that is comparable with that obtained with nuclear markers. Their evolutionary relationship with other land snails is also discussed.

Caloric variability of Corbicula fluminea (Mollusca, Bivalvia in Rosana Reservoir, Brazil

Directory of Open Access Journals (Sweden)

Yara Moretto Bagatini

2007-01-01

Full Text Available The purpose of the present study was to investigate temporal and longitudinal variation of caloric density of Corbicula fluminea in Rosana Reservoir. Significant differences concerning the caloric density of C. fluminea were observed throughout the year at the three reservoir sites. The caloric density variation during the year was probably related to reproductive activity, which demanded higher allocation of energy in certain period. The food source used by this species might be an important factor in the caloric value temporal and spatial variation of C. fluminea in Rosana Reservoir.O objetivo deste estudo foi investigar a variação temporal e longitudinal da densidade calórica de C. fluminea no reservatório de Rosana. Diferenças significativas na densidade calórica de C. fluminea foram observadas ao longo do ano e nas três estações do reservatório. A variação na densidade calórica de C. fluminea, durante o ano, provavelmente foi relacionada à atividade reprodutiva, que exige uma maior alocação de energia em determinado período. O recurso alimentar utilizado por esta espécie pode ser um importante fator na variação temporal e espacial do valor calórico de C. fluminea no reservatório de Rosana.

Wood-Boring Bivalves (Mollusca: Teredinidae, Pholadidae) of Pacific coast of Colombia

International Nuclear Information System (INIS)

Cantera K, Jaime R

2010-01-01

Twelve species of wood-boring bivalves, ten of the family Teredinidae and two of family Pholadidae were collected in mangroves at 6 locations of the Pacific coast of Colombia. This paper presents a brief escription of these species, including size, ecological notes and geographical distribution.

Development of a sperm cryopreservation protocol for redside dace, Clinostomus elongatus: implications for genome resource banking

DEFF Research Database (Denmark)

Butts, Ian A.E.; Mokdad, A.; Trippel, E.A.

2013-01-01

of extirpation.We developed cryopreservation protocols by testing the effects of diluent (buffered sperm motility-inhibiting saline solution [BSMIS]; BSMIS + glycine; sucrose; and Hanks’ balanced salt solution [HBSS]), cryoprotectant (dimethyl sulfoxide [DMSO]; propylene glycol [PG]; N,N-dimethylacetamide [DMA...... rate was not significant for BSMIS + glycine or for HBSS, but an effect was detected for sucrose, with sperm frozen at 5◦C/min or 10◦C/min having higher motility than sperm frozen at 1◦C/min. The effect of extender was not significant at 1◦C/min or 5◦C/min, but an effect was detected at 10◦C...

Short-term cold storage of sperm from six neotropical characiformes fishes

Directory of Open Access Journals (Sweden)

Simone Marques

2004-09-01

Full Text Available Sperm of the following Neotropical Characiformes fish species were tested for cold storage: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus and Prochilodus marggravii. Each sperm sample was split into two aliquots. The first was placed into a plastic bag with air or oxygen and the second, in a plastic tube with air. The samples were maintained at temperatures between 1.7-4.9 ºC. The rate of sperm motility was estimated using a 50 mM NaCl solution as the activating solution. The shortest sperm storage duration (7 h was recorded for L. friderici, when the sperm motility rate reached ~ 30%, whereas the longest duration (20 h was obtained with the sperm of P. lineatus. A fertilisation test using Prochilodus marggravii sperm refrigerated for 8 h yielded 88-90% of viable embryos. The refrigerated storage method could be of practical applications, especially in fish reproductive management at hatchery stations.O sêmen das seguintes espécies de Characiformes neotropicais foi testado para armazenamento em ambiente resfriado: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus e Prochilodus marggravii. Amostras de sêmen, obtidas por massagem da parede celômica, foram armazenadas em saco plástico com ar ou oxigênio ou em tubo plástico com ar, e mantidas resfriadas entre 1,7-4,9º C. A taxa de motilidade espermática foi estimada usando-se NaCl 50 mM como solução ativadora. O sêmen com menor duração de viabilidade (7 h foi o de L. friderici, quando a taxa de motilidade espermática alcançou ~30%, enquanto que o de maior duração (20 h foi o de P. lineatus. A fertilização de ovócitos utilizando sêmen refrigerado por 8 h de Prochilodus marggravii produziu 88-90% de embriões viáveis. O método de armazenamento desenvolvido neste trabalho tem aplicações práticas, especialmente no manejo reprodutivo de peixes em estações de

Engineering a cyanobacterium as the catalyst for the photosynthetic conversion of CO2 to 1,2-propanediol

Directory of Open Access Journals (Sweden)

Li Han

2013-01-01

Full Text Available Abstract Background The modern society primarily relies on petroleum and natural gas for the production of fuels and chemicals. One of the major commodity chemicals 1,2-propanediol (1,2-PDO, which has an annual production of more than 0.5 million tons in the United States, is currently produced by chemical processes from petroleum derived propylene oxide, which is energy intensive and not sustainable. In this study, we sought to achieve photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Compared to the previously reported biological 1,2-PDO production processes which used sugar or glycerol as the substrates, direct chemical production from CO2 in photosynthetic organisms recycles the atmospheric CO2 and will not compete with food crops for arable land. Results In this study, we reported photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Introduction of the genes encoding methylglyoxal synthase (mgsA, glycerol dehydrogenase (gldA, and aldehyde reductase (yqhD resulted in the production of ~22mg/L 1,2-PDO from CO2. However, a comparable amount of the pathway intermediate acetol was also produced, especially during the stationary phase. The production of 1,2-PDO requires a robust input of reducing equivalents from cellular metabolism. To take advantage of cyanobacteria’s NADPH pool, the synthetic pathway of 1,2-PDO was engineered to be NADPH-dependent by exploiting the NADPH-specific secondary alcohol dehydrogenases which have not been reported for 1,2-PDO production previously. This optimization strategy resulted in the production of ~150mg/L 1,2-PDO and minimized the accumulation of the incomplete reduction product, acetol. Conclusion This work demonstrated that cyanobacteria can be engineered as a catalyst for the photosynthetic conversion of CO2 to 1,2-PDO. This work also characterized two NADPH

Improved Alkane Production in Nitrogen-Fixing and Halotolerant Cyanobacteria via Abiotic Stresses and Genetic Manipulation of Alkane Synthetic Genes.

Science.gov (United States)

Kageyama, Hakuto; Waditee-Sirisattha, Rungaroon; Sirisattha, Sophon; Tanaka, Yoshito; Mahakhant, Aparat; Takabe, Teruhiro

2015-07-01

Cyanobacteria possess the unique capacity to produce alkane. In this study, effects of nitrogen deficiency and salt stress on biosynthesis of alkanes were investigated in three kinds of cyanobacteria. Intracellular alkane accumulation was increased in nitrogen-fixing cyanobacterium Anabaena sp. PCC7120, but decreased in non-diazotrophic cyanobacterium Synechococcus elongatus PCC7942 and constant in a halotolerant cyanobacterium Aphanothece halophytica under nitrogen-deficient condition. We also found that salt stress increased alkane accumulation in Anabaena sp. PCC7120 and A. halophytica. The expression levels of two alkane synthetic genes were not upregulated significantly under nitrogen deficiency or salt stress in Anabaena sp. PCC7120. The transformant Anabaena sp. PCC7120 cells with additional alkane synthetic gene set from A. halophytica increased intracellular alkane accumulation level compared to control cells. These results provide a prospect to improve bioproduction of alkanes in nitrogen-fixing halotolerant cyanobacteria via abiotic stresses and genetic engineering.

Role of essential lipids in copepod nutrition: no evidence for trophic upgrading of food quality by a marine ciliate

DEFF Research Database (Denmark)

Klein Breteler, W.; Koski, Marja; Rampen, S.

2004-01-01

-quality Rhodomonas sp. diet. The specific mass of fatty acids in S. sulcatum was much lower than in the Dunaliella sp. diet, However, the fatty acid composition of the protozoan more or less resembled that of the food, lacking long-chain highly unsaturated fatty acids (HUFAs). Sterols only occurred in Dunaliella sp......The ciliate Strombidium sulcatum was used to feed and grow young stages of the copepods Temora longicornis (Muller) and Pseudocalanus elongatus (Boeck). The ciliate was cultured in the laboratory using either bacteria or the green alga Dunaliella sp. as a food source. Young copepodites of both......., although in low abundance of unuseful Delta7 sterols. Obviously, S. sulcatum did not biochemically enhance bacterial or algal food for subsequent use at higher trophic levels, and only transferred fatty acids without further conversion. The results indicate a deficiency in the ciliate of HUFAs and sterols...

Cyanobacterial diversity in extreme environments in Baja California, Mexico: a polyphasic study.

Science.gov (United States)

López-Cortés, A; García-Pichel, F; Nübel, U; Vázquez-Juárez, R

2001-12-01

Cyanobacterial diversity from two geographical areas of Baja California Sur, Mexico, were studied: Bahia Concepcion, and Ensenada de Aripez. The sites included hypersaline ecosystems, sea bottom, hydrothermal springs, and a shrimp farm. In this report we describe four new morphotypes, two are marine epilithic from Bahia Concepcion, Dermocarpa sp. and Hyella sp. The third, Geitlerinema sp., occurs in thermal springs and in shrimp ponds, and the fourth, Tychonema sp., is from a shrimp pond. The partial sequences of the 16S rRNA genes and the phylogenetic relationship of four cyanobacterial strains (Synechococcus cf. elongatus, Leptolyngbya cf. thermalis, Leptolyngbya sp., and Geitlerinema sp.) are also presented. Polyphasic studies that include the combination of light microscopy, cultures and the comparative analysis of 16S rRNA gene sequences provide the most powerful approach currently available to establish the diversity of these oxygenic photosynthetic microorganisms in culture and in nature.

Genetic variability in five species of Anostomidae (Ostariophysi - Characiformes

Directory of Open Access Journals (Sweden)

Chiari Lucimara

1999-01-01

Full Text Available Genetic variability was studied in five fish species (Anostomidae: Schizodon intermedius and S. nasutus and Leporinus friderici, L. elongatus and L. obtusidens, collected at one location on the Tibagi River (Paraná, Brazil. The protein data from seven systems coded collectively for 19 loci in the liver, muscle and heart. Nine of these loci were polymorphic. The estimated proportion of polymorphism loci ( varied from 16.7% in S. intermedius to 36.9% in L. friderici; the mean heterozygosity observed (o was 0.027 ± 0.015 and 0.109 ± 0.042, respectively. The estimated value of the genetic identity among L. friderici and S. intermedius (0.749 and S. nasutus (0.787 suggested that these are "congeneric" species. Morphological characteristics indicate that these species belong to distinct genera, while isoenzymatic data show that they are very similar at the genetic/biochemical level.

Records of new localities and hosts for crustacean parasites in fish from the eastern Amazon in northern Brazil.

Science.gov (United States)

Oliveira, Marcos Sidney Brito; Corrêa, Lincoln Lima; Oliveira Ferreira, Drielly; Neves, Lígia Rigor; Tavares-Dias, Marcos

2017-06-01

The aim of this study was to investigate parasites crustacean fauna in Arapaima gigas , Cichla monoculus , Cichla ocellaris , Cichla jariina , Satanoperca jurupari , Leporinus friderici , Leporinus fasciatus , Hoplias malabaricus , Phractocephalus hemioliopterus , Serrasalmus altispinis , Pseudoplatystoma tigrinum and Potamotrygon motoro of the State Amapá and Pará, in northern Brazil. A total of 242 parasites, including Argulus elongatus , Argulus multicolor, Argulus juparanaensis , Argulus nattereri , Dolops discoidalis , Dolops longicauda , Braga patagonica , Braga fluviatilis , Livoneca guianensis and undetermined Lernaeidae, were collected from these hosts. The Argulus species had the greatest richness among the community of parasitic crustaceans. There was a low abundance of parasites among the hosts, other than D. discoidalis , was most abundant in the integument of A. gigas and P. tigrinum . Finally, the present study reported nine new hosts for the crustacean parasite species and expanded knowledge of the occurrence of some parasite species in the Jari River basin, in eastern Amazon.

Photosystem II Water Oxidation: Mechanism, Efficiency and Flux in Diverse Oxygenic Phototrophs

Energy Technology Data Exchange (ETDEWEB)

Dismukes, Gerard Charles [Rutgers Univ., Piscataway, NJ (United States); Ananyev, Gennady [Rutgers Univ., Piscataway, NJ (United States); Gates, Colin [Rutgers Univ., Piscataway, NJ (United States)

2018-01-09

In one year, we pursued four aims: 1) extend the VZAD model to allow analysis of PSII chlorophyll fluorescence emission as modulated by interaction with the WOC (partial success); 2) compare the solar energy conversion efficiencies of PSII-WOCs from intact cells, isolated thylakoid membranes and PSII core complexes and crystals from cyanobacterium Thermosynechococcus elongatus (collaboration with Lawrence Berkeley National Laboratory; some success after changing collaborator); 3) determine whether PSIIs can store light energy by pumping protons across the thylakoid membrane (PSII-cyclic electron flow) and how it is regulated within the green alga Chlorella ohadii (collaboration with the Hebrew University of Jerusalem; some success); and 4) genetically replace the native PSII-D1 protein subunit from a higher plant with two cyanobacterial D1 isoforms to test whether their functional advantages in growth and photoprotection can be transferred (collaboration with Rutgers University; success).

Phylogenetic study of the arginine-vasotocin/arginine-vasopressin-like immunoreactive system in invertebrates.

Science.gov (United States)

Mizuno, J; Takeda, N

1988-01-01

1. A phylogenetic study of arg-vasotocin (AVT)/arg-vasopressin (AVP)-like immunoreactive cells was performed by the PAP method in the central nervous system of invertebrates. 2. The immunoreactivity was detected in the nerve cells of Hydra magnipapillata of the Coelenterata; Neanthes japonica and Pheretima communissima of the Annelida; Pomacea canaliculata, Aplysia kurodai, Oncidium verrucosum, Bradybaena similaris, Achatina fulica, Limax marginatus and Meretrix lamarckii of the Mollusca; Gnorimosphaeroma rayi, Hemigrapsus sanguineus, Gryllus bimaculatus and Baratha brassicae of the Arthropoda; Asterina pectinifera of the Echinodermata; and Halocynthia roretzi of the Protochordata. 3. No immunoreactivity was detected in Bipalium sp. of the Platyhelminthes, or in Procambarus clarkii and Helice tridens of the Arthropoda. 4. From these results, it appears that AVT/AVP is a phylogenetically ancient peptide which is present in a wide variety of invertebrates. 5. The actions of AVT/AVP and its presence in invertebrates are discussed.

Effect of pollution on diversity of marine gastropods and its role in trophic structure at Nasese Shore, Suva, Fiji Islands

Directory of Open Access Journals (Sweden)

Dissanayake Mudiyanselage Suratissa

2017-06-01

Full Text Available Ocean supplies a significant amount of food to human population. However, marine ecosystem is under a threat due to the increasing marine pollution. Fiji Islands, located in South Pacific sea, are experiencing such a threat. Therefore, this study aims to determine the effects of pollution on the diversity of marine gastropods in Nasese Shore, Suva, Fiji Islands. A detailed opportunistic survey was conducted; 85 species of marine gastropods molluscas were recorded belonging to 29 families in four different habitats (Habitat 1, Habitat 2, Habitat 3 and Habitat 4 at Nasese Shore during April–September 2014. Compared with Habitat 4, all three other habitats were polluted by frequently added sewages and domestic effluents via artificial and natural creeks to the coastal area. Therefore, diversity and abundance of the gastropods were significantly lower in those three habitats. Furthermore, a higher human consumption rate for some of the gastropods was observed.

Gluconeogenesis: An ancient biochemical pathway with a new twist.

Science.gov (United States)

Miyamoto, Tetsuya; Amrein, Hubert

2017-07-03

Synthesis of sugars from simple carbon sources is critical for survival of animals under limited nutrient availability. Thus, sugar-synthesizing enzymes should be present across the entire metazoan spectrum. Here, we explore the evolution of glucose and trehalose synthesis using a phylogenetic analysis of enzymes specific for the two pathways. Our analysis reveals that the production of trehalose is the more ancestral biochemical process, found in single cell organisms and primitive metazoans, but also in insects. The gluconeogenic-specific enzyme glucose-6-phosphatase (G6Pase) first appears in Cnidaria, but is also present in Echinodermata, Mollusca and Vertebrata. Intriguingly, some species of nematodes and arthropods possess the genes for both pathways. Moreover, expression data from Drosophila suggests that G6Pase and, hence, gluconeogenesis, initially had a neuronal function. We speculate that in insects-and possibly in some vertebrates-gluconeogenesis may be used as a means of neuronal signaling.

Biodiversity of macrozoobenthos some running waters of southern Moravia

Directory of Open Access Journals (Sweden)

Ivo Sukop

2010-01-01

Full Text Available The present work gives the results of the research of macrozoobenthos some running waters drai­na­ge areas of the Dyje River (southern Moravia – Czech Republic. Altogether, 762 taxa of macrozoobenthos were determined from the running waters of southern Moravia. Porifera (3, Hydrozoa (3, Turbellaria (8, Nematoda (14, Nematomorpha (1, Oligochaeta (60, Hirudinea (18, Bryozoa (5, Mollusca (44, Isopoda (2, Amphipoda (4, Decapoda (2, Hydracarina (17, Ephemeroptera (65, Plecoptera (55, Odonata (26, Heteroptera (3, Plannipennia (2, Trichoptera (128, Coleoptera (59, Diptera (243. Some taxa of macrozoobenthos are extinct unfortunately in running waters of Southern Moravia at present time. Another ones appear newly, for example snail Potamopyrgus antipodarum from New Zealand or Dreissena polymorpha from Pontic region. The data presented in this paper may serve as a basis for future monitoring of water quality and zoobenthos composition in connection with presumption of climate changes.

Modulations in cell-mediated immunity of Mytilus edulis following the 'Sea Empress' oil spill

International Nuclear Information System (INIS)

Dyrynda, E.A.; Dyrynda, P.E.J.; Ratcliffe, N.A.; Pipe, R.K.

1997-01-01

The 'Sea Empress' oil tanker grounded outside Milford Haven (Wales, UK) in February 1996, spilling ∼ 70,000 tonnes of crude oil and contaminating over 100 km of coastline, causing mass mortalities and strandings of at least 11 mollusc species. Intensive field monitoring commenced after the spill, examining immunity and hydrocarbon levels in the mussel, Mytilus edulis (Mollusca: Bivalvia), a commercially-harvested species which can accumulate contaminants. Comparisons of mussels from oiled and reference sites revealed significant modulations in cell-mediated immunity. Elevations in blood cell (haemocyte) numbers and decreases in superoxide generation and phagocytosis were identified in contaminated animals. The immune response of contaminated mussels gradually improved and generally showed no significant differences compared with clean mussels after 11 weeks. By then, total hydrocarbon content in contaminated mussels had declined by 70-90%, while polycyclic aromatic hydrocarbon content had decreased by over 90%. (author)

Integrity and activity of photosystem 2 complexes isolated from the thermophilic cyanobacterium Synechococcus elongatus using various detergents

Czech Academy of Sciences Publication Activity Database

Šetlíková, Eva; Sofrová, D.; Prášil, Ondřej; Budáč, Petr; Koblížek, Michal; Šetlík, Ivan

1999-01-01

Roč. 37, č. 2 (1999), s. 183-200 ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA ČR GA206/96/1266; GA ČR GA206/98/P110; GA MŠk VS96085; GA MŠk ME 138 Grant - others:NATO(EC) LG970388 Subject RIV: ED - Physiology Impact factor: 0.734, year: 1999

Single Molecule Spectroscopy on Photosynthetic Pigment-Protein Complexes

CERN Document Server

Jelezko, F; Schuler, S; Thews, E; Tietz, C; Wechsler, A; Wrachtrup, J

2001-01-01

Single molecule spectroscopy was applied to unravel the energy transfer pathway in photosynthetic pigment-protein complexes. Detailed analysis of excitation and fluorescence emission spectra has been made for peripheral plant antenna LHC II and Photosystem I from cyanobacterium Synechococcus elongatus. Optical transitions of individual pigments were resolved under nonselective excitation of antenna chlorophylls. High-resolution fluorescence spectroscopy of individual plant antenna LHC II indicates that at low temperatures, the excitation energy is localized on the red-most Chl a pool absorbing at 680 nm. More than one pigment molecule is responsible for the fluorescence emission of the LHC II trimer. The spectral lines of single Chl a molecules absorbing at 675 nm are broadened because of the Foerster energy transfer towards the red-most pigments. Low-temperature spectroscopy on single PS I trimers indicates that two subgroups of pigments, which are present in the red antenna pool, differ by the strength of t...

Preparation and HPLC isolation of L-[U-14C]tryptophan from enzyme hydrolysate labelled with 14C

International Nuclear Information System (INIS)

Novak, J.; Tintera, S.; Hromadkova, B.

1990-01-01

Tryptophan was obtained from biomass of the blue-green alga Synechococcus elongatus cultivated under 14 CO 2 . After partial purification, the protein fraction was subjected to enzymatic hydrolysis using pronase. Semipreparative isolation of L-[U- 14 C]tryptophan was accomplished on a HPLC column of Separon S Hema 1000 CM, 2% ethanol were added to the eluent, and a precolumn packed with the basic anion exchanger Spheron 1000 DEAE was used. Always after the passage of L-[U- 14 C]tryptophan, the precolumn was decoupled. The substance was collected in 96% ethanol. After removing the solvent by vacuum evaporation, the sample was analyzed on a column packed with Separon SIX C 18 in the eluent of 0.1M-NaH 2 PO 4 , 2% methanol. When the desired radiochemical purity was not attained, the sample was purified on Separon SIX C 18 using 2% methanol. The final radiochemical purity achieved by using this method is 98%. (P.A.). 5 figs., 2 tabs., 4 refs

Circadian clock protein KaiC forms ATP-dependent hexameric rings and binds DNA.

Science.gov (United States)

Mori, Tetsuya; Saveliev, Sergei V; Xu, Yao; Stafford, Walter F; Cox, Michael M; Inman, Ross B; Johnson, Carl H

2002-12-24

KaiC from Synechococcus elongatus PCC 7942 (KaiC) is an essential circadian clock protein in cyanobacteria. Previous sequence analyses suggested its inclusion in the RecADnaB superfamily. A characteristic of the proteins of this superfamily is that they form homohexameric complexes that bind DNA. We show here that KaiC also forms ring complexes with a central pore that can be visualized by electron microscopy. A combination of analytical ultracentrifugation and chromatographic analyses demonstrates that these complexes are hexameric. The association of KaiC molecules into hexamers depends on the presence of ATP. The KaiC sequence does not include the obvious DNA-binding motifs found in RecA or DnaB. Nevertheless, KaiC binds forked DNA substrates. These data support the inclusion of KaiC into the RecADnaB superfamily and have important implications for enzymatic activity of KaiC in the circadian clock mechanism that regulates global changes in gene expression patterns.

Enhancing the light-driven production of D-lactate by engineering cyanobacterium using a combinational strategy

Science.gov (United States)

Li, Chao; Tao, Fei; Ni, Jun; Wang, Yu; Yao, Feng; Xu, Ping

2015-05-01

It is increasingly attractive to engineer cyanobacteria for bulk production of chemicals from CO2. However, cofactor bias of cyanobacteria is different from bacteria that prefer NADH, which hampers cyanobacterial strain engineering. In this study, the key enzyme D-lactate dehydrogenase (LdhD) from Lactobacillus bulgaricus ATCC11842 was engineered to reverse its favored cofactor from NADH to NADPH. Then, the engineered enzyme was introduced into Synechococcus elongatus PCC7942 to construct an efficient light-driven system that produces D-lactic acid from CO2. Mutation of LdhD drove a fundamental shift in cofactor preference towards NADPH, and increased D-lactate productivity by over 3.6-fold. We further demonstrated that introduction of a lactic acid transporter and bubbling CO2-enriched air also enhanced D-lactate productivity. Using this combinational strategy, increased D-lactate concentration and productivity were achieved. The present strategy may also be used to engineer cyanobacteria for producing other useful chemicals.

Responses of the crab Heterozius rotundifrons to heterospecific chemical alarm cues: phylogeny vs. ecological overlap.

Science.gov (United States)

Hazlett, Brian A; McLay, Colin

2005-03-01

The big-handed brachyuran crab Heterozius rotundifrons extends the time spent in its anti-predator posture, limb extended posture, if exposed to chemical cues from crushed conspecifics. In this study, we tested whether crabs also respond to chemical cues from crushed heterospecific crabs, and if so, whether phylogenetic relations or ecological overlap is more important in influencing the duration of the anti-predator posture. Chemical cues from two other brachyuran crabs (Cyclograpsus lavauxi and Hemigrapsus sexdentatus), which do not overlap directly in ecological distribution with H. rotundifrons, elicited a duration of the anti-predator posture that was indistinguishable from that produced by conspecific chemical cues. In contrast, chemical cues from two anomuran crabs (Petrolisthes elongatus and Pagurus novizealandiae) that overlap in ecological distribution with H. rotundifrons, elicited durations of the antipredator posture that were significantly shorter than those of either conspecifics or more closely related crab species. Thus, phylogenetic relationship seems to be more important than ecological overlap in influencing anti-predator behavior in H. rotundifrons.

Optimization of isopropanol production by engineered cyanobacteria with a synthetic metabolic pathway.

Science.gov (United States)

Hirokawa, Yasutaka; Suzuki, Iwane; Hanai, Taizo

2015-05-01

Cyanobacterium is an attractive host for the production of various chemicals and alternative fuels using solar energy and carbon dioxide. In previous study, we succeeded to produce isopropanol using engineered Synechococcus elongatus PCC 7942 under dark and anaerobic conditions (0.43 mM, 26.5 mg/l). In the present study, we report the further optimization of this isopropanol producing condition. We then optimized growth conditions for production of isopropanol by the engineered cyanobacteria, including the use of cells in early stationary phase and buffering of the production medium to neutral pH. We observed that shifting of cultures from dark and anaerobic to light and aerobic conditions during the production phase dramatically increased isopropanol production by conversion to isopropanol from acetate, byproduct under dark and anaerobic condition. Under the optimized production conditions, the titer of isopropanol was elevated 6-fold, to 2.42 mM (146 mg/l). Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

Different zooplankton structures in the German Bight

Science.gov (United States)

Martens, P.; Brockmann, U.

1993-06-01

In August 1982, a net of 48 stations with altogether 208 samples was investigated in the eastern German Bight with respect to temperature, salinity, as well as the amount and species composition of the mesozooplankton (>80 μm). The data were arranged into different structures by means of a cluster analysis. Four different clusters were found: (a) a “Wadden sea water” with few holoplankton organisms but a higher amount of spionid larvae; (b) a “German Bight water” with a maximum occurrence of turbellaria ( Alaurina composita) and medium concentrations of copepods; (c) a mixing area between these two water masses with highest amounts of Oikopleura dioica, Temora longicornis, Acartia sp., mussel larvae and larvae of the spionid worms; (d) a “North Sea water” mass with highest concentrations of Pseudocalanus elongatus, Paracalanus parvus und Oithona similis. The differences in the concentrations of the species mentioned between the four clusters were significant on the 0.1%-level.

Engineering an Obligate Photoautotrophic Cyanobacterium to Utilize Glycerol for Growth and Chemical Production.

Science.gov (United States)

Kanno, Masahiro; Atsumi, Shota

2017-01-20

Cyanobacteria have attracted much attention as a means to directly recycle carbon dioxide into valuable chemicals that are currently produced from petroleum. However, the titers and productivities achieved are still far below the level required in industry. To make a more industrially applicable production scheme, glycerol, a byproduct of biodiesel production, can be used as an additional carbon source for photomixotrophic chemical production. Glycerol is an ideal candidate due to its availability and low cost. In this study, we found that a heterologous glycerol respiratory pathway enabled Synechococcus elongatus PCC 7942 to utilize extracellular glycerol. The engineered strain produced 761 mg/L of 2,3-butanediol in 48 h with a 290% increase over the control strain under continuous light conditions. Glycerol supplementation also allowed for continuous cell growth and 2,3-butanediol production in diurnal light conditions. These results highlight the potential of glycerol as an additional carbon source for photomixotrophic chemical production in cyanobacteria.

Prolonging hypothermic storage (4 C) of bovine embryos with fish antifreeze protein.

Science.gov (United States)

Ideta, Atsushi; Aoyagi, Yoshito; Tsuchiya, Kanami; Nakamura, Yuuki; Hayama, Kou; Shirasawa, Atsushi; Sakaguchi, Kenichiro; Tominaga, Naomi; Nishimiya, Yoshiyuki; Tsuda, Sakae

2015-01-01

Embryos obtained via superovulation are necessary for mammalian artificial reproduction, and viability is a key determinant of success. Nonfreezing storage at 4 C is possible, but currently used storage solutions can maintain embryo viability for only 24-48 h. Here we found that 10 mg/ml antifreeze protein (AFP) dissolved in culture medium 199 with 20% (v/v) fetal bovine serum and 25 mM HEPES could keep bovine embryos alive for 10 days at 4 C. We used a recombinant AFP isolated from the notched-fin eelpout (Zoarces elongatus Kner). Photomicroscopy indicated that the AFP-embryo interaction was enhanced at 37 C. Embryos pre-warmed with the AFP solution at 37 C for 60 min maintained high viability, whereas those that were not pre-warmed could live no longer than 7 days. Thus, short-term storage of bovine embryos was achieved by a combination of AFP-containing medium and controlled pre-warming.

Fluorescent minerals - A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments

Science.gov (United States)

Omairi, Tareq; Wainwright, Milton

2015-07-01

We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark.

A New Environmentally Safe Formulation and of Low Cost for Prolonged Release System of Atrazine and Diuron

Directory of Open Access Journals (Sweden)

Gracy karla da Rocha Cortes

2017-07-01

Full Text Available Diuron and atrazine were incorporated in new formulations developed with the purpose to improve herbicides action through release systems, as well as to reduce the environmental toxicity. A low cost formulation (ALG/ESC was obtained by combining sodium alginate (ALG with fish scales of the Piau fish (ESC from the Leporinus elongatus species. From the crosslinking of ALG/ESC with CaCl2, the formulation ALG/ESC-CaCl2 was obtained. For ALG/ESC-CaCl2, the results are successful, showing a prolonged release of 3.5 and 4.5 days for atrazine and diuron, respectively. Based on parameters of an empirical equation used to fit the herbicide release data, it appears that the release systems of diuron and atrazine from ALG/ESC-CaCl2 are by diffusion processes due to anomalous transport, which did not follow Fick’s laws of diffusion. DOI: http://dx.doi.org/10.17807/orbital.v9i3.994

Internal radiation dose to the public from polonium-210 due to consumption of seafood from Bombay-harbour bay

International Nuclear Information System (INIS)

Bangera, V.S.; Rudran, Kamala

1995-01-01

Marine organisms such as fishes, molluscs and crustaceans are known to accumulate 210 Po. Distribution of 210 Po in coastal marine organisms mainly fishes and shell fishes is studied. Concentration of 210 Po obtained in muscle of common fishes (edible portion) varied from 2.10 ± 0.11 to 21.90 ± 5.00 Bq kg -1 dry muscle (for fishes like Pampus argenteus (Pomfret), Cynoglossus elongatus (sole), Rastrelliger kanagurta (mackerel), Harpodon nehereus (Bombay duck) etc. Concentration factors for 210 Po in edible portion of fish from sea water works out to 10 3 to 10 4 . Radiation dose to the public has been evaluated on the basis of daily intake of 40 g of fish (15 kg y -1 ). Committed effective dose (CED) to 210 Po due to consumption of sea food is calculated, CED varied from 2.05 x 10 -3 to 4 x 10 -2 mSv y -1 . (author). 7 refs., 3 figs., 3 tabs

[Phylogeny of protostome moulting animals (Ecdysozoa) inferred from 18 and 28S rRNA gene sequences].

Science.gov (United States)

Petrov, N B; Vladychenskaia, N S

2005-01-01

Reliability of reconstruction of phylogenetic relationships within a group of protostome moulting animals was evaluated by means of comparison of 18 and 28S rRNA gene sequences sets both taken separately and combined. Reliability of reconstructions was evaluated by values of the bootstrap support of major phylogenetic tree nodes and by degree of congruence of phylogenetic trees inferred by various methods. By both criteria, phylogenetic trees reconstructed from the combined 18 and 28S rRNA gene sequences were better than those inferred from 18 and 28S sequences taken separately. Results obtained are consistent with phylogenetic hypothesis separating protostome animals into two major clades, moulting Ecdysozoa (Priapulida + Kinorhyncha, Nematoda + Nematomorpha, Onychophora + Tardigrada, Myriapoda + Chelicerata, Crustacea + Hexapoda) and unmoulting Lophotrochozoa (Plathelminthes, Nemertini, Annelida, Mollusca, Echiura, Sipuncula). Clade Cephalorhyncha does not include nematomorphs (Nematomorpha). Conclusion was taken that it is necessary to use combined 18 and 28S data in phylogenetic studies.

Alien species on the coasts of Turkey

Directory of Open Access Journals (Sweden)

M.E. CINAR

2005-12-01

Full Text Available The compilation of data on alien species reported from the Turkish coasts yielded a total of 263 species belonging to 11 systematic groups, of which Mollusca had the highest number of species (85 species, followed by Crustacea (51, fishes (43 and phytobenthos (39. The Black Sea is represented by a total of 20 alien species, the Sea of Marmara by 48 species, the Aegean Sea by 98 species and the Levantine Sea by 202 species. The majority of aliens found in the Black Sea and the Sea of Marmara were transported via shipping, whereas the Levantine coast is extensively subjected to Lessepsian migration. Benthic habitats (soft and hard substrata comprise 76% of the total alien species and the pelagic environment is inhabited by thirty-nine species. Almost 50% of aliens collected from the Turkish coasts were found only at 0-10 m depth. Eight species occur at depths deeper than 100 m. The impacts of aliens on the benthic and pelagic ecosystems are presented.

How many marine aliens in Europe?

Directory of Open Access Journals (Sweden)

Stelios Katsanevakis

2013-01-01

Full Text Available In the framework of the European Alien Species Information Network (EASIN; http://easin.jrc.ec.europa.eu/, an inventory of marine alienspecies in Europe was created by critically reviewing existing information in 34 global, European, regional and national databases. In total, 1369 marine alien species have been reported in the European seas (including 110 cryptogenic and 139 questionable species; this is a substantial increase from the 737 species previously reported in 2009 based on the DAISIE (Delivering Alien Invasive Species Inventories for Europe; http://www.europe-aliens.org dataset. Most of the reported species were invertebrates (63.3%, followed by chromists (13.7%, vertebrates (11.6%, and plants (10.1%. Mollusca is the most numerous phylum, followed by Arthropoda, Chordata, and Annelida. Thecountries with the highest reported numbers of marine alien species were Israel, Turkey, Italy, France, Egypt and Greece. A reporting bias is evident as efforts for monitoring and reporting alien species vary among countries.

Chitons (Mollusca: Polyplacophora) from the Seychelles with description of a new species

NARCIS (Netherlands)

Kaast, P.

1996-01-01

Notes are given on nine chiton species, collected mainly during the 'Oceanic Reefs' Expedition to the Seychelles (1992-1993), with some biogeographical observations. Ischnochiton goudi (family Ischnochitonidae) is described as a new species.

Diversidad y microestructura de quitones (Mollusca: Polyplacophora del Caribe de Costa Rica

Directory of Open Access Journals (Sweden)

Cedar I García-Ríos

2011-03-01

Full Text Available Los poliplacóforos asociados a los arrecifes de coral en la costa caribeña de Costa Rica han sido poco estudiados. El examen del cascajo de coral acumulado en el sublitoral somero, en cuatro estaciones de colección, localizadas en la Provincia de Limón reveló una diversidad de quitones mayor a la documentada. Anteriormente se habían registrado ocho especies para el Caribe costaricense: Ischnochiton erythronotus (C.B. Adams, 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon, 1886; S. purpurascens (C.B. Adams, 1845; Acanthopleura granulata (Gmelin, 1791; Chiton marmoratus Gmelin, 1791; C. tuberculatus Linnaeus, 1758; Acanthochitona rhodea (Pilsbry, 1893. Otras cinco se registran aquí por primera vez: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954; Cryptoconchus floridanus (Dall 1889.

Integrative taxonomy of the genus Onchidium Buchannan, 1800 (Mollusca, Gastropoda, Pulmonata, Onchidiidae

Directory of Open Access Journals (Sweden)

Benoît Dayrat

2016-11-01

Full Text Available In an effort to clarify the species diversity of onchidiid slugs, the taxonomy of the genus Onchidium Buchannan, 1800 is revised using an integrative approach. New, fresh specimens were collected in a large number of places, including type localities. The genus Onchidium is redefined here as a clade including only three species which are strongly supported by both morphological and molecular data. All three species were already named: the type species O. typhae Buchannan, 1800, O. stuxbergi (Westerlund, 1883, and O. reevesii (J.E. Gray, 1850. With the exception of a re-description of O. typhae published in 1869, all three species are re-described here for the first time. First-hand observations on the color variation of live animals in their natural habitat are provided. The anatomy of each species is described. Important nomenclatural issues are addressed. In particular, Labella Starobogatov, 1976 is regarded as a junior synonym of Onchidium and Labella ajuthiae (Labbé, 1935 and O. nigrum (Plate, 1893 are regarded as junior synonyms of O. stuxbergi. The nomenclatural status of several other species names is discussed as well. Many new records are provided across South-East Asia and precise ranges of geographic distributions are provided for the genus Onchidium and its three species. Distinctive features that help distinguish the genus Onchidium from other onchidiids are provided, as well as an identification key for the three species.

Biomphalaria obstructa (Morelet, 1849: a study of topotypic specimens (Mollusca: pulmonata: planorbidae

Directory of Open Access Journals (Sweden)

W. Lobato Paraense

1990-12-01

Full Text Available A description of Biomphalaria obstructa (Morelet, 1849, based on specimens collected at its type locality - isla del carmen, state of Campeche, Mexico - is presented. The Shell is small, 13 mm in diameter, 3.5 mm in width and with 5.75 whorls in the largest specimen, thin, moderately lustrous and translucent, horn-colored. Whorls increasing regularly (neither slowly nor rapidly in diameter, rounded on the periphery side, bluntly angular on the left. Suture well-marked, deeper on the left. Right side widely concave, with first whorl deeply situated and partly hidden by the next. Left side shallower than right one, largely flattened, with first whorl plaintly visible. Aperture roundly heart-shaped, usually in the same plane as the body whorl but somewhat deflected to the left (less frequently to the right in some specimens. Peristome sharp, seldom blunt; a distinct callus on the parietal wall. A number of young shells develop one set (seldom more of apertural lamellae which tend to be resorbed as the shell grows. Absence of renal ridge. Ovotestis with about 70 mostly unbrached diverticula. Seminal vesicle beset with well-developed knoblike to fingerlike diverticula. Vaginal pouch more or less developed. Spermatheca club-shaped when empty, egg-shaped when full, and with intermediate forms between those extremes. Spermathecal body usually somewhat longer than the duct. Prostate with 7 to 20 (mean 12.06 ± 2.51 usually short diverticula which give off plumpish branches spreading out in a fan shape and overlapping to some extent their immediate neighbors. Foremost prostatic diverticulum nearly always partially or completely inserted between the spermathecal body and the uterine wall. Penial sheath consistently narrower and shorter than the prepuce. Muscular coat of the penis consisting of an inner longitudinal and an outer circular layers. Ratios between organ lengths: caudal to cephalic parts of female duct = 0.55 to 1.37 (mean 0.85 +- 0.17; cephalic parte of female duct to penial complex = 1.36 to 2.81 ((mean 1.90 +- 0.33; penial sheath to prepuce = 042 to 0.96 (mean 0.67 +- 0.13. Comparison with Morelet’s type specimens of Planorbis orbiculus and P. retusus points to the identity of those nominal species with B. obstructa.

Cellular biomarker responses of limpets (Mollusca as measure of sensitivity to cadmiumcontamination

Directory of Open Access Journals (Sweden)

Koot Reinecke

2008-09-01

Full Text Available Due to the availability and chemical nature of some heavy metals, sub-lethal toxicant levels may persist in the ocean waters and may cause physiological problems and toxicity in invertebrates and other marine organisms. Although studies of metal concentrations in False Bay showed relatively low mean concentrations of Cd, invertebrates such as molluscs, crustaceans and many other groups are able to accumulate high levels of heavy metals in their tissues and still survive in the heaviest polluted areas. They can accumulate numerous pollutants from natural waters in quantities that are many orders of magnitude higher than background levels. Bioaccumulation ofcadmium in intertidal species could cause stress which may be measurable at the cellular level. A variety of limpet species that may serve as suitable ecotoxicological monitoring species occur in abundance on rocky shores along the South African coastline. The aim of this study was to obtain sensitivity data which could contribute to the selection of a suitable monitoring species and the eventual establishment of a species sensitivity distribution model (SSD with a biomarker responseas endpoint. The limpets Cymbula oculus, Scutellastra longicosta, Cymbula granatina and Scutellastragranularis as well as water samples were collected at two localities in False Bay, South Africa. Analysis of water and biological samples were done by atomic absorption spectrometry. Exposures were done to three different sublethal concentrations of cadmium in the laboratory in static flow tanks over three days. There was a moderate increase in cadmium body concentrations over time. Results obtained at three exposure concentrations showed no significant differences in metal concentrations between the different C. oculus samples. Significant differences were obtained between the control and the exposure groups for each exposure time except between the control and the 1mg/L CdCl2 exposure group after 24 and 72 hours of exposure. Cd body concentrations(soft tissue varied between 4.56 and 21.41µg/g (wet mass.Mean Cd concentrations in soft tissue of S. longicosta was considerably lower (varying between 1.18 and 19.58 µg/g Cd than in the tissues of C. oculus. The control group differed significantly from the 0.8 and 1 mg/L CdCl2 exposures after 48 and 72 hours. Mean Cd body concentrations in S. granular is were the highest of all exposed species, reaching a level of 148 µg/g Cd at the highest exposure concentration and differed significantly from the means of the other samples of the 0.8 mg/L CdCl2 exposure group after 72 hours and from the 1 mg/L CdCl2 group after 24 hours. Significant differences were also obtained between theCd body concentrations of C. granatina for the three exposure concentrations and three exposure times. Lysosomal membrane integrity was determined for both exposed and control animals, using the neutral red retention assay. Three of the four species showed a significant decrease in retention times with an increase in Cd concentration. Inter-species differences in sensitivity to environmentally relevant cadmium concentrations were reflected in the biomarker responses. Based on reduction of NRR times, the order of relative sensitivity to cadmium was S. granularis >C. oculus> S. longicosta.> C.granatina. 

One hundred years after Pinctada: an update on alien Mollusca in Tunisia

Directory of Open Access Journals (Sweden)

M. ANTIT

2011-04-01

The occurrence of aliens in Tunisia is balanced between presumably Lessepsian species of tropical Indo-Pacific origin, and species from other sources including species from the Tropical Atlantic introduced through shipping. Nevertheless there is a prevalence of Lessepsian species towards the Gulf of Gabes in the south, whereas the shipping activity in Tunis harbour may be the main pathway of introduction in the north.

A new alien snail species from the Eger stream, Hungary (Mollusca, Ampullariidae

Directory of Open Access Journals (Sweden)

Frisóczki, B.

2016-11-01

Full Text Available Our macrozoobenthon samplings carried out in the Eger stream during 2015–2016 resulted in recording an alien species Marisa cornuarietis (Linneaus, 1758 the giant ramshorn snail which has not been reported so far from outdoorwaters in Hungary. Here we report on collecting several specimens from the urban section of the stream close to the outflow of the Eger thermal spa.

Neuromuscular development of Aeolidiella stephanieae Valdéz, 2005 (Mollusca, Gastropoda, Nudibranchia)

DEFF Research Database (Denmark)

Kristof, Alen; Klussmann-Kolb, Annette

2010-01-01

ABSTRACT: BACKGROUND: Studies on the development of the nervous system and the musculature of invertebrates have become more sophisticated and numerous within the last decade and have proven to provide new insights into the evolutionary history of organisms. In order to provide new morphogenetic ...

Geochemical and Crystallographic Study of Turbo Torquatus (Mollusca: Gastropoda) From Southwestern Australia

Science.gov (United States)

Roger, L. M.; George, A. D.; Shaw, J.; Hart, R. D.; Roberts, M. P.; Becker, T.; Evans, N. J.; McDonald, B. J.

2018-01-01

Shells of the marine gastropod Turbo torquatus were sampled from three different locations along the Western Australian coastline, namely Marmion Lagoon (31°S), Rottnest Island (32°S), and Hamelin Bay (34°S). Marmion Lagoon and Rottnest Island have similar sea surface temperature ranges that are ˜1°C warmer than Hamelin Bay, with all sites influenced by the warm southward flowing Leeuwin Current. The shells were characterized using crystallographic, spectroscopic, and geochemical analyses. Shell mineral composition varies between the three sites suggesting the influence of sea surface temperature, oxygen consumption, and/or bedrock composition on shell mineralogy and preferential incorporation and/or elemental discrimination of Mg, P, and S. Furthermore, T. torquatus was found to exert control over the incorporation of most, if not all, the elements measured here, suggesting strong biological regulation. At all levels of testing, the concentrations of Li varied significantly, which indicates that this trace element may not be a suitable environmental proxy. Variation in Sr concentration between sites and between specimens reflects combined environmental and biological controls suggesting that Sr/Ca ratios in T. torquatus cannot be used to estimate sea surface temperature without experimentally accounting for metabolic and growth effects. The mineral composition and microstructure of T. torquatus shells may help identify sea surface temperature variations on geological time scales. These findings support the previously hypothesized involvement of an active selective pathway across the calcifying mantle of T. torquatus for most, if not all, the elements measured here.

The Mediterranean Sea Mollusks - a school shell collection

Science.gov (United States)

Marcu, Delia

2017-04-01

School: 1. "Ana Aslan" Technical College, Street Decebal 1, Cluj-Napoca, Romania 2. Orthodox Theological Seminary, Avram Iancu Square No.18, Cluj-Napoca, Romania The aim of the present project is to develop the students awareness of human activities impact on mollusks population in the Mediterranean Sea. Students have studied about the Geography of the Mediterranean Sea and they have the theoretical knowledge related to the its specific flora and fauna. One of the main fears related to the Mediterranean Sea is the loss of marine and coastal biodiversity due to biological disturbance, climate change and human activities. Out of all reasons, the human impact is considered to be the major cause of habitat loss, degradation and extinction. Regarding the Phylum Mollusca a major threat is represented by unregulated fisheries and shell traffic. In order to enable the students possibility to observe the great diversity of the Phylum Mollusca in the Mediterranean Sea, a school shell collection was made. The shells were brought by the students and they had to mention if the shells were bought, received as a souvenir or picked from their environment. Further, the students learned how to prepare the shells for the collection. The next step involved the shell classification and by this activity the students learned how to use the IUCN: International Union for Conservation of Nature database to identify the threatened species, as well as the World Register of Marine Species (WoRMS) for a correct identification of the species. As Romania romania bordering the Black Sea, the students had the opportunity to identify the mollusks species common for both the Mediterranean Sea and the Black Sea. The objectives of this study were to highlight the human-environment relation and the interconnection between environment conditions and life quality, to develop the students research, exploration and investigation skills, to be able to identify the causes of species extinction and methods

The benthic macroinvertebrate fauna of highland streams in southern Brazil: composition, diversity and structure Fauna de macro-invertebrados bentônicos de rios de montanha no sul do Brasil: composição, diversidade e estrutura

Directory of Open Access Journals (Sweden)

Ludwig Buckup

2007-06-01

Full Text Available Benthic macroinvertebrate in four rivers, three in the Pelotas River basin (Divisa, Marco and Silveira rivers, in the headwaters of the Uruguai River and one in the Taquari-Antas system (Antas River, a tributary in the Guaíba basin, in the state of Rio Grande do Sul, were identified. Two samples were collected in summer, autumn and spring, with one replicate in each river. The total of 28,961 specimens included members of Platyhelminthes, Annelida, Acarina, Insecta, Crustacea and Mollusca. The Silveira and Marco rivers showed significant differences in the indices of Shannon-Weaver (H’, Simpson’s Reciprocal (1/D, Margalef (DMg and Equitability (E. The Silveira River showed the highest means of diversity and the EPT index (Ephemeroptera, Plecoptera, Trichoptera. Comparison among the diversity indices, considered individually, were insufficient to show differences in community structure, for the purpose of ecological characterization of the rivers. The EPT values characterized the Divisa River as having the highest abundance (73%, followed by the Marco (71%, Antas (48% and Silveira (36%. These results suggest that the Silveira River is subject to moderate environmental stress, from human impact, although it showed the highest diversity of the major macrobenthic groups.Os macro-invertebrados bentônicos que ocorrem em quatro rios, três pertencentes à bacia do Rio Pelotas (Rios Divisa, Marco e Silveira nas cabeceiras do Rio Uruguai e um ao sistema Taquari-Antas (Rio Antas, tributário da bacia do Guaíba, no Estado do Rio Grande do Sul, foram identificados. Duas amostras foram coletadas no verão, outono e primavera, com uma réplica em cada rio. Foram coletados 28961 espécimes de macro-invertebrados compreendendo Platyhelminthes, Annelida, Acarina, Insecta, Crustacea e Mollusca. Na comparação entre os rios, Silveira e Marco mostraram diferenças significativas nos índices de Shannon-Weaver (H’, no Recíproco de Simpson (1/D, de

Photophysiological and photosynthetic complex changes during iron starvation in Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

Directory of Open Access Journals (Sweden)

Jared M Fraser

Full Text Available Iron is an essential component in many protein complexes involved in photosynthesis, but environmental iron availability is often low as oxidized forms of iron are insoluble in water. To adjust to low environmental iron levels, cyanobacteria undergo numerous changes to balance their iron budget and mitigate the physiological effects of iron depletion. We investigated changes in key protein abundances and photophysiological parameters in the model cyanobacteria Synechococcus PCC 7942 and Synechocystis PCC 6803 over a 120 hour time course of iron deprivation. The iron stress induced protein (IsiA accumulated to high levels within 48 h of the onset of iron deprivation, reaching a molar ratio of ~42 IsiA : Photosystem I in Synechococcus PCC 7942 and ~12 IsiA : Photosystem I in Synechocystis PCC 6803. Concomitantly the iron-rich complexes Cytochrome b6f and Photosystem I declined in abundance, leading to a decrease in the Photosystem I : Photosystem II ratio. Chlorophyll fluorescence analyses showed a drop in electron transport per Photosystem II in Synechococcus, but not in Synechocystis after iron depletion. We found no evidence that the accumulated IsiA contributes to light capture by Photosystem II complexes.

Nitrogen Starvation Acclimation in Synechococcus elongatus: Redox-Control and the Role of Nitrate Reduction as an Electron Sink

Directory of Open Access Journals (Sweden)

Alexander Klotz

2015-03-01

Full Text Available Nitrogen starvation acclimation in non-diazotrophic cyanobacteria is characterized by a process termed chlorosis, where the light harvesting pigments are degraded and the cells gradually tune down photosynthetic and metabolic activities. The chlorosis response is governed by a complex and poorly understood regulatory network, which converges at the expression of the nblA gene, the triggering factor for phycobiliprotein degradation. This study established a method that allows uncoupling metabolic and redox-signals involved in nitrogen-starvation acclimation. Inhibition of glutamine synthetase (GS by a precise dosage of l-methionine-sulfoximine (MSX mimics the metabolic situation of nitrogen starvation. Addition of nitrate to such MSX-inhibited cells eliminates the associated redox-stress by enabling electron flow towards nitrate/nitrite reduction and thereby, prevents the induction of nblA expression and the associated chlorosis response. This study demonstrates that nitrogen starvation is perceived not only through metabolic signals, but requires a redox signal indicating over-reduction of PSI-reduced electron acceptors. It further establishes a cryptic role of nitrate/nitrite reductases as electron sinks to balance conditions of over-reduction.

Nitrogen Starvation Acclimation in Synechococcus elongatus: Redox-Control and the Role of Nitrate Reduction as an Electron Sink

Science.gov (United States)

Klotz, Alexander; Reinhold, Edgar; Doello, Sofía; Forchhammer, Karl

2015-01-01

Nitrogen starvation acclimation in non-diazotrophic cyanobacteria is characterized by a process termed chlorosis, where the light harvesting pigments are degraded and the cells gradually tune down photosynthetic and metabolic activities. The chlorosis response is governed by a complex and poorly understood regulatory network, which converges at the expression of the nblA gene, the triggering factor for phycobiliprotein degradation. This study established a method that allows uncoupling metabolic and redox-signals involved in nitrogen-starvation acclimation. Inhibition of glutamine synthetase (GS) by a precise dosage of l-methionine-sulfoximine (MSX) mimics the metabolic situation of nitrogen starvation. Addition of nitrate to such MSX-inhibited cells eliminates the associated redox-stress by enabling electron flow towards nitrate/nitrite reduction and thereby, prevents the induction of nblA expression and the associated chlorosis response. This study demonstrates that nitrogen starvation is perceived not only through metabolic signals, but requires a redox signal indicating over-reduction of PSI-reduced electron acceptors. It further establishes a cryptic role of nitrate/nitrite reductases as electron sinks to balance conditions of over-reduction. PMID:25780959

New species of Rissoidae from the Cape Verde Islands (Mollusca: Gastropoda) Part 1

OpenAIRE

Moolenbeek, R.G.; Rolán, E.

1988-01-01

Sediment samples collected at the Cape Verde Islands contained many interesting micromolluscs. Amongst them, four new species of the family Rissoidae ( Alvania peli, A. nicolauensis, A. stocki and A. planciusi).

Studies on the physiology and endocrinology of reproduction of Helisoma duryi (Mollusca: Pulmonata)

Energy Technology Data Exchange (ETDEWEB)

Miksys, S.L.

1987-01-01

Helisoma duryi is a hermaphroditic, freshwater, pulmonate snail native to North America. It has been proposed as a biological control agent against snail intermediate hosts of Schistosoma sp., a parasitic trematode in man. Very little is known of the physiology and endocrinology of reproduction of H. duryi. This thesis investigates vitello-genesis, endocrine control of the synthesis of albumen, a nutrient-rich fluid catabolized by developing embryos, and the possible endocrine role of the gonad. Light and electron microscopy, chemical extraction, energy dispersive X-ray analysis, and radioimmunoassay are used to identify the yolk protein ferritin. It is proposed that ferritin synthesis, and its circulating levels, are regulated, probably indirectly, by a gonadal factor released into the blood. The rate of synthesis of albumen polysaccharides can be monitored in vitro by providing albumen gland explants with the precursor /sup 14/C-glucose and measuring /sup 14/C-polysaccharide produced. The basal synthetic activity of the gland reflects the reproductive activity of the snail.

A new record of marine wood-borer (Mollusca: Teredinidae) from waters off Bombay

Digital Repository Service at National Institute of Oceanography (India)

Raveendran, T.V.; Wagh, A.B.

The occurrence of Teredona princesae (Sivickis) has been reported for the first time from the Exclusive Economic Zone (EEZ) off Bombay. A brief description of the pallet and distribution of this species is presented...

A biomechanical model of rock drilling in the piddock Barnea candida (Bivalvia; Mollusca)

NARCIS (Netherlands)

Nederlof, R.; Muller, M.

2012-01-01

The bivalve Barnea candida (Pholadacea) makes its burrow in clay, soft rock and peat. Barnea has developed a number of adaptations to accommodate this lifestyle. Four muscles enable burrowing. These are situated around a dorsal pivot in such a way that the piddock is able to rotate the shells around

Systematic reviews on the Mesodesmatidae (Mollusca, Bivalvia) I. The Genus Monterosatus Beu, 1971

NARCIS (Netherlands)

Rooij-Schuiling, de L.A.

1977-01-01

In trying to identify a small Mesodesma from West Irian, New Guinea, much material in the collections of several museums was studied. As a guide for the identification I at first used the revision of the Mesodesmatidae by Lamy (1914), which is based exclusively on the collections of the Parisian

Histofisiología del epitelio renal de helix aspersa (mollusca, gastropoda, pulmonata, stylommatophora)

OpenAIRE

Sánchez Aguayo, Inmaculada

1983-01-01

La excreción es, por definición, la separación de los productos de desecho de los fluidos tisulares y corporales, y su eliminación del organismo. Además, se considera como el resultado de la filtración del líquido de la sangre, de la reabsorción de ciertos compuestos y de la secreción de sustancias en el interior de túbulos excretores. Los productos de desecho son el resultado del metabolismo celular. Aunque en general son productos finales de procesos catabólicos, también pueden incluir ...

The genus Alvania on the Canary Islands and Madeira (Mollusca: Gastropoda) Part 1

NARCIS (Netherlands)

Moolenbeek, R.G.; Hoenselaar, H.J.

1989-01-01

Micromolluscs of the family Rissoidae and belonging to the genus Alvania s.l. from the Canary Islands and the Madeira archipelago are revised. For several species the type locality is restricted and lectotypes are designated for Rissoa canadensis d’Orbigny, 1839, R. euchila Watson, 1886, R.

Phylogenetic Diversity of Cephalopoda (Animalia:Mollusca) Along the Saudi Arabian Red Sea Coastline

KAUST Repository

Byron, Gordon

2016-01-01

ecosystems, serving as part of the food chain and exhibiting population increases due to targeted teleost fisheries and global climate change. In order to assess the biodiversity of Cephalopoda in the Saudi Arabian Red Sea, 87 specimens were collected from 25

The shallow-water chitons (Mollusca, Polyplacophora of Caldera, Region of Atacama, northern Chile

Directory of Open Access Journals (Sweden)

Juan Francisco Araya

2015-03-01

Full Text Available The Molluscan species of the northern littoral of Chile have been sparsely studied. This work reviews for the first time the diversity of polyplacophoran molluscs around the port of Caldera, in the Region of Atacama (26°45’49”S; 70°45’17”W to 27°20’23”S; 70°56’46”W, northern Chile. Eleven species were found in this study: Acanthopleura echinata (Barnes, 1824; Callistochiton pulchellus (Gray, 1828; Calloplax vivipara (Plate, 1899, Chaetopleura peruviana (Lamarck, 1819; Chiton cumingsii Frembly, 1827; Chiton granosus Frembly, 1827; Chiton magnificus Deshayes, 1827; Enoplochiton niger (Barnes, 1824, Radsia barnesii (Gray, 1828, Tonicia atrata (G. B. Sowerby II, 1840 and Tonicia chilensis (Frembly, 1827. All of the species occurring in the area have distributions in the southeastern Pacific Ocean, from Ecuador to central Chile, and three of them are species endemic to the Chilean coasts (Calloplax vivipara, Radsia barnesii, and Tonicia atrata. This diversity of species is comparable to that of better surveyed faunas of central and southern Chile or Patagonia. Of the eleven species recorded, the geographic distribution records for Callistochiton pulchellus, Radsia barnesii and Tonicia atrata are extended, and Calloplax vivipara is found alive again after 40 years, filling a gap in its known distribution. Illustrations of living specimens in their habitat, distribution records and a taxonomic key for all the studied taxa are also provided.

The Bulimulidae (Mollusca: Pulmonata) from the Región de Atacama, northern Chile.

Science.gov (United States)

Araya, Juan Francisco

2015-01-01

The bulimulid genus Bostryx Troschel, 1847 is the most species-rich genus of land snails found in Chile, with the majority of its species found only in the northern part of the country, usually in arid coastal zones. This genus has been sparsely studied in Chile and there is little information on their distribution, diversity or ecology. Here, for the first time, a formal analysis of the diversity of bulimulids in the Región de Atacama, northern Chile, is reported. Of the seventeen species recorded for the area, most of them were efectively found in the field collections and one record was based on literature. Five taxa are described as new: Bostryx ancavilorum sp. nov., Bostryx breurei sp. nov., Bostryx calderaensis sp. nov., Bostryx ireneae sp. nov. and Bostryx valdovinosi sp. nov., and the known geographic distribution of seven species is extended. Results reveal that the Región de Atacama is the richest region in terrestrial snails in Chile, after the Juan Fernández Archipelago. All of the terrestrial molluscan species occurring in the area are endemic to Chile, most of them with restricted geographic distributions along the coastal zones, and none of them are currently protected by law. Further sampling in northern Chile will probably reveal more snail species to be discovered and described.

The complete mitochondrial genome of the giant African snail Achatina fulica (Mollusca: Achatinidae).

Science.gov (United States)

Yang, Huirong; Zhang, Jia-En; Guo, Jing; Deng, Zhixin; Luo, Hao; Luo, Mingzhu; Zhao, Benliang

2016-05-01

We present the complete mitochondrial genome of the Achatina fulica in this study. The results show that the mitochondrial genome is 15,057 bp in length, which is comprised of 13 protein-coding genes, 2 rRNA genes, 21 tRNA genes. The nucleotide compositions of the light strand are 35.47% of A, 27.97% of T 19.46% of C, and 17.10% of G. Except the ND3, 7 tRNA, ATP6, ATP8, COX3 and 12S-rRNA on the light strand, the rest are encoded on the heavy strand. Five types of inferred initiation codons are ATA (ND1, ND5), GTG (ND6), ATG (COX3, COX2), ATT (ND4) and TTG (COX1, ND2, ND3, ND4L, ATP6, ATP8, Cytb), and 3 types of inferred termination codons are T (COX3, ND2), TAA (ND1, ND4L, ND5, ND6, ATP6), and TAG (ND3, ND4, COX1, COX2, Cytb, ATP8). There are 24 intergenic spacers and 6 gene overlaps. The tandem repeat sequence (total 52 bp) of (AATAATT)n is observed in 16S-rRNA. Gene arrangement and distribution are inconsistent with the typical vertebrates.

Phylogenetic Diversity of Cephalopoda (Animalia:Mollusca) Along the Saudi Arabian Red Sea Coastline

KAUST Repository

Byron, Gordon

2016-12-01

Although the Red Sea presents a unique environment with high temperature and salinity, it remains an area that is understudied. This lack of information is reflected in many areas, one which is biodiversity. Despite increasing work on biodiversity throughout the Red Sea and an increase in Cephalopoda studies, Cephalopoda in the Red Sea remain underrepresented, which is especially pronounced in molecular analyses. Members of the class Cephalopoda are considered to be major contributors to coral reef ecosystems, serving as part of the food chain and exhibiting population increases due to targeted teleost fisheries and global climate change. In order to assess the biodiversity of Cephalopoda in the Saudi Arabian Red Sea, 87 specimens were collected from 25 reef locations between 17°N and 28°N latitude, as well as from the largest fish market in the Kingdom of Saudi Arabia. Taxonomic identification of specimens was determined using morphological comparisons with previously reported species in the Red Sea and the molecular barcoding region Cytochrome Oxidase I. 84 Red Sea sequences were compared with sequences from GenBank and analyzed using a complement of Neighbor-Joining, Maximum-Likelihood, and Bayesian inference trees. Species complexes were also investigated for Sepia pharaonis and Sepioteuthis lessoniana, which had been previously reported. From 17 cuttlefish, our study yielded three species, two of which matched previously reported species in GenBank. In addition, two distinct clades of Sepia pharaonis were identified. Of 35 squid collected, four species were identified, one of which did not match any other accepted species in literature, while Sepioteuthis lessoniana in the Red Sea formed a distinct clade. From 30 different specimens a total of five genera of Octopoda were present, forming six distinct species. Five Octopoda species collected did not match previously reported species, although many specimens were paralarvae or juveniles, so morphologically we could not compare to previously described species in the Red Sea. Cephalopoda fisheries in the Red Sea is low, and as their populations increase worldwide, this could be a viable fishery for Saudi Arabia. As such, further investigation into the role which cephalopods play in supporting biodiversity in the Red Sea is essential.

Fine structure of the mineralized teeth of the chiton Acanthopleura echinata (Mollusca: Polyplacophora).

Science.gov (United States)

Wealthall, Rosamund J; Brooker, Lesley R; Macey, David J; Griffin, Brendan J

2005-08-01

The major lateral teeth of the chiton Acanthopleura echinata are composite structures composed of three distinct mineral zones: a posterior layer of magnetite; a thin band of lepidocrocite just anterior to this; and apatite throughout the core and anterior regions of the cusp. Biomineralization in these teeth is a matrix-mediated process, in which the minerals are deposited around fibers, with the different biominerals described as occupying architecturally discrete compartments. In this study, a range of scanning electron microscopes was utilized to undertake a detailed in situ investigation of the fine structure of the major lateral teeth. The arrangement of the organic and biomineral components of the tooth is similar throughout the three zones, having no discrete borders between them, and with crystallites of each mineral phase extending into the adjacent mineral zone. Along the posterior surface of the tooth, the organic fibers are arranged in a series of fine parallel lines, but just within the periphery their appearance takes on a "fish scale"-like pattern, reflective of the cross section of a series of units that are overlaid, and offset from each other, in adjacent rows. The units are approximately 2 microm wide and 0.6 microm thick and comprise biomineral plates separated by organic fibers. Two types of subunits make up each "fish scale": one is elongate and curved and forms a trough, in which the other, rod-like unit, is nestled. Adjacent rod and trough units are aligned into large sheets that define the fracture plane of the tooth. The alignment of the plates of rod-trough units is complex and exhibits extreme spatial variation within the tooth cusp. Close to the posterior surface the plates are essentially horizontal and lie in a lateromedial plane, while anteriorly they are almost vertical and lie in the posteroanterior plane. An understanding of the fine structure of the mineralized teeth of chitons, and of the relationship between the organic and mineral components, provides a new insight into biomineralization mechanisms and controls. Copyright 2005 Wiley-Liss, Inc.

Melanoides tuberculata (Mollusca: Thiaridae as an intermediate host of Centrocestus formosanus (Trematoda: Heterophyidae in Brazil Melanoides tuberculata (Mollusca: Thiaridae como hospedeiro intermediário de Centrocestus formosanus (Trematoda: Heterophyidae no Brasil

Directory of Open Access Journals (Sweden)

Hudson Alves Pinto

2010-08-01

Full Text Available Pleurolophocercous cercariae emerged from naturally infected Melanoides tuberculata from Minas Gerais State, Brazil, were used to perform experimental infection of laboratory-reared Poecilia reticulata. Mature metacercariae were obtained from the gills of fishes and force-fed to Mus musculus. The adult parasites which recovered from small intestines of mice were identified as Centrocestus formosanus. This is the first report of M. tuberculata as intermediate host of this heterophyid in Brazil.Cercárias do tipo pleurolofocerca emergidas de Melanoides tuberculata naturalmente infectados coletados na represa da Pampulha, Belo Horizonte, Minas Gerais, Brasil, foram utilizadas para a infecção experimental de Poecilia reticulata criados em laboratório. Metacercárias maduras foram obtidas nas brânquias dos peixes e administradas por via oral a Mus musculus. Parasitos adultos recuperados no intestino delgado dos camundongos foram identificados como Centrocestus formosanus. Este é o primeiro relato de M. tuberculata como hospedeiro intermediário deste parasito no Brasil.

Algumas observações de campo sobre biologia e ecologia de Pomacea haustrum (Reeve, 1856 (Mollusca, Pilidae Some field observation on biology and ecology of Pomacea haustrum (Reeve, 1856 (Mollusca, Pilidae

Directory of Open Access Journals (Sweden)

Carlos Tito Guimarães

1981-12-01

Full Text Available Algumas observações de campo sobre o pilídeo Pomacea haustrum (Reeve, 1856, predador-competidor de planorbíneos hospedeiros intermediários da esquistossomose mansoni mostraram que: Cópula e oviposição são realizadas, preferencialmente, à noite e de madrugada. As desovas - cujas dimensões e formas dependem do número de ovos e tipos dos suportes - sao ovipostas, na maioria das vezes, de 6 a 10 cm acima do nível da água eclodindo após 9 a 30 dias de incubação; o número médio de ovos por desova foi de 236. A alimentação habitual deste molusco consiste de algas confervóides, além de vegetais aquáticos natantes e submersos; entretanto, e comum a utilização de outros materiais como alimento.Tem como habitat a zona marginal mais rasa das coleções hídricas onde e encontrado, predominando, aparentemente, nos ambientes lênticos. A distribuição espacial esta condicionada por determinadas características dos biótopos. Algumas aves aquáticas - anatídeos, ralídeos, etc.- revelaram-se importantes inimigos naturais, atacando além das desovas exemplares jovens e adultos; em determinadas condições podem constituir fator impeditivo da implantação e colonização de novos biótopos.Some field observations on the pilid Pomacea haustrum (Reeve, 1856, predator-competitor of schistosomiasis mansoni planorbid intermediate hosts have shown that: Copula and oviposition are preferably carried out at night or at dawn. Eggmasses - whose dimension and shape depend on the number of eggs and types of supports - are often laid from 6 to 10 com above the water level and hatched 9 to 30 days after incubation; the average number of eggs/egg-mass was 236. Habitual food consist of confervoid algae, besides natant and submerged aquatic vegetation; it is common, however, the utilization of the other material as food. Its habitat is the shallower marginal zone of hidric collections, predominatly in lentic surrounding. Its spacial distribution is conditioned to the biotipe special characteristics. Some aquatic birds - anatid, ralid, etc. - reveal important natural enemies, attacking both young and adult specimens, besides the egg-masses; under certain conditions they may be an impedictive factor to the establishment and colonization of this pilid in new biotopes.

Fluorescent minerals--A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments.

Science.gov (United States)

Omairi, Tareq; Wainwright, Milton

2015-07-01

We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.

Analysis of Selected Environmental Indicators in the Cultivation System of Energy Crops

Directory of Open Access Journals (Sweden)

Šoltysová Božena Š

2017-11-01

Full Text Available The changes of selected chemical parameters were observed in Gleyic Fluvisols. The field experiment was established as a twofactor experiment with four energy crops (Arundo donax L., Miscanthus × giganteus, Elymus elongatus Gaertner, Sida hermafrodita and two variants of fertilization (nitrogen fertilization in rate 60 kg ha-1, without nitrogen fertilization. Soil samples were taken from the depth of 0 to 0.3 m at the beginning of the experiment in the autumn 2012 and at the end of reference period in the autumn 2015. Land management conversion from market crops to perennial energy crops cultivation has influenced changes of selected soil chemical parameters. The contents of soil organic carbon were affected by cultivated energy crops differently. It was found out that Arundo increased the organic carbon content and Miscanthus, Elymus and Sida decreased its content. At the same time, the same impact of the crops on content of available phosphorus and potassium and soil reaction was found. It was recorded that each cultivated crop decreased the soil reaction and available phosphorus content and increased the content of available potassium.

Structural insights into the light-driven auto-assembly process of the water-oxidizing Mn4CaO5-cluster in photosystem II.

Science.gov (United States)

Zhang, Miao; Bommer, Martin; Chatterjee, Ruchira; Hussein, Rana; Yano, Junko; Dau, Holger; Kern, Jan; Dobbek, Holger; Zouni, Athina

2017-07-18

In plants, algae and cyanobacteria, Photosystem II (PSII) catalyzes the light-driven splitting of water at a protein-bound Mn 4 CaO 5 -cluster, the water-oxidizing complex (WOC). In the photosynthetic organisms, the light-driven formation of the WOC from dissolved metal ions is a key process because it is essential in both initial activation and continuous repair of PSII. Structural information is required for understanding of this chaperone-free metal-cluster assembly. For the first time, we obtained a structure of PSII from Thermosynechococcus elongatus without the Mn 4 CaO 5 -cluster. Surprisingly, cluster-removal leaves the positions of all coordinating amino acid residues and most nearby water molecules largely unaffected, resulting in a pre-organized ligand shell for kinetically competent and error-free photo-assembly of the Mn 4 CaO 5 -cluster. First experiments initiating (i) partial disassembly and (ii) partial re-assembly after complete depletion of the Mn 4 CaO 5 -cluster agree with a specific bi-manganese cluster, likely a di-µ-oxo bridged pair of Mn(III) ions, as an assembly intermediate.

Nematodes (Mermithidae parasitizing grasshoppers (Orthoptera: Acrididae in the Pampean region, Argentina

Directory of Open Access Journals (Sweden)

J. M. Rusconi

Full Text Available Abstract This work provides the results of a survey of entomonematodes parasites of grasshoppers in grasslands of the Pampean Region, Argentina. Nymphs of Staurorhectus longicornis Giglio-Tos, Laplatacris dispar Rhen, 1939, Dichroplus elongatus Giglio-Tos, 1894 and Metaleptea brevicornis (L. (Orthoptera: Acrididae were collected. Mermithidae was the only family registered with seven species: Agamermis decaudata Cobb, Steiner and Christie, 1923, Amphimermis bonaerensis Miralles and Camino, 1983, Amphimermis dichroplusi Camino and Lange, 1997, Amphimermis ronderosi Camino and Lange, 1997, Hexamermis coclhearius Stock and Camino, 1992, Hexamermis ovistriata Stock and Camino, 1992, and Longimermis acridophila Camino and Stock, 1989. The values of parasitism ranged between 1-12%, and intensity not overcome the number of 5.0 nematodes per larva. The nematodes observed showed specificity, not registering the same species of parasite in more than one host species. The Pampean region constituted an area with high diversity of mermithids where new species could be consider as bioregulator agents of this troublesome insect pests in agricultural areas of Argentina.

Defining an additivity framework for mixture research in inducible whole-cell biosensors

DEFF Research Database (Denmark)

Martin-Betancor, K; Ritz, Christian; Fernández-Piñas, F

2015-01-01

A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts for differe......A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts...... for differential maximal effects among analytes and response inhibition beyond the maximum permissive concentrations. This allows a multivariate extension of Loewe additivity, enabling direct application in a biphasic dose-response framework. The proposed additivity definition was validated, and its applicability...... illustrated by studying the response of the cyanobacterial biosensor Synechococcus elongatus PCC 7942 pBG2120 to binary mixtures of Zn, Cu, Cd, Ag, Co and Hg. The novel method allowed by the first time to model complete dose-response profiles of an inducible whole cell biosensor to mixtures. In addition...

Spring diet and feeding strategy of the European sprat Sprattus sprattus (L., 1758 from the Black Sea coast of Turkey

Directory of Open Access Journals (Sweden)

Bahar Bayhan

2015-09-01

Full Text Available This study aims to identify the spring diet composition and feeding strategy of the European sprat, Sprattus sprattus. Diet composition of European sprat was investigated for the first time in the central Black Sea coast of Turkey. Examined of the 115 specimens (6 - 9.1 cm total length of stomach, 12 (10.4% had emty. Diet analysis was described based on gravimetric percentages (W%, frequency of abundance (N%, frequency of occurrence (%F and relative importance index (IRI%. Feeding strategy was analyzed and graphically (Costello represented, considering the frequency of abundance (N% and frequency of occurrence (%F indexes and grouping prey into higher taxonomic categories. Twenty species were identified, belonging to four prey groups: Polychaeta, Crustacea, Mollusca and Chaetognatha. Finally copepods proved to be the most important food item considering the above-cited indexes. All other prey taxa were identified as accidental preys. At least seven copepod species were identified, where Calanus euxinus appeared all round with %IRI≥50. Also results of feeding strategy analyses revealed a trophic specialization toward a single prey.

Role and convergent evolution of competing RNA secondary structures in mutually exclusive splicing.

Science.gov (United States)

Yue, Yuan; Hou, Shouqing; Wang, Xiu; Zhan, Leilei; Cao, Guozheng; Li, Guoli; Shi, Yang; Zhang, Peng; Hong, Weiling; Lin, Hao; Liu, Baoping; Shi, Feng; Yang, Yun; Jin, Yongfeng

2017-10-03

Exon or cassette duplication is an important means of expanding protein and functional diversity through mutually exclusive splicing. However, the mechanistic basis of this process in non-arthropod species remains poorly understood. Here, we demonstrate that MRP1 genes underwent tandem exon duplication in Nematoda, Platyhelminthes, Annelida, Mollusca, Arthropoda, Echinodermata, and early-diverging Chordata but not in late-diverging vertebrates. Interestingly, these events were of independent origin in different phyla, suggesting convergent evolution of alternative splicing. Furthermore, we showed that multiple sets of clade-conserved RNA pairings evolved to guide species-specific mutually exclusive splicing in Arthropoda. Importantly, we also identified a similar structural code in MRP exon clusters of the annelid, Capitella teleta, and chordate, Branchiostoma belcheri, suggesting an evolutionarily conserved competing pairing-guided mechanism in bilaterians. Taken together, these data reveal the molecular determinants and RNA pairing-guided evolution of species-specific mutually exclusive splicing spanning more than 600 million years of bilaterian evolution. These findings have a significant impact on our understanding of the evolution of and mechanism underpinning isoform diversity and complex gene structure.

Fouling assemblage of benthic plastic debris collected from Mersin Bay, NE Levantine coast of Turkey.

Science.gov (United States)

Gündoğdu, Sedat; Çevik, Cem; Karaca, Serkan

2017-11-15

The Mediterranean is an ecosystem that faces more and more microplastic pollution every day. This causes the whole of the Mediterranean to face the negative effects of plastic pollution. This study examines the state of plastic debris and fouling organisms found on it in one of the areas most affected by plastic pollution, Mersin Bay. As a result, a total of 3.88kg plastic (mean=0,97kg; n=120; 2670item/km 2 ; 86,3kg/km 2 ) was collected and based on the ATR-FTIR analysis, it was determined that this total contained 9 types of plastics. 17 different fouling species belonging to 6 phylum (Annelida, Arthropoda, Bryozoa, Chordata, Cnidaria, Mollusca) 7 class and 11 order were discovered on plastics. Spirobranchus triqueter, Hydroides sp. and Neopycnodonte cochlear were the most abundant species. In the end, the example of Mersin Bay shows that plastic debris as a substrate can contain a very high diversity of life just like natural substrates. Copyright © 2017 Elsevier Ltd. All rights reserved.

The Sponge Zygomycale parishii(Bowerbank) and its Endobiotic Fauna

Science.gov (United States)

Duarte, Luiz; Nalesso, Rosebel

1996-02-01

The endobiotic fauna of the sponge Zygomycale parishii(Bowerbank) was studied for 2·5 years at two sites, Ubatuba and São Sebastião, on the northern coast of the State of São Paulo, Brazil. Ninety-two macrofaunal species (over 1 mm long) were identified among which Cnidaria, Turbellaria, Nemertinea, Sipuncula, Polychaeta, Mollusca, Crustacea, Pycnogonida, Echinodermata, Ascidiacea and Pisces were represented. The results obtained on the number of species (species richness), the abundances of different species and faunal composition were related to the physico-biotic characteristics of the study sites. The influence of sample volume and other methodological artifacts on sample characteristics were also examined. The ophiuroid Ophiactis savignyi(Müller & Troschell) was the dominant endobiotic species, comprising 64% of all individuals collected. The São Sebastião endobiotic fauna was more diversified than the Ubatuba endobiotic fauna, possibly due to higher larval recruitment, and to the closeness of Z. parishiito the sea-floor providing a greater possibility for inhabitants of this microhabitat to find and to live inside the sponge.

ELNAIS meets EASIN: distribution of marine alien species in Greece using EASIN mapping services and ELNAIS spatial data

Directory of Open Access Journals (Sweden)

S. KATSANEVAKIS

2013-03-01

Full Text Available The European Alien Species Information Network (EASIN was created with the aim to provide easy access to accurate information on alien species in Europe. EASIN allows the retrieval of spatial information from existing online data providers in order to produce integrated georeferenced distribution maps of alien species in Europe. In November 2012, a new data provider, the Ellenic Network on Aquatic Invasive Species (ELNAIS, joined EASIN; this has significantly increased the available georeferenced information on marine/estuarine alien species in Greek waters. Here, we use maps created by EASIN to show differences in patterns of distribution in Greece for the most abundant Phyla of marine alien species - Mollusca, Arthropoda, Chordata and Annelida. We also show that the two main pathways of introduction of marine alien species (Lessepsian migration and Shipping are related to different patterns of species spatial distribution in Greece. Overall, the tools provided by EASIN can greatly aid scientists and policy makers in obtaining high quality information on marine alien species in Greece, especially after the association with ELNAIS.

Feeding pattern and use of reproductive habitat of the Striped toad Rhinella crucifer (Anura: Bufonidae from Southeastern Brazil

Directory of Open Access Journals (Sweden)

Rodrigo B. Ferreira

2009-12-01

Full Text Available Diet composition, foraging mode, and using of reproductive habitat of Rhinella crucifer was studied in an artificial pond in Espírito Santo, Brazil. The favored substrate was leaf litter, followed by Cyperaceae/Poaceae. Calling sites, preferred for 23.3 % (n = 7 of the observed toads, were within the water, with only the head not submerged. We analyzed a total of 61 specimens, mainly males (98.5% male and 1.5% female. Seven categories of prey were found in the stomach contents: Coleoptera, Hymenoptera (Formicidae, Isoptera, Lepidoptera, Orthoptera, Gastropoda (Mollusca, Opilionida (Arachnida. Our studies indicate that the diet of Rhinella crucifer consists mainly of terrestrial colonial arthropods. Formicidae was the predominant food item in frequency of occurrence, number of prey and weight. Isoptera and Coleoptera were also relevant in terms of weight. Neither large ontogenetic dietary nor seasonal shifts were observed in the population studied. Our results suggest that no intraspecific food resource partitioning occurs in adult or juveniles. Rhinella crucifer adults avoid competition inhabiting different home range habitats and seem to be ant-specialist with a wide foraging mode.

Keanekaragaman makrofauna tanah pada lahan tanaman padi dengan sistem rotasi dan monokultur di Desa Banyudono, Boyolali

Directory of Open Access Journals (Sweden)

AYU OKTARIANA VIDYA

2014-05-01

Full Text Available Vidya AO, Sugiyarto, Sunarto. 2013. Diversity of soil macrofauna on the ricefield with rorarion and monoculture systems in Banyudono Village, Boyolali. Bioteknologi 11: 19-22. Makrofauna tanah berperan penting dalam menjaga kesuburan tanah persawahan. Perbedaan sistem pengelolaan lahan mempengaruhi populasi dan komposisi makrofauna tanah. Penelitian ini bertujuan untuk mengetahui indeks keanekaragaman makrofauna tanah pada lahan tanaman padi dengan sistem rotasi dan monokultur di Desa Banyudono Boyolali, Jawa Tengah. Koleksi makrofauna dalam tanah dilakukan dengan metode hand sorting. Lokasi sampling ditentukan dengan metode purposive sampling, yang masing-masing stasiun terdapat 5 titik sampling. Indeks dinyatakan dengan indeks keanekaragaman Simpson. Perbandingan studi komunitas antar penggunaan lahan dinyatakan dengan Indeks Similaritas Sorensen. Hubungan antara keanekaragaman makrofauna tanah dengan faktor lingkungan abiotik dianalisis dengan korelasi Pearson. Berdasarkan penelitian ini ditemukan 3 phylum yaitu annelida, arthopoda dan mollusca. Indeks keanekaragaman makrofauna dalam tanah tertinggi adalah pada lahan tanaman padi monokultur umur 80 hari (0,66. Berdasarkan hasil korelasi pearson menunjukkan bahwa indeks keanekaragaman makrofauna dalam tanah berhubungan kuat dengan suhu tanah (-0,732.

Afinidad Limnológica del Sistema Lagunar Costero del estado de Guerrero, México

Directory of Open Access Journals (Sweden)

Manuel Guzmán Arroyo

1986-01-01

Full Text Available The coastal lagoons are system in which many factors interact in complex w ys. The objective of this study is to establish a caracterization of the Guerrero coas­tal lagoons in four variable groups: 1 Morphometrics; among others, area, total volume, perimeter, relative depth, middle depth, max, depth and development of the coastal line and volume among other variables. 2 Hidroclimate: rainfall, mean environmental temperature, weather, basin area and fluvial discharge. 3 Physico–Chemical: salinity, temperature and dissolved oxigen. 4 Biological: presence of pisces, crustacea and mollusca. To establish any relationship between the lagoon for each variable group, the data were processes by means of a multivariate analysis (Cluster. The first variable group showed two affinity blocks; Mitla and Tres Palos on the first and Potosi, Nuxco and Coyuca on the other. Chautengo displays a low affinity arrangement with Mitla, Tres Palos on one block and Potosi, Nuxco, Salinas de Apozahualco and Chautengo on the other. This type of analysis permit regionalized the lagoons of the Coastal Plain of Guerrero for a better understanding and classification.

A First Insight into the Genome of the Filter-Feeder Mussel Mytilus galloprovincialis.

Directory of Open Access Journals (Sweden)

Maria Murgarella

Full Text Available Mussels belong to the phylum Mollusca, one of the largest and most diverse taxa in the animal kingdom. Despite their importance in aquaculture and in biology in general, genomic resources from mussels are still scarce. To broaden and increase the genomic knowledge in this family, we carried out a whole-genome sequencing study of the cosmopolitan Mediterranean mussel (Mytilus galloprovincialis. We sequenced its genome (32X depth of coverage on the Illumina platform using three pair-end libraries with different insert sizes. The large number of contigs obtained pointed out a highly complex genome of 1.6 Gb where repeated elements seem to be widespread (~30% of the genome, a feature that is also shared with other marine molluscs. Notwithstanding the limitations of our genome sequencing, we were able to reconstruct two mitochondrial genomes and predict 10,891 putative genes. A comparative analysis with other molluscs revealed a gene enrichment of gene ontology categories related to multixenobiotic resistance, glutamate biosynthetic process, and the maintenance of ciliary structures.

Medicinal benefits of marine invertebrates: sources for discovering natural drug candidates.

Science.gov (United States)

De Zoysa, Mahanama

2012-01-01

Marine invertebrates are one of the major groups of organisms, which could be diversified under the major taxonomic groups of Porifera, Cnidaria, Mollusca, Arthropoda, Echinodermata, and many other minor phyla. To date, range of medicinal benefits and a significant number of marine natural products (MNPs) have been discovered from marine invertebrates. Seafood diet from edible marine invertebrates such as mollusks and crustaceans has been linked with various medicinal benefits to improve human health. Among marine invertebrates, spongers from phylum Porifera is the most dominant group responsible for discovering large number of MNPs, which have been used as template to develop therapeutic drugs. MNPs isolated from invertebrates have shown wide range of therapeutic properties including antimicrobial, antioxidant, antihypertensive, anticoagulant, anticancer, anti-inflammatory, wound healing and immune modulator, and other medicinal effects. Therefore, marine invertebrates are rich sources of chemical diversity and health benefits for developing drug candidates, cosmetics, nutritional supplements, and molecular probes that can be supported to increase the healthy life span of human. Copyright © 2012 Elsevier Inc. All rights reserved.

Macroinvertebrate communities associated with littoral zone habitats and the influence of environmental factors in Malilangwe Reservoir, Zimbabwe

Directory of Open Access Journals (Sweden)

Dalu T.

2012-10-01

Full Text Available The aim of our study was to investigate macroinvertebrate communities so as to understand factors and processes structuring macroinvertebrate communities in a small reservoir, Malilangwe reservoir over seven months (April to October. Sampling was performed by active sweep netting and searching soil sediments. Water temperature, conductivity, dissolved oxygen, pH, ammonia, nitrogen, phosphorus, chemical oxygen demand and macrophyte cover were determined. In total, forty-two macroinvertebrate families belonging to 10 orders were identified amongst 13 macrophyte species and sediments. Thiaridae and Physidae (Mollusca were the dominant and most abundant taxa (57.71% and there were followed by the Hemiptera (27.31%. High indices for sites 1 to 3 for the Simpsons index, the Shannon-Weaver index and evenness were recorded, while low indices were observed for sites 4 to 5, with significant differences being observed among the study site using the Kruskal-Wallis ANOVA test (p < 0.05. Redundancy Analysis revealed that among environmental factors, hydrologically linked parameters such as conductivity, water level and macrophyte cover had the strongest influence on macroinvertebrate distribution.

Os gêneros Fasciolaria Lamarck, 1799 e Leucozonia Gray, 1847 no nordeste brasileiro (Mollusca: Gastropoda: Fasciolariidae The genera Fasciolaria Lamarck, 1799 and Leucozonia Gray, 1847 in the northeastern Brazil (Mollusca: Gastropoda: Fasciolariidae

Directory of Open Access Journals (Sweden)

Helena Matthews-Cascon

1989-01-01

Full Text Available The genera Fasciolaria Lamarck, 1799 and Leucozonia Gray, 1847 are represented in Northeastern Brazil by three species. Fasciolaria aurantiaca Lamarck, 1816; Leucozonia ocellata (Gmelin, 1791 and Leucozonia nassa (Gmelin, 1791. The three species are described and illustrated. An identification key for all the above mentioned taxa is included, together with some ecological data. The anatomy and radula of Fasciolaria aurantiaca and Leucozonia nassa are described and illustrated. Polimorfism in Fasciolaria aurantiaca and Leucozonia nassa is discussed.

A new species of Temnocephala (Platyhelminthes, Temnocephalida commensal of Pomella megastoma (Mollusca, Ampullariidae from Misiones, Argentina Una especie nueva de Temnocephala (Platyhelminthes, Temnocephalida comensal de Pomella megastoma (Mollusca, Ampullariidae de Misiones, Argentina

Directory of Open Access Journals (Sweden)

Cristina Damborenea

2008-08-01

Full Text Available Temnocephala lamothei n. sp., a commensal of Pomella megastoma (Sowerby, 1825, is described herein from specimens collected at Arroyo Yabotí-Miní (Misiones province, Argentina. Juveniles and adults were removed from the mantle cavity by host relaxation. Distinctive characters of the new species are: non-partitioned intestine; conical cirrus with 1 face flat and another concave; distal area with spines, as evidenced by a strong, oblique sclerotized ring, and 2 rows of long spines, an internal one with long spines arising from base of introvert and an external one arising from distal end of the introvert. The closest species are T. iheringi, T. rochensis and T. haswelli, which are also commensals of mollusc species. The presence of this new species of Temnocephala, and its similarity to the other species that are commensals of molluscan species, suggest the existence of a morphologically homogeneous group.Temnocephala lamothei n. sp., comensal de Pomella megastoma (Sowerby, 1825, se describe para el arroyo Yabotí-Miní, provincia de Misiones, Argentina. Se extrajeron ejemplares juveniles y adultos de la cavidad paleal, por relajación de los hospederos. Las características distintivas de la nueva especie son: intestino no septado, cirro de forma cónica, con una cara plana y otra cóncava, zona distal con espinas evidente por un fuerte anillo oblicuo esclerosado. Dos hileras de espinas se reconocen en el extremo distal, 1 interna de espinas largas, que surge desde la base del introverso, y 1 externa, que surge del extremo distal del mismo. Las especies más semejantes son T. iheringi, T. rochensis y T. haswelli, especies comensales de moluscos con las que es comparada. El hallazgo de esta nueva especie de Temnocephala y sus características semejantes a las restantes especies del género comensales de moluscos, sugieren que las especies conocidas hasta la fecha formen un grupo morfológicamente homogéneo.

Larval fish distribution and their relationship with environmental factors in the southern Tyrrhenian Sea (central Mediterranean during two years of sampling

Directory of Open Access Journals (Sweden)

Adriana Profeta

2014-06-01

The results of this study could have implications for the management of marine resources, because the investigated area has already been identified as a nursery area for many pelagic and coastal fishes and a natural habitat for many species of high commercial interest. Fig. 1. Results of CCA analysis for larval fish species and sampled stations during June 2006. Two first axes (CCA1 and CCA2 are represented. Species abbreviations in alphabetical order: An_a (Anthias anthias, Ap_i (Apogon imberbis, Ar_k (Arnoglossus kessleri, Ar_h (Argyropelecus hemigymnus, Ar_l (Arnoglossus laterna, Ar_r (Arnoglossus rueppelii, Ar_t (Arnoglossus thori, Be_g (Benthosema glaciale, Bl_o (Blennius ocellaris, Bo_b (Boops boops, Bo_p (Bothus podas, Ca_a (Capros aper, Ca_p (Callyonimus maculatus, Ce_m (Ceratoscopelus maderensis, Ce_m1(Cepola macrophtalma, Ci_l (Citharus linguatula, Co_j (Coris julis, Co_n (Ophidion barbatum, Cy_b (Cyclothone braueri, Cy_p (Cyclothone pygmaea, En_e (Engraulis encrasicolus, Di_a (Diplodus annularis, Di_h (Diaphus holti, Di_r (Diaphus rafinesquei, El_r (Electrona rissoi, Go_n (Gobius niger, He_d (Helicolenus dactylopterus, Hy_b (Hygophum benoiti, Hy_h (Hygophum hygomii, La_c (Lampanyctus crocodilus, La_p (Lampanyctus pusillus, Le_c (Lepidotrigla cavillone, Le_j (Lestidiops jayakari, Lo_d (Lobianchia dofleini, Ma_m (Maurolicus muelleri, Ma_s (Macrorhamphosus scolopax, Me_m (Merluccius merluccius, Mi_p (Micromesistius poutassou, My_p (Myctophum punctatum, Mu_s (Mullus surmuletus, Ne_s (Nemichthys scolopaceus, No_b (Notoscopelus bolini, No_e (Notoscopelus elongatus, No_r (Arctozenus risso, Ob_m (Oblada melanura, Pa_s (Paralepis speciosa. Sc_p (Scorpaena porcus, Sc_s (Scorpaena scrofa, Se_c (Serranus cabrilla, Se_h (Serranushepatus, Sp_f (Spicara maena, Sp_s (Spicara smaris, Sy sp. (Symphurus nigrescens, Sy_v, (Symphurus ligulatus, St_b (Stomias boa boa, Tr_d (Trachinus draco, Tr_me (Trachurus mediterraneus, Tr_t (Trachurus trachurus, Ur_s (Uranoscopus scaber

Seasonal dynamic of the occurrence of the gregarines infection of Harpalus rufipes (Coleoptera, Carabidae in agroecosystem

Directory of Open Access Journals (Sweden)

D. Y. Reshetnyak

2015-08-01

Full Text Available Relationships in the “parasite-host” system are closely interrelated and occur at all levels from the molecular to behavioral and population ones. There are two models of realization of these relations. The first case is when the parasites are uniformly distributed in the host population. High extensiveness of invasion is accompanied by its low intensity. The second case is when a part of host population is infected with parasites, but the negative impact is manifested to the maximum extent. Invasion of the ground beetle Harpalus rufipes (De Geer, 1774, dwelling in sweet corn agroecosystems located in the vicinity of Dnipropetrovsk near Doslidnoe village, by several gregarines species is investigated in this study. H. rufipes is an abundant, ubiquitous species, living in extremely wide range of terrestrial ecosystems, with especially high populations inhabiting anthropogenically transformed environments. H. rufipes has a wide range of feeding. This species is distributed in the Central and Eastern Europe, and introduced to North America. Gregarines were found in the intestines of 20 individuals of H. rufipes from 190 (10.5%: Gregarina ovata Dufour, 1828, G. steini Berndt, 1902, G. amarae (Hammerschmidt, 1839 Frantzius, 1848, Clitellocephalus ophoni (Tuzet and Ormieres, 1956 Clopton, 2002, Torogregarina sphinx Clopton, 1998, Gigaductus macrospora Filipponi, 1948 and G. elongatus (Moriggi, 1943 Filipponi, 1948. There is high level of infestation of C. ophoni and G. steini. At the same time, not more than three species of the gregarines were localized in the beetle body. Seasonal dynamic of occurrence of the gregarines is as follows. Maximal indices of occurrence are found at the end of August (22.2% and minimal ones at the end of June (4.8%. The highest total number of gregarines (383 ind. is recorded at the end of August, the lowest one is fixed at the beginning of September (33 ind.. Indices of gregarine species dominance are as follows

Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá

Directory of Open Access Journals (Sweden)

Dueñas J. Hernando

1979-12-01

Full Text Available En el presente trabajo se da a conocer el resulrado del estudio palinológico de los 35 metros superiores de la sección Tarragona, localizada en la Sabana de Bogotá, a 2.560 metros sobre el nivel del mar. Se describen 2 géneros (Spirotremesporites, Striadyadosporites y 5 especies(Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus y Striadyadosporites constrictus de fungi fósil, 14 tipos de polen, 8 tipos de esporas triletes, 4 tipos de Pediastrum y un tipo especial de Chlorococcales. Con base en la relación de polen de elementos de páramo a polen de elementos de bosque (Pp/Pb y a la estrarigrafía, se dividió el diagrama depolen en 8 zonas climáticas (vegetación, con las cuales fue posible correlacionar la sección Tarragona con otras secciones levantadas en la Sabana de Bogotá y regiones aledañas. Utilizando esta correlación y las fechas de edad absoluta que se han obtenido en las diferentes secciones del área, fue posible efectuar una correlacion tentativa con las unidades cronoestratigráficas europeas.  Los 35 metros superiores de la sección Tarragona representan la historia geológica de por lo menos los últimos 500.000 años de la Sabana de Bogotá.In this study it is given the result of the palynological study of the uppermost 35 meters of the Tarragona section, located in the Sabana de Bogotá at an altitude of 2.560 meters above sea level.  It is described: 2 genus (Spirotremesporites, Striadyadosporites and 5 species (Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus and Striadyadosporites constrictus of fossil fungi, 14 types of pollen, 8 types of trilete spores, 4 types of Pediastrum and one special type of Chlorococcales.  On the basis of the relation, Pollen of paramo elements to Pollen of forest elements (Pp/Pb and the stratigraphy it was possible to divide the pollen diagram

Acanthochitona terezae sp. n., um novo poliplacóforo da costa brasileira (Mollusca, Polyplacophora

Directory of Open Access Journals (Sweden)

Orlando Guerra Júnior

1983-12-01

Full Text Available O autor descreve uma nova espécie de poliplacóforo (Acanthochitona terezae para o litoral brasileiro, apresenta dados sobre sua morfologia e discute aspectos biogeográficos.The author describes a new species of chiton (Acanthochitona terezae from the coast of Brazil, adducing data on its morphology and biogeographic aspects.

Stunting of the penis in Heleobia parchappii (Mollusca: Cochliopidae) and its relationship with parasitism.

Science.gov (United States)

Merlo, Matías J; Parietti, Manuela; Etchegoin, Jorge A

2017-02-08

Penis anatomy is used to discriminate species of gastropods belonging to the family Cochliopidae; however, this characteristic may be affected by the presence of parasites. To evaluate the possible effect of parasites on penis length and number of papillae in Heleobia parchappii, 195 males were collected from the Nahuel Rucá Lagoon, Argentina. Male snails were only infected by trematode digeneans (total prevalence 45.13%). Three out of 9 species of digeneans registered showed prevalence values higher than 10%: Microphallus szidati, M. simillimus, and Notocotylidae sp. 1. The penis length of non-parasitized males and those parasitized by M. szidati and M. similimus increased with increased snail length; however, this increase was lower in infected snails. In the case of snails infected with Notocotylidae sp. 1, no relationship between shell length and penis length was apparent. Differences in the life cycles of these 3 digeneans could explain the null or lower penis growth rate in relation to host body growth. In contrast, no change was observed in the number of penial papillae of H. parchappii when these snails were infected by larval digeneans compared to those that were not infected. This indicates that penial papillae may be a more stable characteristic than penis length to discriminate between species within the Cochliopidae. The study of penial papillae should be central in the taxonomy and identification of new species within the Cochliopidae, as well as in previously described species.

Vestigial phragmocone in the gladius points to a deepwater origin of squid (Mollusca: Cephalopoda)

Science.gov (United States)

Arkhipkin, Alexander I.; Bizikov, Vyacheslav A.; Fuchs, Dirk

2012-03-01

The microstructure of the gladius cone was investigated in six species of nektonic squid: shallow-water Loligo gahi (Loliginidae), pelagic eurybathic Illex argentinus, Todarodes pacificus, Dosidicus gigas (Ommastrephidae), and deepwater Onykia ingens (Onychoteuthidae) and Gonatus antarcticus (Gonatidae) using state-of-the-art microscopy. Apart from L. gahi, all other species had septa-like layers in the gladius cone, which for the first time were investigated in detail and compared with those in extinct Cretaceous belemnites Hibolithes sp. and Pachyteuthis sp., and spirulid Cyrtobelus sp. It was found that the organic layers of the gladius cone in recent squid can be homologized with the organic components of the shell in fossil phragmocone-bearing coleoids. The septa-like layers in modern gladius cones therefore represent a vestigial phragmocone composed of organic septal rudiments of the ancestral phragmocone that has lost the siphuncle and gas-filled chambers. The well-developed rostrum in onychoteuthids and small rostrum of the gladius in ommastrephids and gonatids can be seen as homologous with the belemnoid rostrum, which may indicate a close phylogenetic relationship between belemnites and at least some squid. Possible evolutionary pathways of the reduction of the functional phragmocone in squid ancestors are discussed. Several features such as the loss of shell calcification, deep water speciation, and the structure of the equilibrium organ point to a deep-water origin of squids.

Alien Planorbid (Mollusca, Gastropoda Pulmonata) from South West Africa erroneously recorded as Biomphalaria Pfeifferi

NARCIS (Netherlands)

Bruggen, van A.C.

1974-01-01

In 1970 I published a record of the freshwater snail Biomphalaria pfeifferi (Krauss, 1848) (fam. Planorbidae) for South West Africa: "Sandamap Farm, Spitzkoppe" (Van Bruggen, 1970: 45, figs. 1-13). Dr. D. S. Brown of the Medical Research Council (London) kindly drew my attention to the fact that

How well-known is the Cephalaspidean fauna (Mollusca: Opisthobranchia) in the Indo-Pacific region?

DEFF Research Database (Denmark)

Cedhagen, Tomas

1998-01-01

The gastropod group Cephalaspidea contains about 700 recent species worldwide. The status of the research on the group, indicated as the number of described species, in the tropical Indo-Pacific region is compared with other areas. The number ofspecies are 118 in the Indo-Pacific, 168 in Japan...

Pseudoglessula Libera, a new Subulinid land snail from Guinea, West Africa (Mollusca, Gastropoda Pulmonata)

NARCIS (Netherlands)

Solem, A.; Bruggen, van A.C.

1976-01-01

Study of some land snails collected in Guinea, West Africa, by Ms. Diane deVry has led to the description of a new species, Pseudoglessula libera. It is currently known only from several localities near Conakry, but probably has a wide distribution. Detailed comparisons with previously described

Estudo morfométrico da concha de Lymnaea columella say, 1817 (Mollusca, Gastropoda, Pulmonata

Directory of Open Access Journals (Sweden)

Marlene T. Ueta

1980-12-01

Full Text Available Foram estudadas variações morfométricas de conchas de L. columella, provenientes de dez criadouros localizados nos seguintes municípios do Estado de São Paulo: - Campinas, Americana, Atibaia, Pirassununga, Caçapava e Taubaté. Foram analisados os diferentes tipos de ambientes onde as limneas são encontradas com maior freqüência, estabelecendo-se a época do ano com maior abundância em espécimes, que correspondeu aos meses de julho a outubro. As medidas nas conhas dos diferentes criadouros referiram-se ao comprimento e largura da concha, comprimento e largura da abertura, comprimento da espira e número de voltas. Foram estabelecidos os coeficientes de correlação e de regressão e realizadas análises de variância entre as medidas tomadas e os índices obtidos da relação entre largura/comprimento da concha. Estas conchas foram comparadas com as de L. columella, L. viator, L. cubensis da coleção do Museu Nacional do Rio de Janeiro. Para a maioria das medidas as conchas mostraram proporções constantes, embora apresentassem diferenças em relação ao desenvolvimento. A maior variação foi observada em relação ao comprimento da espira. As variações morfométricas das conchas foram relacionadas com alguns fatores externos como pH, alcalinidade, dureza e teor da água. Aparentemente apenas a dureza total da água influiu na consistência das conchas.Shells of Lymnaea columella from ten populations from the State of São Paulo were studied to determine morphometric variation. Samples were collected in the following municipalities: Campinas, Americana, Atibaia, Pirassununga, Caçapava and Taubaté. Five measurements were taken from each shell: length and width of the shell, length and width of the aperture and lenght of the spire. Two ratios were also established: width/lenght of the shell and length of the aperture /length of the shell. The numbers of whorls and the length of the shell were also determined. Statistical tests (correlation coeficients, regression, and analysis of variance were used to compare the different samples. Also, com parisons of L. columella shells collected by us were made with those of L. columella, L. viator and L. cubensis from collections deposited in the Museu Nacional, Rio de Janeiro. The results of these studies revealed that in most of the cases the snail populations of different areas were similar, showing constant proportions, but they diverged in their absolute dimensions. Data on aquatic environmental conditions (pH, alkalinity, hardness, and calcium concentration were also obtained. These Chemical factors were examined with respect to shell morphology. Our results revealed that only hardness of water was associated with the robustness of the shells.

[Reproductive aspects of Pomacea flagellata (Mollusca: Ampullariidae) at Bacalar lagoon, Quintana Roo, México].

Science.gov (United States)

Oliva-Rivera, José J; Ocaña, Frank A; Navarrete, Alberto de Jesús; Carrillo, Rosa M de Jesús; Vargas-Espósitos, Abel A

2016-12-01

The freshwater snail Pomacea flagellata is native from Southeastern Mexico. Studies about this species are scarce and none has treated their reproduction. This snail has been exploited at Bacalar lagoon for many years, leading to a significant decrease in their abundance and currently, a permanent ban was proposed by the government. This work aimed to assess the temporal variations of mating frequency and the abundance of egg clutches of P. flagellata at Bacalar lagoon, as well as their relation with snails density and environmental variables. Sampling was done during the three climatic seasons: Rainy (July, August and September/2012), North or Cold fronts (December/2012 and January and February/2013) and Dry (March, April and May/2013) in 12 sampling stations located along the Bacalar lagoon. On each station a transect of 100 m length was set parallel to the edge, and the number of fresh egg clutches (pink color) laid over vegetation, rocks or manmade structures, were counted. In the water, three 50 x 2 m transects were set and the number of snails were counted as well as the mating frequency. Density of snails varied significantly among seasons, decreasing from the rainy to the dry season. There were no significant differences of snail abundance among months, nested in climatic seasons (ANOVA, p>0.05). During the rainy season the mating frequency was significantly higher than in the Norths, meanwhile in the dry season no mating were registered (Kruskal-Wallis, p˂0.05). Eggs clutches appeared from July to March. Density of egg clutches presented no differences between the Rainy and the North seasons (2.72 and 2.93 clutches/m, respectively), nonetheless during the dry season abundance of egg masses was significantly lower (0.1 clutches/m) (H, p˂0.05). Mating frequency was related with snail abundance (rs= 0.26; p<0.05) and water temperature (rs= 0.34; p<0.05) and the abundance of egg masses is related with snail abundance (rs= 0.46; p<0.05). In general, we observed that reproductive activity of P. flagellata at Bacalar lagoon is related with the warmer months and with higher rainfall. This finding is relevant to support the management of this resource in the region, so that to implement any management arrangement they must be aware that a temporal ban is necessary during the reproductive season at least.

Comparative morphology among representatives of main taxa of Scaphopoda and basal protobranch Bivalvia (Mollusca

Directory of Open Access Journals (Sweden)

Luiz Ricardo L. Simone

2009-01-01

Full Text Available This study deals with detailed morphology and anatomy of 4 species of Scaphopoda and 5 species of protobranch Bivalvia. Both classes are traditionally grouped in the taxon Diasoma, which has been questioned by different methodologies, such as molecular and developmental. This study is developed under a phylogenetic methodology with the main concern in performing it in an intelligible and testable methodology. The analyzed Scaphopoda species came from the Brazilian coast and belong to the family Dentaliidae [(1 Coccodentalium carduus; (2 Paradentalium disparile] and Gadiliidae; [(3 Polyschides noronhensis, n. sp. from Fernando de Noronha Archipelago; (4 Gadila braziliensis]. These species represent the main branches of the class Scaphopoda. From protobranch bivalves, representatives of the families Solemyidae [(5 Solemya occidentalis, from Florida; S. notialis, n. sp. from S.E. Brazil], Nuculanidae [(6 Propeleda carpentieri from Florida], and Nuculidae [(7 Ennucula puelcha, from south Brazil] are included. These species represent the main branches of the basal Bivalvia. The descriptions on the anatomy of S. occidentalis and of P. carpentieri are published elsewhere. The remaining are included here, for which a complete taxonomical treatment is performed. Beyond these species, representatives of other taxa are operationally included as part of the ingroup (indices are then shared with them, as a procedure to test the morphological monophyly of Diasoma. These taxa are: two lamellibranch bivalves [(8 Barbatia - Arcidae; (9 Serratina - Tellinidae; both published elsewhere;, and Propilidium (10 Patellogastropoda, and (11 Nautilus, basal Cephalopoda, based on basal taxa. The effective outgroups are (12 Neopilina (Monoplacophora and (13 Hanleya (Polyplacophora. The phylogenetic analysis based on morphology revealed that the taxon Diasoma is supported by 14 synapomorphies, and is separated from Cyrtosoma (Gastropoda + Cephalopoda. Although they are not the main goal of this paper, the taxa Scaphopoda and Bivalvia are supported by 8 and by 7 synapomorphies respectively. The taxon Protobranchia resulted paraphyletic. Both scaphopod orders resulted monophyletic. The obtained cladogram is: ((((Coccodentalium carduus - Paradentalium disparile (Polyschides noronhensis - Gadila brasiliensis ((Solemya occidentalis - S. notialis (Propeleda carpenteri (Ennucula puelcha (Barbatia cancellaria - Serratina capsoides (Propilidium curumim - Nautilus pompilius - Lolliguncula brevis.Este estudo analisa a morfologia e anatomia detalhadas de 4 espécies de Scaphopoda e 5 espécies de bivalves protobrânquios. Ambas as classes são tradicionalmente agrupadas no táxon Diasoma, o qual vem sendo questionado por diferentes metodologias, tais como molecular e de desenvolvimento. Este estudo é desenvolvido sob uma metodologia filogenética, a qual a maior preocupação é fornecer um procedimento inteligível e testável. As espécies de Scaphopoda analisadas provieram da costa brasileira e pertencem à família Dentaliidae [(1 Coccodentalium carduus; (2 Paradentalium disparile] e Gadilidae [(3 Polyschides noronhensis, n. sp. do Arquipélago de Fernando de Noronha; (4 Gadila braziliensis]. Estas espécies representam os ramos principais da classe Scaphopoda. Dos bivalves protobrânquios, representantes das famílias Solemyidae [(5 Solemya occidentalis, da Flórida; S. notialis, n. sp. do S.E. Brasil], Nuculanidae [(6 Propeleda carpentieri, da Flórida] e Nuculidae [(7 Ennucula puelcha, do sul do Brasil] são incluídos. Estas espécies representam os principais ramos dos bivalves basais. As descrições anatômicas de S. occidentalis e de P. carpentieri estão sendo publicadas em outro artigo, as das demais espécies estão incluídas neste, o qual também inclui um completo tratamento taxonômico. Além dessas espécies, representantes de outros táxons são operacionalmente incluídos como parte do ingroup (então os índices são compartilhados com eles, um procedimento visando testar a monofilia morfológica de Diasoma. Esses táxons são 2 bivalves lamelibrânquios [(8 Barbatia - Arcidae; (9 Serratina - Tellinidae; ambos publicados em artigos a parte]; Propilidium (10 Patellogastropoda e (11 Nautilus, Cephalopoda basal, baseados em táxons basais. Os outgroups efetivos são (12 Neopilina (Monoplacophora e (13 Hanleya (Polyplacophora. A análise filogenética baseada na morfologia revelou que o táxon Diasoma é suportado por 14 sinapomorfias, sendo separada de Cyrtosoma (Gastropoda + Cephalopoda. Embora não sendo o principal enfoque do presente artigo, os táxons Scaphopoda e Bivalvia são suportados por 8 e por 7 sinapomorfias respectivamente. O táxon Protobranchia resultou parafilético. O cladograma obtido é: ((((Coccodentalium carduus - Paradentalium disparile (Polyschides noronhensis - Gadila brasiliensis ((Solemya occidentalis - S. notialis (Propeleda carpenteri (Ennucula puelcha (Barbatia cancellaria - Serratina capsoides (Propilidium curumim - Nautilus pompilius - Lolliguncula brevis.

Ueber den begriff "Kinoplasma" in der spermiogenese von Australorbis Glabratus Olivaceus (Mollusca, Pulmonata, Planorbidae

Directory of Open Access Journals (Sweden)

Rudolf Barth

1960-11-01

Full Text Available Zur Klaerung der Frage, ob der Begriff "Kinoplasma" fuer gewisse, von MERTON (1924,1926, 1930 beobachtete Bildungen an den reifenden Spermiden von pulmonaten Mollusken oder fuer Bestandteile des Cytoplasmas im Sinne von STRASBURGER und SCARTH zu verwenden ist, werden in der vorliegenden Mitteilung die Vorgaenge bei der Spermiohistogenese von Australorbis glabratus olivaceus untersucht. Es ergibt sich: 1. Das von MERTON bezeichnete "Kinoplasma" existiert nicht als solches, es handelt sich bei den von ihm dargestellten Protoplasmabildungen um kugelige, von den Spermiden abgeschnuerte Restkoerper nicht verwendeten Baumaterials, bestehend aus Protoplasma und einigen Mitochondrien. Sie werden von den Naehr- oder Bazalzellen phagozytiert. Der Ausdruck "Kinoplasma" kann nur fuer die submikroskopischen, geformten, faedigen Elemente des Cytoplasmas reserviert bleiben, die den geradlinigen Fall der uebrigen nicht geformten Komponenten bremst oder ablenkt; damit muss das Kinoplasma aber aus dem Begriff des Cytoplasmas herausgenommen werden, da es, wenn auch vermutlich reversibel, eine Differenzierung darstellt. 2. Der Spermienfaden wird von den Centriolen (Axialfilament und den Mitochondrien (zwei peripher gelegene Spiralfilamente, sowie einem Plasmamantel gebildet. 3. Nach Beendigung des Auswachsens der Spermiengeissel, die zu diesem Zeitpunkt nur aus dem Achsenfaden und dem Protoplasmazylinder besteht, setzt sich eine Protoplasmamasse vom Kopf in Richtung zum Geisselende in Bewegung. Sie fuehrt den Golgi-Koerper und sehr viele Mitochondrien mit sich. Aus diesen entwickeln sich Fibrillen, die sich zu den beiden Spiralfilamenten zusammenfuegen. Diese Masse entspricht der von MERTON in seiner Theorie als Kinoplasma bezeichneten Komponente. 4. Die Bewegung dieses Protoplasmateils wird auf den Schub zurueckgefuehrt, den die sich bildenden Fibrillen auf die Mitochondrien ausueben. 5. Die Rueckwaertsbewegung dieses Protoplasmakoerpers beruht wahrscheinlich auf Elastizitaet und Kontraktilitaet des Plasmalemmas. 6. Das zum Kopf zurueckgekehrte Protoplasma wird mit restlichen Mitochondrien als Kugel ausgeschieden und von den Naehrzellen phagocytiert. 7. Der Golgi-Koerper wird vor Beendigung der Protoplasmawanderung bereits in der letzten Haelfte der Geissel eliminiert.

Sea Hare Aplysia punctata (Mollusca: Gastropoda) Can Maintain Shell Calcification under Extreme Ocean Acidification.

Science.gov (United States)

Carey, Nicholas; Dupont, Sam; Sigwart, Julia D

2016-10-01

Ocean acidification is expected to cause energetic constraints upon marine calcifying organisms such as molluscs and echinoderms, because of the increased costs of building or maintaining shell material in lower pH. We examined metabolic rate, shell morphometry, and calcification in the sea hare Aplysia punctata under short-term exposure (19 days) to an extreme ocean acidification scenario (pH 7.3, ∼2800 μatm pCO 2 ), along with a group held in control conditions (pH 8.1, ∼344 μatm pCO 2 ). This gastropod and its congeners are broadly distributed and locally abundant grazers, and have an internal shell that protects the internal organs. Specimens were examined for metabolic rate via closed-chamber respirometry, followed by removal and examination of the shell under confocal microscopy. Staining using calcein determined the amount of new calcification that occurred over 6 days at the end of the acclimation period. The width of new, pre-calcified shell on the distal shell margin was also quantified as a proxy for overall shell growth. Aplysia punctata showed a 30% reduction in metabolic rate under low pH, but calcification was not affected. This species is apparently able to maintain calcification rate even under extreme low pH, and even when under the energetic constraints of lower metabolism. This finding adds to the evidence that calcification is a largely autonomous process of crystallization that occurs as long as suitable haeomocoel conditions are preserved. There was, however, evidence that the accretion of new, noncalcified shell material may have been reduced, which would lead to overall reduced shell growth under longer-term exposures to low pH independent of calcification. Our findings highlight that the chief impact of ocean acidification upon the ability of marine invertebrates to maintain their shell under low pH may be energetic constraints that hinder growth of supporting structure, rather than maintenance of calcification.

Changes in energetic metabolism of Biomphalaria glabrata (Mollusca, Planorbidae in response to exogenous calcium

Directory of Open Access Journals (Sweden)

L. D. Silva

Full Text Available Abstract Calcium is considered an essential element for the metabolism of aquatic snail Biomphalaria glabrata (Say, 1818, intermediate host of Schistosoma mansoni Sambon, 1907 in Brazil, and represents a limiting factor to its distribution and adaptation to the environment. This study investigated the effect of different concentrations of exogenous CaCO3 on the energetic metabolism of B. glabrata for better understanding the physiological interference of chemical elements dissolved in the environment with the physiology of this species. Sixty-day-old snails were distributed into six groups, five exposed to different concentrations of CaCO3 (20, 40, 60, 80 and 100 mg/L and a control group. The exposure to CaCO3 was assessed over time, with analysis of 15 snails of each group in the following intervals: 1, 14, 21 or 30 days for hemolymph extraction. Concentrations of calcium and glucose in the hemolymph were determined by commercial kits, and organic acids were extracted using an ion exchange column and analyzed by high-performance liquid chromatography. Concentration of calcium in the hemolymph showed no significant difference (p>0.05 from the control group and between the concentrations tested. Concentration of glucose decreased (p<0.05 in the treatments of exposure to 20 and 40 mg/L and increased when exposed to 80 and 100 mg/L CaCO3 compared to control and to other concentrations tested over 30 days. The organic acids pyruvate, oxaloacetate, citrate, succinate, fumarate, beta-hydroxybutyrate and lactate presented increased concentrations, while propionate and acetoacetate, decreased concentrations, when exposed to CaCO3 compared to control. Considering the influence of different periods of exposure to CaCO3, on the 14th day, there were stronger alterations in the metabolism of B. glabrata. In conclusion, exposure to CaCO3 reduced the concentration of glucose, which is metabolized into pyruvate, the final product of glycolysis, and also influenced the energetic metabolism pathways, indicating an aerobic or partially anaerobic functioning.

The Recent Pectinoidea of the New Zealand region (Mollusca: Bivalvia: Propeamussiidae, Pectinidae and Spondylidae)

NARCIS (Netherlands)

Dijkstra, H.H.; Marshall, B.A.

2008-01-01

The Recent Pectinoidea of the New Zealand region are reviewed. Eight new species are described from the New Zealand Exclusive Economic Zone: Parvamussium cancellorum, Cyclochlamys austrina, Cc. delli, Cc. irregularis, Cc. munida, Cc. pileolus, Cyclopecten fluctuosus, and Catillopecten tasmani. Nine

Biogeographical homogeneity in the eastern Mediterranean Sea - I: the opisthobranchs (Mollusca: Gastropoda from Lebanon

Directory of Open Access Journals (Sweden)

F. CROCETTA

2013-07-01

Full Text Available A reviewed knowledge of the opisthobranch species from Lebanon (eastern Mediterranean Sea, based on literature records (scattered throughout various papers published over a period of more than 150 years and recently collected material (1999-2002 within the CEDRE framework and other samples, is presented, yielding a total number of 35 taxa recorded from the Lebanese shores identified to species level. Special emphasis has mainly been given to the alien species, for which scattered notes are also given. The known opisthobranch biota is composed of 22 native (~ 63%, 12 alien (~ 34% and one cryptogenic (~ 3% taxa. Eleven of these (Berthella aurantiaca, B. ocellata, Aplysia fasciata, Felimare picta, Felimida britoi, F. luteorosea, F. purpurea, Phyllidia flava, Dendrodoris grandiflora, D. limbata and Aeolidiella alderi constitute new records for the Lebanese fauna, whilst the examined material of a further seven species (Elysia grandifolia, Pleurobranchus forskalii, Aplysia dactylomela, Bursatella leachii, Syphonota geographica, Goniobranchus annulatus, Flabellina rubrolineata anecdotally cited from Lebanon on the basis of the samples here studied, is here first explained. One additional taxon belonging to the genus Haminoea has been identified to genus level only. Despite the searching effort poning the basis of the material analyzed here, data reported clearly suggest that strong investments are still needed for a better understanding of the eastern Mediterranean opisthobranch fauna.

An annotated list of the species of the genus Corbicula from Indonesia (Mollusca: Corbiculidae)

NARCIS (Netherlands)

Djajasasmita, Machfudz

1977-01-01

The species of the genus Corbicula known from Indonesia are alphabetically listed and noted. Sixteen out of the 35 described species are considered valid, i.e. C. gustaviana, C. moltkiana, C. sumatrana, C. tobae and C. tumida from Sumatra; C. javanica, C. pulchella and C. rivalis from Java; C.

On the morphology of Laevapex vazi n. sp. from Brazil (Mollusca: Pulmonata: Basommatophora: Ancylidae

Directory of Open Access Journals (Sweden)

Sonia Barbosa dos Santos

1989-01-01

Full Text Available A description of Laevapex vazi n. sp. based on 8 specimens collectec in Ourinhos, state of São Paulo, is presented. Shell thin, diaphanous, with a light brown periostracum and moderately elliptical opening. Apex not pointed, smooth, situated on the right posterior region of the shell, inclined to the right often reaching the edge of the shell or extending beyond it. Concentric lines clearly visible; radial striation not visible or when perceptible very thin, here and there. Ratios: shell width/shell lenght = 0,60 - 0,67 (mean = 0,63; shell height/shell length = 0,50 - 0,61 (mean = 0,55; shell height/shell width = 0,33 - 0,40 (mean = 0,35. Body of normal ancylid type; mantle pigmentation concentrated on the left side; three muscles are seen: a round posterior one on the left side, an elliptical muscle on the right anterior side and an almost almond-shaped one on the left anterior side. Tentacles with a medium core of black pigment. Pseudobranch two-lobed and folded, the dorsal lobe smaller than the vetral one. Ovotestis with 20 unbranched diverticula, around a short collecting canal. Ovispermiduct with an enlargement with several round outpocketings constituting the seminal vesicle. Carrefour as a round sac. Albumen gland almost cylindrical with several acinous diverticula. Elongated nidamental gland continous with the galndular wall of the uterus; uterus flattened and thin-walled. Spermathecal body almost rounded. Pear-shaped prostate without diverticula. Penial complex without flagellum but with well-developed ultra-penis and penis. Jaw horseshoe shaped. Radular forma 20.1.20; raquidian tooth quadricuspid, asymmetrical. The genus Laevapex Walker, 1903 is recorded for the first time in Brazil. It is easily distinguished from South American Gundlachia Pfeiffer, 1849 by its penial complex. Laevapex vazi is dedicated to Dr. Jorge Faria Vaz, from SUCEN-SP, who have been sent to me the specimens.

Revisão da subfamília Atactorhynchinae Petrotschenko, 1956 (Acanthocephala - Neoechinorhynchidae A review of Atactorhynchinae Petrotschenko, 1956 (Acanthocephala, Neoechinorhynchidae

Directory of Open Access Journals (Sweden)

Dely Noronha

1973-01-01

Full Text Available No presente trabalho é feita a revisão da subfamília Atactorhynchinae Petrostschenko, 1956. Para o gênero Floridosentis Ward, 1953, o estudo é baseado em exemplares do material tipo, além de outros encontrados parasitnando três peixes do gênero Mugil (Parati, provenientes de Cabo Frio, Rio de Janeiro. Quanto ao gênero Atactorhynchus Chandler, 1935, o nosso estudo foi baseado na descrição original de Chandler e do trabalho de Golvan sobre a classe dos Eoacanthocephala (Van Cleave, 1936.In this paper, the authors revise the sub-family Atactorhynchinae Petrotschenko, 1956, after studying types of Floridosentis mugilis (Machado Filho, 1951 and material recovered from intestine of Mugil sp. from Cabo Frio, Estado do Rio de Janeiro, Brasil. They confirm what was suggested by Bullock, 1962, about a new combination for the type species of Floridosentis Ward, 1953. For this reason, they make F. elongatus, synonym of F. mugilis Machado Filho, 1951. Besides they also enlarge the subfamily diagnosis and add a table showing the maind differences between the two genera under Atactorhynchinae Petrotschenko, 1956.

Silica ecosystem for synergistic biotransformation

Science.gov (United States)

Mutlu, Baris R.; Sakkos, Jonathan K.; Yeom, Sujin; Wackett, Lawrence P.; Aksan, Alptekin

2016-06-01

Synergistical bacterial species can perform more varied and complex transformations of chemical substances than either species alone, but this is rarely used commercially because of technical difficulties in maintaining mixed cultures. Typical problems with mixed cultures on scale are unrestrained growth of one bacterium, which leads to suboptimal population ratios, and lack of control over bacterial spatial distribution, which leads to inefficient substrate transport. To address these issues, we designed and produced a synthetic ecosystem by co-encapsulation in a silica gel matrix, which enabled precise control of the microbial populations and their microenvironment. As a case study, two greatly different microorganisms: Pseudomonas sp. NCIB 9816 and Synechococcus elongatus PCC 7942 were encapsulated. NCIB 9816 can aerobically biotransform over 100 aromatic hydrocarbons, a feat useful for synthesis of higher value commodity chemicals or environmental remediation. In our system, NCIB 9816 was used for biotransformation of naphthalene (a model substrate) into CO2 and the cyanobacterium PCC 7942 was used to provide the necessary oxygen for the biotransformation reactions via photosynthesis. A mathematical model was constructed to determine the critical cell density parameter to maximize oxygen production, and was then used to maximize the biotransformation rate of the system.

Enhanced limonene production in cyanobacteria reveals photosynthesis limitations.

Science.gov (United States)

Wang, Xin; Liu, Wei; Xin, Changpeng; Zheng, Yi; Cheng, Yanbing; Sun, Su; Li, Runze; Zhu, Xin-Guang; Dai, Susie Y; Rentzepis, Peter M; Yuan, Joshua S

2016-12-13

Terpenes are the major secondary metabolites produced by plants, and have diverse industrial applications as pharmaceuticals, fragrance, solvents, and biofuels. Cyanobacteria are equipped with efficient carbon fixation mechanism, and are ideal cell factories to produce various fuel and chemical products. Past efforts to produce terpenes in photosynthetic organisms have gained only limited success. Here we engineered the cyanobacterium Synechococcus elongatus PCC 7942 to efficiently produce limonene through modeling guided study. Computational modeling of limonene flux in response to photosynthetic output has revealed the downstream terpene synthase as a key metabolic flux-controlling node in the MEP (2-C-methyl-d-erythritol 4-phosphate) pathway-derived terpene biosynthesis. By enhancing the downstream limonene carbon sink, we achieved over 100-fold increase in limonene productivity, in contrast to the marginal increase achieved through stepwise metabolic engineering. The establishment of a strong limonene flux revealed potential synergy between photosynthate output and terpene biosynthesis, leading to enhanced carbon flux into the MEP pathway. Moreover, we show that enhanced limonene flux would lead to NADPH accumulation, and slow down photosynthesis electron flow. Fine-tuning ATP/NADPH toward terpene biosynthesis could be a key parameter to adapt photosynthesis to support biofuel/bioproduct production in cyanobacteria.

Genetic variability of broodstocks of restocking programs in Brazil

Directory of Open Access Journals (Sweden)

Nelson Lopera-Barrero

2015-09-01

Full Text Available Objective. The aim of this study was evaluate the genetic diversity of the following broodstocks: piapara (Leporinus elongatus, dourado (Salminus brasiliensis, jundiá (Rhamdia quelen and cachara (Pseudoplatystoma fasciatum already useful for restocking programs in the Paranapanema, Iguaçu and Paraná Brazilian Rivers. Materials and methods. Samples from the caudal fin of 122 fish were analyzed. DNA was extracted by NaCl protocol. PCR products were separated by a horizontal agarose gel electrophoresis. The fragments were visualized by staining with ethidium bromide. Results. The amplification of 25 primers generated different fragments in studied species that allowed characterizing 440 fragments of 100-2900 bp. High percentage of polymorphic fragments (66.67 to 86.29, Shannon index (0.365 to 0.486 and genetic diversity of Nei (0.248 to 0.331 were detected. Conclusions. The level of genetic variability in the broodstocks was adequate for allowing their use in restocking programs in the studied Rivers. However, periodical monitoring studies of genetic variability in these stocks, the mating system, reproductive system and general management must be made to guarantee the preservation of wild populations.

Delineating Substrate Diversity of Disparate Short-Chain Dehydrogenase Reductase from Debaryomyces hansenii.

Directory of Open Access Journals (Sweden)

Arindam Ghatak

Full Text Available Short-chain dehydrogenase reductases (SDRs have been utilized for catalyzing the reduction of many aromatic/aliphatic prochiral ketones to their respective alcohols. However, there is a paucity of data that elucidates their innate biological role and diverse substrate space. In this study, we executed an in-depth biochemical characterization and substrate space mapping (with 278 prochiral ketones of an unannotated SDR (DHK from Debaryomyces hansenii and compared it with structurally and functionally characterized SDR Synechococcus elongatus. PCC 7942 FabG to delineate its industrial significance. It was observed that DHK was significantly more efficient than FabG, reducing a diverse set of ketones albeit at higher conversion rates. Comparison of the FabG structure with a homology model of DHK and a docking of substrate to both structures revealed the presence of additional flexible loops near the substrate binding site of DHK. The comparative elasticity of the cofactor and substrate binding site of FabG and DHK was experimentally substantiated using differential scanning fluorimetry. It is postulated that the loop flexibility may account for the superior catalytic efficiency of DHK although the positioning of the catalytic triad is conserved.

The 'other faunivory' revisited: Insectivory in human and non-human primates and the evolution of human diet.

Science.gov (United States)

McGrew, William C

2014-06-01

The role of invertebrates in the evolution of human diet has been under-studied by comparison with vertebrates and plants. This persists despite substantial knowledge of the importance of the 'other faunivory', especially insect-eating, in the daily lives of non-human primates and traditional human societies, especially hunters and gatherers. Most primates concentrate on two phyla, Mollusca and Arthropoda, but of the latter's classes, insects (especially five orders: Coleoptera, Hymenoptera, Isoptera, Lepidoptera, Orthoptera) are paramount. An insect product, bees' honey, is particularly important, and its collection shows a reversal of the usual sexual division of labor. Human entomophagy involves advanced technology (fire, containers) and sometimes domestication. Insectivory provides comparable calorific and nutritional benefits to carnivory, but with different costs. Much insectivory in hominoids entails elementary technology used in extractive foraging, such as termite fishing by chimpanzees. Elucidating insectivory in the fossil and paleontological record is challenging, but at least nine avenues are available: remains, lithics, residues, DNA, coprolites, dental microwear, stable isotopes, osteology, and depictions. All are in play, but some have been more successful so far than others. Copyright © 2013 Elsevier Ltd. All rights reserved.

Antimicrobial peptides in marine invertebrate health and disease.

Science.gov (United States)

Destoumieux-Garzón, Delphine; Rosa, Rafael Diego; Schmitt, Paulina; Barreto, Cairé; Vidal-Dupiol, Jeremie; Mitta, Guillaume; Gueguen, Yannick; Bachère, Evelyne

2016-05-26

Aquaculture contributes more than one-third of the animal protein from marine sources worldwide. A significant proportion of aquaculture products are derived from marine protostomes that are commonly referred to as 'marine invertebrates'. Among them, penaeid shrimp (Ecdysozosoa, Arthropoda) and bivalve molluscs (Lophotrochozoa, Mollusca) are economically important. Mass rearing of arthropods and molluscs causes problems with pathogens in aquatic ecosystems that are exploited by humans. Remarkably, species of corals (Cnidaria) living in non-exploited ecosystems also suffer from devastating infectious diseases that display intriguing similarities with those affecting farmed animals. Infectious diseases affecting wild and farmed animals that are present in marine environments are predicted to increase in the future. This paper summarizes the role of the main pathogens and their interaction with host immunity, with a specific focus on antimicrobial peptides (AMPs) and pathogen resistance against AMPs. We provide a detailed review of penaeid shrimp AMPs and their role at the interface between the host and its resident/pathogenic microbiota. We also briefly describe the relevance of marine invertebrate AMPs in an applied context.This article is part of the themed issue 'Evolutionary ecology of arthropod antimicrobial peptides'. © 2016 The Author(s).

Biology and chemistry of three Pennsylvania lakes: responses to acid precipitation

Energy Technology Data Exchange (ETDEWEB)

Bradt, P.T.; Dudley, J.L.; Berg, M.B.; Barrasso, D.S.

1986-09-01

The biology and chemistry of three northeastern Pennsylvania lakes was studied from summer 1981 through summer 1983 to evaluate lakes with different sensitivities to acidification. At the acidified lake there were fewer phytoplankton and zooplankton species than at the moderately sensitive lakes. The most numerous plankton species in all three lakes are reportedly acid tolerant. Among the benthic macro-invertebrates (BMI) there were more acid tolerant Chironomidae at the acidified lake, but more acid intolerant Ephemeroptera and Mollusca and a higher wet weight at the least sensitive lake. There were no differences among the lakes' BMI mean total numbers or mean number of taxa. The fish community at the acidified lake was dominated by stunted Lepomis gibbosus, but L. machrochirous were most abundant in the other lakes. Principal component analysis suggested a shift in all three lakes over the sampling period toward combined lower pH, alkalinity, specific conductance, Ca and Mg and higher Al and Mn. Such chemical changes have been associated with acidification. The rate and extent of acidification appeared to be controlled by geological and hydrological characteristics of the drainage basins. 38 refs.

Biology and chemistry of tree Pennsylvania lakes: responses to acid precipitation. [Lepomis gibbosus; Lepomis machrochirous

Energy Technology Data Exchange (ETDEWEB)

Bradt, P.T.; Dudley, J.L.; Berg, M.B.; Barrasso, D.S.

1986-01-01

The biology and chemistry of three northeastern Pennsylvania lakes was studied from summer 1981 through summer 1983 to evaluate lakes with different sensitivities to acidification. At the acidifies lake (total alkalinity par. delta 0.0 ..mu..eq L/sup -1/) there were fewer phytoplankton and zooplankton species than at the moderately sensitive lakes. The most numerous plankton species in all three lakes are reportedly acid tolerant. Among the benthic macro- invertebrates (BMI) there were more acid tolerant Chironomidae at the acidified lake, but more acid intolerant Ephemeroptera and Mollusca and a higher wet weight at the least sensitive lake. There were no differences among the lakes' BMI mean total numbers or mean number of taxa. The fish community at the acidified lake was dominated by stunted Lepomis gibbosus, but L. machrochirous were most abundant in the other lakes. Principal component analysis suggested a shift in all three lakes over the sampling period toward combined lower pH, alkalinity, specific conductance, Ca, and Mg and higher Al and Mn. Such chemical changes have been associated with acidification. The rate and extent of acidification appeared to be controlled by geological and hydrological characteristics of the drainage basins.

PEMILIHAN LOKASI BUDI DAYA IKAN, RUMPUT LAUT, DAN TIRAM MUTIARA YANG RAMAH LINGKUNGAN DI KEPULAUAN TOGEAN, SULAWESI TENGAH

Directory of Open Access Journals (Sweden)

Utojo Utojo

2016-11-01

Central Sulawesi had coastal resources which are potential to be developed for mariculture i.e Tomini Bay, however the scientific data support was unavailable. This study was conducted by survey method to find out suitable location to be developed for mariculture in Togean Archipelago, Tojo Una-Una Regency, Central Sulawesi. Secondary data such as wheather, tidal plate, coastal fisheries production, Indonesia earth surface map of scale 1:50,000, citra land sat-7ETM digital product, and navigation map of scale 1:200,000 were collected before the study. The primary data was collected from each study areas and interpreted as mariculture requirement for several domesticated species i.e. fish, seaweed, and mollusca. Tematic map of area, suitability as the main expected out put of the study was made through spatial analysis and GIS as suggested by reference. The total potential areas which were suitable for mariculture development  are 1,601.3 hectares, namely either for fish culture in floating net cage (1,021.9 hectares, seaweed and pearl oysters (579.4 hectares were distribution in the sea waters of Siatu, Salaka, Kadidiri, Huo, and Bungin island.

Feeding habits of Pagellus acarne (Sparidae in the Gulf of Tunis, central Mediterranean

Directory of Open Access Journals (Sweden)

Rafika Fehri-Bedoui

2009-12-01

Full Text Available The feeding habits of the axillary seabream, Pagellus acarne (Risso, 1810, from the Gulf of Tunis were investigated in relation to season, sex and fish size (juveniles TL < 14.5 cm and adults TL ≥ 14.5 cm. A total of 536 specimens (males, females, unsexed and hermaphroditic, ranging between 11.0 and 25.2 cm TL, were collected with trammel nets from June 2005 to July 2006. Their stomach contents were analysed. Of the total number of examined stomachs, 279 stomachs were empty (Vacuity index, VI = 52%. The VI did not reveal significant seasonal differences when all of the specimens were analysed together; however, significant seasonal variations were observed for females. The diet of the axillary seabream was composed of 36 different prey species. The most important prey were Arthropoda, Mollusca and Echinodermata. Both the dietary indices and the Spearman’s coefficient of correlation indicated seasonal variations in the diet. The diet was more diversified in adults than in juveniles. The axillary seabream fed on a wide range of prey items, endofauna and nekton, and can be considered a carnivorous and euryphagous predator.

The effect of temperature and body size on filtration rates of Limnoperna fortunei (Bivalvia, Mytilidae under laboratory conditions

Directory of Open Access Journals (Sweden)

Débora Pestana

2009-02-01

Full Text Available The golden mussel (Limnoperna fortunei, Mollusca: Bivalvia is an invasive species that has been causing considerable environmental and economic problems in South America. In the present study, filtration rates of L. fortunei were determined in the laboratory under different temperatures (10, 15, 20, 25, 28, and 30 ºC and two types of food (Algamac-2000® and the chlorophycean alga Scenedesmus sp.. There was a statistically significant relationship between time and filtration rates in the experiment using Scenedesmus sp., regardless of temperature. However, this pattern was absent in the experiment using Algamac, suggesting that the relationship between filtration rates and temperature might depend on the size of the filtered particles. In addition, there was no correlation between filtration rates and either shell size or condition index (the relationship between the weight and the length of a mussel. The filtration rate measured in the present study (724.94 ml/h was one of the highest rates recorded among invasive bivalves to date. Given that the colonies of the golden mussel could reach hundreds of thousands of individuals per square meter, such filtration levels could severely impact the freshwater environments in its introduced range.

The Global Invertebrate Genomics Alliance (GIGA): Developing Community Resources to Study Diverse Invertebrate Genomes

KAUST Repository

Bracken-Grissom, Heather

2013-12-12

Over 95% of all metazoan (animal) species comprise the invertebrates, but very few genomes from these organisms have been sequenced. We have, therefore, formed a Global Invertebrate Genomics Alliance (GIGA). Our intent is to build a collaborative network of diverse scientists to tackle major challenges (e.g., species selection, sample collection and storage, sequence assembly, annotation, analytical tools) associated with genome/transcriptome sequencing across a large taxonomic spectrum. We aim to promote standards that will facilitate comparative approaches to invertebrate genomics and collaborations across the international scientific community. Candidate study taxa include species from Porifera, Ctenophora, Cnidaria, Placozoa, Mollusca, Arthropoda, Echinodermata, Annelida, Bryozoa, and Platyhelminthes, among others. GIGA will target 7000 noninsect/nonnematode species, with an emphasis on marine taxa because of the unrivaled phyletic diversity in the oceans. Priorities for selecting invertebrates for sequencing will include, but are not restricted to, their phylogenetic placement; relevance to organismal, ecological, and conservation research; and their importance to fisheries and human health. We highlight benefits of sequencing both whole genomes (DNA) and transcriptomes and also suggest policies for genomic-level data access and sharing based on transparency and inclusiveness. The GIGA Web site () has been launched to facilitate this collaborative venture.

Registro de Achatina fulica Bowdich, 1822 (Mollusca, Gastropoda no Brasil: caramujo hospedeiro intermediário da angiostrongilíase Occurrence of Achatina fulica Bowdich, 1822 (Mollusca, Gastropoda in Brazil: intermediate snail host of angiostrongyliasis

Directory of Open Access Journals (Sweden)

Horácio Manuel Santana Teles

1997-06-01

Full Text Available A introdução de Achatina fulica é assinalada em Itariri, SP, Brasil. Essa espécie de caramujo terrestre foi importada para cultivo, visando à comercialização para consumo humano como "escargot". O encontro de exemplares em vida livre mostra a dispersão de A. fulica e, conseqüentemente, o risco de transmissão de Angiostrongylus cantonensis, nematóide parasita do homem e de outros vertebrados. Além disso, o caramujo é uma praga importante da agricultura.Achatina fulica, the intermediate snail host of angiostrongyliasis and also an agricultural pest, is being bred in Brazil for human consumption as "escargot". The snail has escaped from its artificial breeding sites and its dispersal in Itariri county, State of S. Paulo, is reported here for the first time. A. fulica is a transmitter of the rat lungworm Angiostrongylus cantonensis, nematode which causes meningoencephalic angiostrongyliasis; the risks of human contamination are commented on.

Patterns of Diversity of the Rissoidae (Mollusca: Gastropoda) in the Atlantic and the Mediterranean Region

OpenAIRE

Sérgio P. Ávila; Jeroen Goud; António M. de Frias Martins

2012-01-01

The geographical distribution of the Rissoidae in the Atlantic Ocean and Mediterranean Sea was compiled and is up-to-date until July 2011. All species were classified according to their mode of larval development (planktotrophic and nonplanktotrophic), and bathymetrical zonation (shallow species—those living between the intertidal and 50 m depth, and deep species—those usually living below 50 m depth). 542 species of Rissoidae are presently reported to the Atlantic Ocean and the Mediterranean...

Patterns of diversity of the Rissoidae (Mollusca: Gastropoda) in the Atlantic and the Mediterranean region.

Science.gov (United States)

Ávila, Sérgio P; Goud, Jeroen; de Frias Martins, António M

2012-01-01

The geographical distribution of the Rissoidae in the Atlantic Ocean and Mediterranean Sea was compiled and is up-to-date until July 2011. All species were classified according to their mode of larval development (planktotrophic and nonplanktotrophic), and bathymetrical zonation (shallow species--those living between the intertidal and 50 m depth, and deep species--those usually living below 50 m depth). 542 species of Rissoidae are presently reported to the Atlantic Ocean and the Mediterranean Sea, belonging to 33 genera. The Mediterranean Sea is the most diverse site, followed by Canary Islands, Caribbean, Portugal, and Cape Verde. The Mediterranean and Cape Verde Islands are the sites with higher numbers of endemic species, with predominance of Alvania spp. in the first site, and of Alvania and Schwartziella at Cape Verde. In spite of the large number of rissoids at Madeira archipelago, a large number of species are shared with Canaries, Selvagens, and the Azores, thus only about 8% are endemic to the Madeira archipelago. Most of the 542-rissoid species that live in the Atlantic and in the Mediterranean are shallow species (323), 110 are considered as deep species, and 23 species are reported in both shallow and deep waters. There is a predominance of nonplanktotrophs in islands, seamounts, and at high and medium latitudes. This pattern is particularly evident in the genera Crisilla, Manzonia, Onoba, Porosalvania, Schwartziella, and Setia. Planktotrophic species are more abundant in the eastern Atlantic and in the Mediterranean Sea. The results of the analysis of the probable directions of faunal flows support the patterns found by both the Parsimony Analysis of Endemicity and the geographical distribution. Four main source areas for rissoids emerge: Mediterranean, Caribbean, Canaries/Madeira archipelagos, and the Cape Verde archipelago. We must stress the high percentage of endemics that occurs in the isolated islands of Saint Helena, Tristan da Cunha, Cape Verde archipelago and also the Azores, thus reinforcing the legislative protective actions that the local governments have implemented in these islands during the recent years.

New records for the shallow-water chiton fauna (Mollusca, Polyplacophora of the Azores (NE Atlantic

Directory of Open Access Journals (Sweden)

Sérgio Ávila

2013-06-01

Full Text Available Published records, original data from recent field work on all of the islands of the Azores (NE Atlantic, and a revision of the entire mollusc collection deposited in the Department of Biology of the University of the Azores (DBUA were used to compile a checklist of the shallow-water Polyplacophora of the Azores. Lepidochitona cf. canariensis and Tonicella rubra are reported for the first time for this archipelago, increasing the recorded Azorean fauna to seven species.

The influence of thymol+DMSO on survival, growth and reproduction of Bradybaena similaris (Mollusca: Bradybaenidae

Directory of Open Access Journals (Sweden)

Paula Ferreira

2011-04-01

Full Text Available Bradybaena similaris (Férussac, 1821, commonly known as the Asian trampsnail, is a terrestrial snail native to Asia, introduced in other regions of the world. In Brazil, populations of this land snail are distributed from the state of Amapá in the North to Rio Grande do Sul in the South. This species acts as an intermediate host for parasites and is a difficult-to-control agricultural pest as well, causing great losses to crops and ornamental plant cultivation. This land snail is easily reared in the laboratory and has been successfully used as a biological model in studies that aim at verifying molluscicidal effects of plant extracts. Several studies have demonstrated that B. similaris, like many other species of land and freshwater snails, is physiologically adapted to survival over transitory unfavorable environmental conditions. Moreover, this species seems to have a life history strategy characterized by a short life span and a maximal opportunistic reproductive effort during transient favorable periods. Such biological features may potentially lead to the inefficacy of control attempts and, simultaneously, make this species able to repopulate sites previously treated with biocides. For this reason, studies that aim at verifying the effect of molluscicides on the reproduction, growth and survival of molluscs are greatly required. Molluscicides of plant origin may represent a safe and effective way of controlling these animals. Thymol is a substance of plant origin which has bactericidal, fungicidal and anti-inflammatory properties and has been presented as a promissory biocide of mollusc species. The aim of this work was to assess the molluscicidal property of thymol in combination with DMSO against eggs and adults of B. similaris. During 120 days, we evaluated the effect of thymol+DMSO at different concentrations (2.5 g/L and 5 g/L on the hatching success, hatchling survival, growth and reproduction of B. similaris under laboratory conditions. We tested thymol+DMSO on 160 eggs, 160 10-day-old and 160 30-day-old juveniles. The results showed that thymol+DMSO (5 g/L and 2.5 g/L affected hatching success, acting as an ovicide. The tests with 10-day-old juveniles showed that thymol+DMSO at 2.5 g/L and 5 g/L caused 90 and 100% of mortality, respectively. For the 30-day-old juveniles, thymol+DMSO caused 87.5% of mortality at 5 g/L, and 75% at 2.5 g/L. With regard to growth, the results were not significant. The 10-day-old individuals treated with thymol+DMSO showed only one reproductive event during the 120 days of the experiment. Thymol+DMSO showed molluscicidal and residual activity, which makes evident its potential for controlling snails, and consequently, snail-borne diseases.

New records and new species of cones from deeper water off Fiji (Mollusca, Gastropoda, Conidae)

NARCIS (Netherlands)

Moolenbeek, R.G.; Röckel, D.; Bouchet, P.

2008-01-01

A little less than 100 species of cones are known in the literature from waters around the Fiji islands, all intertidal to subtidal. We report here on the species taken by recent offshore and deep-water benthic sampling expeditions. Samples were taken to depths of 1300 m, although cones were taken

Is Galba schirazensis (Mollusca, Gastropoda) an intermediate host of Fasciola hepatica (Trematoda, Digenea) in Ecuador?

Science.gov (United States)

Caron, Yannick; Celi-Erazo, Maritza; Hurtrez-Boussès, Sylvie; Lounnas, Mannon; Pointier, Jean-Pierre; Saegerman, Claude; Losson, Bertrand; Benítez-Ortíz, Washington

2017-01-01

Fasciolosis is a widely distributed disease in livestock in South America but knowledge about the epidemiology and the intermediate hosts is relatively scarce in Ecuador. For three months, lymnaeid snails were sampled (n = 1482) in Pichincha Province at two sites located in a highly endemic area. Snails were identified (based on morphology and ITS-2 sequences) and the infection status was established through microscopic dissection and a multiplex polymerase chain reaction (PCR)-based technique. Techniques based on morphology were not useful to accurately name the collected snail species. Comparison with available DNA sequences showed that a single snail species was collected, Galba schirazensis. Live rediae were observed in 1.75% (26/1482) and Fasciola sp. DNA was detected in 6% (89/1482) of collected snails. The COX-1 region permitted identification of the parasite as Fasciola hepatica. The relative sensitivity and specificity of the microscope study, compared to PCR results, were 25.84% and 99.78%, respectively. The mean size of the snails recorded positive for F. hepatica through crushing and microscopy was significantly higher than the mean size of negative snails, but there was no such difference in PCR-positive snails. The role of G. schirazensis as an intermediate host of F. hepatica in Ecuador is discussed and the hypothesis of an adaptation of the parasite to this invasive snail is proposed. For the first time, an epidemiological survey based on molecular biology-based techniques assessed the possible role of lymnaeid snails in the epidemiology of fasciolosis in Ecuador. © Y. Caron et al., published by EDP Sciences, 2017.

Is Galba schirazensis (Mollusca, Gastropoda an intermediate host of Fasciola hepatica (Trematoda, Digenea in Ecuador?

Directory of Open Access Journals (Sweden)

Caron Yannick

2017-01-01

Full Text Available Fasciolosis is a widely distributed disease in livestock in South America but knowledge about the epidemiology and the intermediate hosts is relatively scarce in Ecuador. For three months, lymnaeid snails were sampled (n = 1482 in Pichincha Province at two sites located in a highly endemic area. Snails were identified (based on morphology and ITS-2 sequences and the infection status was established through microscopic dissection and a multiplex polymerase chain reaction (PCR-based technique. Techniques based on morphology were not useful to accurately name the collected snail species. Comparison with available DNA sequences showed that a single snail species was collected, Galba schirazensis. Live rediae were observed in 1.75% (26/1482 and Fasciola sp. DNA was detected in 6% (89/1482 of collected snails. The COX-1 region permitted identification of the parasite as Fasciola hepatica. The relative sensitivity and specificity of the microscope study, compared to PCR results, were 25.84% and 99.78%, respectively. The mean size of the snails recorded positive for F. hepatica through crushing and microscopy was significantly higher than the mean size of negative snails, but there was no such difference in PCR-positive snails. The role of G. schirazensis as an intermediate host of F. hepatica in Ecuador is discussed and the hypothesis of an adaptation of the parasite to this invasive snail is proposed. For the first time, an epidemiological survey based on molecular biology-based techniques assessed the possible role of lymnaeid snails in the epidemiology of fasciolosis in Ecuador.

Especies bentónicas de Opisthobranchia (Mollusca: Gastropoda presentes en el litoral del norte peruano

Directory of Open Access Journals (Sweden)

Katia Nakamura

2013-05-01

Full Text Available El presente trabajo muestra las especies bentónicas de Opisthobranchia registradas para el norte del Perú. El trabajo se basa en la recopilación de la literatura científica disponible para el área de interés. Se presentan las 17 especies reportadas para dicha zona, clasificadas dentro del Grupo Informal Opisthobranchia en 6 clados, 12 familias y 14 géneros. A pesar del alto potencial de diversidad que se le otorga a la costa norte peruana, el número de especies registradas es bajo, debido principalmente al escaso número de exploraciones e investigaciones realizadas.

Ross Sea Mollusca from the Latitudinal Gradient Program: R/V Italica 2004 Rauschert dredge samples

Directory of Open Access Journals (Sweden)

Claudio Ghiglione

2013-10-01

Full Text Available Information regarding the molluscs in this dataset is based on the Rauschert dredge samples collected during the Latitudinal Gradient Program (LGP on board the R/V “Italica” in the Ross Sea (Antarctica in the austral summer 2004. A total of 18 epibenthic dredge deployments/samplings have been performed at four different locations at depths ranging from 84 to 515m by using a Rauschert dredge with a mesh size of 500µm. In total 8,359 specimens have been collected belonging to a total of 161 species. Considering this dataset in terms of occurrences, it corresponds to 505 discrete distributional records (incidence data. Of these, in order of abundance, 5,965 specimens were Gastropoda (accounting for 113 species, 1,323 were Bivalvia (accounting for 36 species, 949 were Aplacophora (accounting for 7 species, 74 specimens were Scaphopoda (3 species, 38 were Monoplacophora (1 species and, finally, 10 specimens were Polyplacophora (1 species. This data set represents the first large-scale survey of benthic micro-molluscs for the area and provides important information about the distribution of several species, which have been seldom or never recorded before in the Ross Sea. All vouchers are permanently stored at the Italian National Antarctic Museum (MNA, Section of Genoa, enabling future comparison and crosschecking. This material is also currently under study, from a molecular point of view, by the barcoding project “BAMBi” (PNRA 2010/A1.10.

Deep-water Drilliinae, Cochlespirinae and Oenopotinae (Mollusca: Gastropoda: Turridae from the Campos Basin, southeast Brazil

Directory of Open Access Journals (Sweden)

Raquel Medeiros Andrade Figueira

2010-08-01

Full Text Available Samples of a soft-bottom community from the continental slope of Campos Basin, off southeast Brazil, were obtained between 2001 and 2003 by the Research Vessel “Astro-Garoupa” with a 0.25 m2 box corer or by dredging with a Charcot dredge. A total of 177 samples were taken at depths ranging from 700 to 1950 m. Mollusks were present at all of the stations and among Gastropoda the Turridae showed the highest diversity. Within the family Cochlespirinae we found: Leucosyrinx tenoceras (Dall, 1889, L. verrillii (Dall, 1881, expanding the known distribution of the latter species farther south, and L.? subgrundifera (Dall, 1888, which is the first record of this species for the South Atlantic and the shallowest depth at which it has ever been found. Within the family Drilliinae we found Splendrillia centimata (Dall, 1889, also the first record of this species for the South Atlantic and its shallowest depth. Within the subfamily Oenopotinae we describe here three new species in the genus Oenopota Mörch, 1852: O. seraphina n. sp., O. diabula n. sp. and O. carioca n. sp.

Dynamics and ecology of an Indo-Pacific conch,Conomurex persicus (Mollusca: Gastropoda in southeastern Turkey

Directory of Open Access Journals (Sweden)

Erhan Mutlu

2006-03-01

Full Text Available Conomurex persicus, one of the tropical conchs, has been introduced to one of the subtropical regions, the northeastern Mediterranean Sea, and invaded sandy bottoms between 1 and 10 m deep. Population dynamics were studied from specimens collected with a standard dredge (60 x 15 cm mouth opening, 0.5 x 0.5 cm eye opening of net. Samples of C. persicus were collected monthly along the 5 and 10 m depth contours off Erdemli, Mersin, Turkey, in February and May 2000. Intra-annual density depended on salinity levels, while inter-annual density was correlated with bottom water temperature. Specimens underwent spring emergences and winter burial and sheltering (disappearance. Emergence took place in March when temperatures rose and the disappearance occurred in October-November when temperatures dropped. Adults live at 10 m, juveniles are recruited at a 5 m depth. Recruitment began in April and continued for the next 6 months. In contrast to shell width or shell lip thickness, shell length was not a convenient index for estimation of growth parameters. Annual production and mortality were calculated to be 7.86 g m-2 and 3.80 g m-2, respectively, in April-November. Rev. Biol. Trop. 54 (1: 117-129. Epub 2006 Mar 31.El gastrópodo tropical Conomurex persicurs, ha sido introducido a una región subtropical, el noreste del Mar Mediterráneo, y ha invadido los fondos arenosos en un rango de profundidad de 1 a 10 m. Se estudiarion las dinámicas poblacionales a partir de especímenes recolectados mediante un dragado estándard (60 x 15 cm de apertura de entrada y 0.5 x 0.5 cm de tramado. Muestras de C. persicus fueron recolectadas mensualmente a produndidades de 5 y 10 m en las cercanías de Erdemil, Mersin, Turkey, en los meses de febrero y mayo del año 2000. La densidad dentro de un mismo año depende de los niveles de salinidad, mientras que al comparar años distintos está correlacionada con la temperatura del agua.

The genus Alvania on the Canary islands and Madeira (Mollusca: Gastropoda), part 2 [final part

NARCIS (Netherlands)

Moolenbeek, R.G.; Hoenselaar, H.J.

1998-01-01

Five Alvania species from the Canary Islands and the Madeira Archipelago are revised. A new species to science, A. johannae is described and for three species lectotypes are designated. Altogether 13 littoral alvaniids are presently known from this area. Doubtful records are enumerated and a list of

[Occurrence of Achatina fulica Bowdich, 1822 (Mollusca, Gastropoda) in Brazil: intermediate snail host of angiostrongyliasis].

Science.gov (United States)

Teles, H M; Vaz, J F; Fontes, L R; Domingos, M de F

1997-06-01

Achatina fulica, the intermediate snail host of angiostrongyliasis and also an agricultural pest, is being bred in Brazil for human consumption as "escargot". The snail has escaped from its artificial breeding sites and its dispersal in Itariri country, State of S. Paulo, is reported here for the first time. A. fulica is a transmitter of the rat lungworm Angiostrongylus cantonensis, nematode which causes meningoencephalic angiostrongyliasis; the risks of human contamination are commented on.

Patterns of Diversity of the Rissoidae (Mollusca: Gastropoda) in the Atlantic and the Mediterranean Region

Science.gov (United States)

Ávila, Sérgio P.; Goud, Jeroen; de Frias Martins, António M.

2012-01-01

The geographical distribution of the Rissoidae in the Atlantic Ocean and Mediterranean Sea was compiled and is up-to-date until July 2011. All species were classified according to their mode of larval development (planktotrophic and nonplanktotrophic), and bathymetrical zonation (shallow species—those living between the intertidal and 50 m depth, and deep species—those usually living below 50 m depth). 542 species of Rissoidae are presently reported to the Atlantic Ocean and the Mediterranean Sea, belonging to 33 genera. The Mediterranean Sea is the most diverse site, followed by Canary Islands, Caribbean, Portugal, and Cape Verde. The Mediterranean and Cape Verde Islands are the sites with higher numbers of endemic species, with predominance of Alvania spp. in the first site, and of Alvania and Schwartziella at Cape Verde. In spite of the large number of rissoids at Madeira archipelago, a large number of species are shared with Canaries, Selvagens, and the Azores, thus only about 8% are endemic to the Madeira archipelago. Most of the 542-rissoid species that live in the Atlantic and in the Mediterranean are shallow species (323), 110 are considered as deep species, and 23 species are reported in both shallow and deep waters. There is a predominance of nonplanktotrophs in islands, seamounts, and at high and medium latitudes. This pattern is particularly evident in the genera Crisilla, Manzonia, Onoba, Porosalvania, Schwartziella, and Setia. Planktotrophic species are more abundant in the eastern Atlantic and in the Mediterranean Sea. The results of the analysis of the probable directions of faunal flows support the patterns found by both the Parsimony Analysis of Endemicity and the geographical distribution. Four main source areas for rissoids emerge: Mediterranean, Caribbean, Canaries/Madeira archipelagos, and the Cape Verde archipelago. We must stress the high percentage of endemics that occurs in the isolated islands of Saint Helena, Tristan da Cunha, Cape Verde archipelago and also the Azores, thus reinforcing the legislative protective actions that the local governments have implemented in these islands during the recent years. PMID:22693430

Fine structure and immunocytochemistry of a new chemosensory system in the Chiton larva (Mollusca: Polyplacophora)

DEFF Research Database (Denmark)

Haszprunar, Gerhard; Friedrich, Stefan; Wanninger, Andreas

2002-01-01

symmetrically situated pairs lying dorsolaterally and ventrolaterally in the pretrochal part of the trochophore-like larva and they send axons into the cerebral commissure. They are lost at metamorphosis. The fine structure of these cells strongly resembles that of so-called "ampullary cells" known from various...

A checklist of land snails from the west coast islands of Sabah, Borneo (Mollusca, Gastropoda

Directory of Open Access Journals (Sweden)

Chee-Chean Phung

2017-05-01

Full Text Available Sabah, situated in one of the world’s biodiversity hotspots, has the largest number of islands in Malaysia with more than 500 of various sizes and degrees of isolation. However, information on the islands’ biodiversity is limited. This study provides an up-to-date checklist of land snail species found on 24 west coast islands in Sabah. A total of 67 species (nearly 20% of the total number of land snail species in the state representing 37 genera and 19 families is enumerated based on systematic field surveys of 133 sampling plots, BORNEENSIS database records and species checklists published between 2000 and 2016. The number of species on the islands ranges from four to 29. Labuan Island has the highest number of species (29, followed by Tiga Island (25, Mantanani Besar Island (24 and Gaya Island (23. However, the populations of some land snail species may have declined as several previously recorded species on the islands were not found in a recent systematic field sampling. This checklist is provided as a baseline inventory for future island land snail studies and to better inform biodiversity conservation plans of marine parks and other islands on the Sabah west coast.

Anatomia e histologia do aparelho reprodutor masculino de Pomacea canaliculata (Lamarck, 1822 (Mollusca, Gastropoda, Pilidae

Directory of Open Access Journals (Sweden)

Eliana de Fátima Marques de Mesquita

1990-01-01

Full Text Available In this paper the authors give an anatomical and histological analysis of the male reproductive system of Pomacea canaliculata (Lamarck, 1822. Anatomically, the testis is better evidentiated than the ovary. In the structure of the testis a great number of very small channels converges to a single one. The male copulatory organs result of transformations that take place in the inner surface on the palial membrane. Histologically, the testis of immature males shows seminiferous ducts with round egg-shaped forms. In their lumens we could notice masses of cells that will originate spermatozoids. The penis has a conjunctive muscular sheath that can be seen in van Gieson's coloured preparations.

A morphological study on the African genus Micralestes (Characidae

Directory of Open Access Journals (Sweden)

Pier Giorgio Bianco

2015-12-01

Full Text Available The study is based on the compared morphology of most of Micralestes nominal taxa, described from whole Africa, with particular attention to the dentition, meristics counts and, in several cases, the color pattern. Type materials and more than 1.500 additional specimens were analyzed. The genus is spread in sub-sahariana areas, and the Nile. Is absent in estern Africa and the southernmost area of South Africa. About 11 species were recognized. The most spread species are: M. humilis which is found from western Africa to the head water of River Sobat (White Nile basin, and the Congo basin, and M. elongatus which range from western Africa to the Nile Basin, but absent in central and southern Africa All others species have restricted ranges: M. occidentalis in basins of western Africa; M. woosmani, M. holargyreus, M. congicus, M. neglectus. M.ambiguous and M. schelly, are all endemic of Congo Basin. M. acutidens was found only in rivers of southern Africa and I did not found any specimens in the Congo basin which can be identified as this species. In Lake Rudolf exist a populations previously identified as M. acutidens which cannot be assigned to any known species and it should be considered as a new one.

Genetic support for the morphological identification of larvae of Myctophidae, Gonostomatidae, Sternoptychidae and Phosichthyidae (Pisces from the western Mediterranean

Directory of Open Access Journals (Sweden)

Ainhoa Bernal

2014-12-01

Full Text Available Mesopelagic fishes experience an extreme body transformation from larvae to adults. The identification of the larval stages of fishes from the two orders Myctophiformes and Stomiiformes is currently based on the comparison of morphological, pigmentary and meristic characteristics of different developmental stages. However, no molecular evidence to confirm the identity of the larvae of these mesopelagic species is available so far. Since DNA barcoding emerged as an accurate procedure for species discrimination and larval identification, we have used the cytochrome c oxidase 1 or the mitochondrial 12S ribosomal DNA regions to identify larvae and adults of the most frequent and abundant species of myctophiforms (family Myctophidae and stomiiforms (families Gonostomatidae, Sternoptychidae and Phosichthyidae from the Mediterranean Sea. The comparisons of sequences from larval and adult stages corroborated the value of the morphological characters that were used for taxonomic classification. The combination of the sequences obtained in this study and those of related species from GenBank was used to discuss the consistency of monophyletic clades for different genera. Pairwise nucleotide distances were notably higher inter- than intraspecifically, and were useful to discern between congeners such as Cyclothone braueri and C. pygmaea, Hygophum benoiti and H. hygomii, Lampanyctus crocodilus and L. pusillus, and Notoscopelus bolini and N. elongatus.

Prevalence and Sequence-Based Identity of Rumen Fluke in Cattle and Deer in New Caledonia.

Directory of Open Access Journals (Sweden)

Laura Cauquil

Full Text Available An abattoir survey was performed in the French Melanesian archipelago of New Caledonia to determine the prevalence of paramphistomes in cattle and deer and to generate material for molecular typing at species and subspecies level. Prevalence in adult cattle was high at animal level (70% of 387 adult cattle and batch level (81%. Prevalence was lower in calves at both levels (33% of 484 calves, 51% at batch level. Animals from 2 of 7 deer farms were positive for rumen fluke, with animal-level prevalence of 41.4% (29/70 and 47.1% (33/70, respectively. Using ITS-2 sequencing, 3 species of paramphistomes were identified, i.e. Calicophoron calicophorum, Fischoederius elongatus and Orthocoelium streptocoelium. All three species were detected in cattle as well as deer, suggesting the possibility of rumen fluke transmission between the two host species. Based on heterogeneity in ITS-2 sequences, the C. calicophorum population comprises two clades, both of which occur in cattle as well as deer. The results suggest two distinct routes of rumen fluke introduction into this area. This approach has wider applicability for investigations of the origin of rumen fluke infections and for the possibility of parasite transmission at the livestock-wildlife interface.

Physiological tolerance and stoichiometric potential of cyanobacteria for hydrocarbon fuel production.

Science.gov (United States)

Kämäräinen, Jari; Knoop, Henning; Stanford, Natalie J; Guerrero, Fernando; Akhtar, M Kalim; Aro, Eva-Mari; Steuer, Ralf; Jones, Patrik R

2012-11-30

Cyanobacteria are capable of directly converting sunlight, carbon dioxide and water into hydrocarbon fuel or precursors thereof. Many biological and non-biological factors will influence the ability of such a production system to become economically sustainable. We evaluated two factors in engineerable cyanobacteria which could potentially limit economic sustainability: (i) tolerance of the host to the intended end-product, and (ii) stoichiometric potential for production. Alcohols, when externally added, inhibited growth the most, followed by aldehydes and acids, whilst alkanes were the least inhibitory. The growth inhibition became progressively greater with increasing chain-length for alcohols, whilst the intermediate C6 alkane caused more inhibition than both C3 and C11 alkane. Synechocystis sp. PCC 6803 was more tolerant to some of the tested chemicals than Synechococcus elongatus PCC 7942, particularly ethanol and undecane. Stoichiometric evaluation of the potential yields suggested that there is no difference in the potential productivity of harvestable energy between any of the studied fuels, with the exception of ethylene, for which maximal stoichiometric yield is considerably lower. In summary, it was concluded that alkanes would constitute the best choice metabolic end-product for fuel production using cyanobacteria if high-yielding strains can be developed. Copyright © 2012 Elsevier B.V. All rights reserved.

A barrier to upstream migration in the fish passage of Itaipu Dam (Canal da Piracema), Paraná River basin

Science.gov (United States)

,; Fontes Júnior, Hélio Martins; Makrakis, Sergio; Gomes, Luiz Carlos; Latini, João Dirço

2012-01-01

The majority of the fish passages built in the Neotropical region are characterised by low efficiency and high selectivity; in many cases, the benefits to fish populations are uncertain. Studies conducted in the Canal da Piracema at Itaipu dam on the Parana River indicate that the system component designated as the Discharge channel in the Bela Vista River (herein named Canal de deságue no rio Bela Vista or CABV), a 200 m long technical section, was the main barrier to the upstream migration. The aim of this study was to evaluate the degree of restriction imposed by the CABV on upstream movements of Prochilodus lineatus and Leporinus elongatus, Characiformes. Fish were tagged with passive integrated transponders (PIT tags) and released both downstream and upstream of this critical section. Individuals of both species released downstream of the CABV took much more time to reach the upper end of the system (43.6 days vs. 15.9 days), and passed in much lower proportions (18% vs. 60.8%) than those tagged upstream of this component. Although more work is needed to differentiate between fishway effects and natural variation in migratory motivation, the results clearly demonstrate passage problems at the CABV.

An evolutionary fitness enhancement conferred by the circadian system in cyanobacteria

International Nuclear Information System (INIS)

Ma, Peijun; Woelfle, Mark A.; Johnson, Carl Hirschie

2013-01-01

Circadian clocks are found in a wide variety of organisms from cyanobacteria to mammals. Many believe that the circadian clock system evolved as an adaption to the daily cycles in light and temperature driven by the rotation of the earth. Studies on the cyanobacterium, Synechococcus elongatus PCC 7942, have confirmed that the circadian clock in resonance with environmental cycles confers an adaptive advantage to cyanobacterial strains with different clock properties when grown in competition under light–dark cycles. The results thus far suggest that in a cyclic environment, the cyanobacterial strains whose free running periods are closest to the environmental period are the most fit and the strains lacking a functional circadian clock are at a competitive disadvantage relative to strains with a functional clock. In contrast, the circadian system provides little or no advantage to cyanobacteria grown in competition in constant light. To explain the potential mechanism of this clock-mediated enhancement in fitness in cyanobacteria, several models have been proposed; these include the limiting resource model, the diffusible inhibitor model and the cell-to-cell communication model. None of these models have been excluded by the currently available experimental data and the mechanistic basis of clock-mediated fitness enhancement remains elusive

An Approach for Predicting Essential Genes Using Multiple Homology Mapping and Machine Learning Algorithms.

Science.gov (United States)

Hua, Hong-Li; Zhang, Fa-Zhan; Labena, Abraham Alemayehu; Dong, Chuan; Jin, Yan-Ting; Guo, Feng-Biao

Investigation of essential genes is significant to comprehend the minimal gene sets of cell and discover potential drug targets. In this study, a novel approach based on multiple homology mapping and machine learning method was introduced to predict essential genes. We focused on 25 bacteria which have characterized essential genes. The predictions yielded the highest area under receiver operating characteristic (ROC) curve (AUC) of 0.9716 through tenfold cross-validation test. Proper features were utilized to construct models to make predictions in distantly related bacteria. The accuracy of predictions was evaluated via the consistency of predictions and known essential genes of target species. The highest AUC of 0.9552 and average AUC of 0.8314 were achieved when making predictions across organisms. An independent dataset from Synechococcus elongatus , which was released recently, was obtained for further assessment of the performance of our model. The AUC score of predictions is 0.7855, which is higher than other methods. This research presents that features obtained by homology mapping uniquely can achieve quite great or even better results than those integrated features. Meanwhile, the work indicates that machine learning-based method can assign more efficient weight coefficients than using empirical formula based on biological knowledge.

Circadian Rhythms in Cyanobacteria

Science.gov (United States)

Golden, Susan S.

2015-01-01

SUMMARY Life on earth is subject to daily and predictable fluctuations in light intensity, temperature, and humidity created by rotation of the earth. Circadian rhythms, generated by a circadian clock, control temporal programs of cellular physiology to facilitate adaptation to daily environmental changes. Circadian rhythms are nearly ubiquitous and are found in both prokaryotic and eukaryotic organisms. Here we introduce the molecular mechanism of the circadian clock in the model cyanobacterium Synechococcus elongatus PCC 7942. We review the current understanding of the cyanobacterial clock, emphasizing recent work that has generated a more comprehensive understanding of how the circadian oscillator becomes synchronized with the external environment and how information from the oscillator is transmitted to generate rhythms of biological activity. These results have changed how we think about the clock, shifting away from a linear model to one in which the clock is viewed as an interactive network of multifunctional components that are integrated into the context of the cell in order to pace and reset the oscillator. We conclude with a discussion of how this basic timekeeping mechanism differs in other cyanobacterial species and how information gleaned from work in cyanobacteria can be translated to understanding rhythmic phenomena in other prokaryotic systems. PMID:26335718

Diversification of DnaA dependency for DNA replication in cyanobacterial evolution.

Science.gov (United States)

Ohbayashi, Ryudo; Watanabe, Satoru; Ehira, Shigeki; Kanesaki, Yu; Chibazakura, Taku; Yoshikawa, Hirofumi

2016-05-01

Regulating DNA replication is essential for all living cells. The DNA replication initiation factor DnaA is highly conserved in prokaryotes and is required for accurate initiation of chromosomal replication at oriC. DnaA-independent free-living bacteria have not been identified. The dnaA gene is absent in plastids and some symbiotic bacteria, although it is not known when or how DnaA-independent mechanisms were acquired. Here, we show that the degree of dependency of DNA replication on DnaA varies among cyanobacterial species. Deletion of the dnaA gene in Synechococcus elongatus PCC 7942 shifted DNA replication from oriC to a different site as a result of the integration of an episomal plasmid. Moreover, viability during the stationary phase was higher in dnaA disruptants than in wild-type cells. Deletion of dnaA did not affect DNA replication or cell growth in Synechocystis sp. PCC 6803 or Anabaena sp. PCC 7120, indicating that functional dependency on DnaA was already lost in some nonsymbiotic cyanobacterial lineages during diversification. Therefore, we proposed that cyanobacteria acquired DnaA-independent replication mechanisms before symbiosis and such an ancestral cyanobacterium was the sole primary endosymbiont to form a plastid precursor.

Discrete gene replication events drive coupling between the cell cycle and circadian clocks.

Science.gov (United States)

Paijmans, Joris; Bosman, Mark; Ten Wolde, Pieter Rein; Lubensky, David K

2016-04-12

Many organisms possess both a cell cycle to control DNA replication and a circadian clock to anticipate changes between day and night. In some cases, these two rhythmic systems are known to be coupled by specific, cross-regulatory interactions. Here, we use mathematical modeling to show that, additionally, the cell cycle generically influences circadian clocks in a nonspecific fashion: The regular, discrete jumps in gene-copy number arising from DNA replication during the cell cycle cause a periodic driving of the circadian clock, which can dramatically alter its behavior and impair its function. A clock built on negative transcriptional feedback either phase-locks to the cell cycle, so that the clock period tracks the cell division time, or exhibits erratic behavior. We argue that the cyanobacterium Synechococcus elongatus has evolved two features that protect its clock from such disturbances, both of which are needed to fully insulate it from the cell cycle and give it its observed robustness: a phosphorylation-based protein modification oscillator, together with its accompanying push-pull read-out circuit that responds primarily to the ratios of different phosphoform concentrations, makes the clock less susceptible to perturbations in protein synthesis; the presence of multiple, asynchronously replicating copies of the same chromosome diminishes the effect of replicating any single copy of a gene.

Avaliação da composição de invertebrados terrestres em uma área rural localizada no município de Campina Grande do Sul, Paraná, Brasil

Directory of Open Access Journals (Sweden)

Fernando Willyan Trevisan Leivas

2008-01-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2008v21n1p65 Os invertebrados terrestres que participam ativamente na formação do solo  podem ser utilizados como indicadores de perturbação ambiental. Assim, objetivou-se realizar uma avaliação da composição da fauna de invertebrados terrestres, em uma área rural, no município de Campina Grande do Sul. As coletas foram realizadas em um fragmento de Floresta com Araucária, com dois pontos amostrais estruturalmente diferenciados, através de armadilhas pitfall. Foram capturados 1776 invertebrados, pertencentes aos filos Arthropoda, Annelida, Mollusca e Plathyhelminthes, sendo Arthropoda e  Hexapoda os grupos mais representativos. Dentro dos Hexapoda, onze ordens foram registradas, destas, Coleoptera, Hymenoptera, Collembola e Diptera foram as mais abundantes. O fragmento estudado, embora esteja em recuperação há cerca de 10 anos após interferência antrópica de aproximadamente 40 anos e, todavia, ser rodeado de áreas utilizadas para agropecuária, agricultura e estradas, comporta diferentes grupos de invertebrados terrestres de níveis tróficos abrangentes, sendo importantes para a estrutura espacial e a composição da serrapilheira do fragmento.

DNA barcoding commercially important aquatic invertebrates of Turkey.

Science.gov (United States)

Keskin, Emre; Atar, Hasan Hüseyin

2013-08-01

DNA barcoding was used in order to identify aquatic invertebrates sampled from fisheries bycatch and discards. A total of 440 unique cytochrome c oxidase sub unit I (COI) barcodes were generated for 22 species from three important phyla (Arthropoda, Cnidaria, and Mollusca). All the species were sequenced and submitted to GenBank and Barcode of Life Database (BOLD) databases using 654 bp-long fragment of mitochondrial COI gene. Two of them (Pontastacus leptodactylus and Rapana bezoar) were first records of the species for the BOLD database and six of them (Carcinus aestuarii, Loligo vulgaris, Melicertus kerathurus, Nephrops norvegicus, Scyllarides latus, and Scyllarus arctus) were first standard (>648 bp) COI barcode records for the GenBank database. COI barcodes were analyzed for nucleotide composition, nucleotide pair frequencies, and Kimura's two-parameter genetic distance. Mean genetic distance among species was found increasing at higher taxonomic levels. Neighbor-joining trees generated were congruent with morphometric-based taxonomic classification. Findings of this study clearly demonstrate that DNA barcodes could be used as an efficient molecular tool in identification of not only target species from fisheries but also bycatch and discard species, and so it could provide us leverage for a better understanding in monitoring and management of fisheries and biodiversity.

Structure of gastropod communities at mangrove ecosystem in Lubuk Kertang village, West Berandan District, Langkat Regency, North Sumatera Province

Science.gov (United States)

Manullang, T.; Bakti, D.; Leidonald, R.

2018-02-01

Gastropod was one of the class from mollusca in mangrove ecosystem. Lubuk Kertang Village’s mangrove forest was been converted into tourist areas, agricultural land and settlements. The purpose of this study was to analyze the structure of gastropods at Avicennia lanata, Rhizophora apiculata and Sonneratia alba. This research was conducted at Lubuk Kertang Village in February-March 2017. Gastropod were collected in 1 m × 1 m transect in mangrove. Examples of biota were taken by using shovel, then the biota was inserted into a plastic bag sample, wrote date of sampling and identified. The results showed there were 15 species Gastropods, namely Achatina fulica, Cerithidea alata, Cerithidea cingulata, Cerithidea obtusa, Chicoreus capucinus, Cymatium pileare, Ellobium aurimisdae, Ellobium aurisjudae, Littoraria melanostoma, Littoraria scabra, Murex tribulus, Nerita balteata, Nerita planospira, Pugilina cochlidium, Stramonita gradata, Telescopium telescopium and Terebralia sulcata. Diversity index ranged 1.702 to 2.165 was in medium category, Similarity index ranged 0.676 to 0.799 was in low category and Dominance index ranged 0.142 to 0.282 that categorized was low. The highest gastropod density was 31 individuals/m2 in the Sonneratia alba. The conclusion of the research is the existing mangrove ecosystem in Lubuk Kertang Village in a stable state.

A study on the representative person of critical group for radiological assessment in Korea

International Nuclear Information System (INIS)

Lee, Gab-Bock; Lee, Doo-Ho; Yang, Yang-Hee; Jang, Young-Sik; Moon, Jong-Yi

2011-01-01

The 'maximum individual' concept based on US NRC Regulatory Guide 1.109 has been used for the public dose calculation in Korea. However, the 'maximum individual' results in largely overestimating the public dose. In Korea, the adoption of the 'representative person' is under consideration. The 'representative person' was recommended by ICRP Publication No. 101. In this study, individual habits (consumption of foodstuffs, use of local resources) of representative person have been analyzed or investigated. The age-specific food consumption rates of the representative person were derived from the Korean national dietary survey by government in 2005. The foodstuffs are classified into 12 classes - grain, fruits, kimchi, vegetables, milk, beef, pork, poultry, fishes, mollusca, crustacea, and seaweeds. The use of local resources such as the self-sufficiency of foodstuffs was investigated by using the questionnaire survey to the public members within 2 km from four nuclear power plant sites in Korea. The 95th percentile values are used for the top-two pathways such as grain and kimchi, but the average values are used for other foods. The results show that the effective dose from new habit data is about 30% lower than that from the existing data. (author)

Biodiversity assessment of benthic macroinvertebrates along a reservoir cascade in the lower São Francisco river (northeastern Brazil

Directory of Open Access Journals (Sweden)

M. Callisto

Full Text Available In order to verify the cascade-system effect in benthic macroinvertebrate communities, and the implications for policy making and proposals for conservation and sustainable use of the lower portion of São Francisco river basin (Bahia State, Brazil, a three-reservoir cascade system including two stretches downstream were studied during dry (June, 1997 and rainy (March, 1998 periods. The dominant groups found were Mollusca (Melanoides tuberculata, Oligochaeta, and Chironomidae larvae. Low Shannon-Wiener and Pielou index values were found, but with no significant difference between the sampling periods. However, density and taxonomic richness were significantly different (t(0.05; 31 = -2.1945; p < 0.05; e t(0.05; 31 = -3.0600; p < 0.01 between the sampling periods, with a reduction in the number of taxaand macroinvertebrate abundance during the rainy period. An increasing gradient in benthic macroinvertebrate community structures was noted along the reservoir cascade from the first reservoir (Apolônio Sales, followed by a decrease downstream from the third reservoir of the system (Xingó. Despite the negative consequences of rapid proliferation of dams, which have caused widespread loss of freshwater habitats, the reservoir cascade system promoted an increase in benthic macroinvertebrate diversity, due to water-quality improvement along the system.

Correlation study of some physico-chemical parameters and benthic macroinvertebrates metrics on the ecological impacts of flriculture industries along Wedecha River, Debrezeit, Ethiopia

Directory of Open Access Journals (Sweden)

Sisay Misganaw Tamiru

2017-10-01

Full Text Available Objective: To assess the quality of water using biological and chemical information correlation study. Methods: A total of 6 sites, one reference site less impaired to represent natural conditions from upstream, and 5 impaired sites in the downstream were sampled for macroinvertebrates and physicochemical parameters. Results: In the polluted sites with high nutrient enrichment and organic loading, only organisms with special physiological and morphological adaptations were found, such as Hydrobiidae, Physidae and Viviparidae snails. Physicochemical parameters: electrical conductivity, chemical oxygen demand, biological oxygen demand, sulphate, orthophosphate and nitrate-nitrogen and metrics: percent of Mollusca, percent of Physidae and percent of dominant taxa were used for monitoring, and expected to have strong positive relation with increasing disturbance. Conclusions: Therefore, floriculture industries wastewater discharged to the nearby rivers has enormous effect on the degradation of the ecosystem. To sustain the ecological conditions of the nearby rivers, wastewater treatment and environmental audit were suggested. Environmental assessment and environmental audit enable the floriculturist to keep humans and the environment safe. Taking care of workers, soil, water and the environment has to be seen with great care and caution because it is difficult to maintain a healthy community and carry out development in a degraded environment.

Dynamic energy budget as a basis to model population-level effects of zinc-spiked sediments in the gastropod Valvata piscinalis.

Science.gov (United States)

Ducrot, Virginie; Péry, Alexandre R R; Mons, Raphaël; Quéau, Hervé; Charles, Sandrine; Garric, Jeanne

2007-08-01

This paper presents original toxicity test designs and mathematical models that may be used to assess the deleterious effects of toxicants on Valvata piscinalis (Mollusca, Gastropoda). Results obtained for zinc, used as a reference toxicant, are presented. The feeding behavior, juvenile survival, growth, age at puberty, onset of reproduction, number of breedings during the life cycle, and fecundity were significantly altered when the snails were exposed to zinc-spiked sediments. Dynamic energy budget models (DEBtox) adequately predicted the effects of zinc on the V. piscinalis life cycle. They also provided estimates for lifecycle parameters that were used to parameterize a demographic model, based on a Z-transformed life-cycle graph. The effect threshold for the population growth rate (lambda) was estimated at 259 mg/kg dry sediment of zinc, showing that significant changes in abundance may occur at environmental concentrations. Significant effects occurring just above this threshold value were mainly caused by the severe impairment of reproductive endpoints. Sensitivity analysis showed that the value of lambda depended mainly on the juvenile survival rate. The impairment of this latter parameter may result in extinction of V. piscinalis. Finally, the present study highlights advantages of the proposed modeling approach in V. piscinalis and possible transfer to other test species and contaminants.

Comparative molecular analysis of evolutionarily distant glyceraldehyde-3-phosphate dehydrogenase from Sardina pilchardus and Octopus vulgaris.

Science.gov (United States)

Baibai, Tarik; Oukhattar, Laila; Mountassif, Driss; Assobhei, Omar; Serrano, Aurelio; Soukri, Abdelaziz

2010-12-01

The NAD(+)-dependent cytosolic glyceraldehyde-3-phosphate dehydrogenase (GAPDH, EC 1.2.1.12), which is recognized as a key to central carbon metabolism in glycolysis and gluconeogenesis and as an important allozymic polymorphic biomarker, was purified from muscles of two marine species: the skeletal muscle of Sardina pilchardus Walbaum (Teleost, Clupeida) and the incompressible arm muscle of Octopus vulgaris (Mollusca, Cephalopoda). Comparative biochemical studies have revealed that they differ in their subunit molecular masses and in pI values. Partial cDNA sequences corresponding to an internal region of the GapC genes from Sardina and Octopus were obtained by polymerase chain reaction using degenerate primers designed from highly conserved protein motifs. Alignments of the deduced amino acid sequences were used to establish the 3D structures of the active site of two enzymes as well as the phylogenetic relationships of the sardine and octopus enzymes. These two enzymes are the first two GAPDHs characterized so far from teleost fish and cephalopod, respectively. Interestingly, phylogenetic analyses indicated that the sardina GAPDH is in a cluster with the archetypical enzymes from other vertebrates, while the octopus GAPDH comes together with other molluscan sequences in a distant basal assembly closer to bacterial and fungal orthologs, thus suggesting their different evolutionary scenarios.

Seasonal variation in biomarker responses of Donax trunculus from the Gulf of Annaba (Algeria): Implication of metal accumulation in sediments

Science.gov (United States)

Amira, Akila; Merad, Isma; Almeida, C. Marisa R.; Guimarães, Laura; Soltani, Nourredine

2018-05-01

The aim of the present study was to test biomarker responses in an edible mollusk, Donax trunculus L. (Mollusca, Bivalvia) associated with environmental pollution in the Gulf of Annaba (northeastern Algeria). The biomarkers selected were glutathione S-transferase (GST), acetylcholinesterase (AChE) and metallothioneins (MTs). Samples were collected seasonally (September 2014, and January, April and July 2015) from two sites located over the Gulf of Annaba: El Battah and Sidi Salem. The results obtained reveal that autumn and winter were the two seasons that show an increase in GST activity, an inhibition of AChE activity and a high rate of MT. In addition, a decrease in AChE activity, an increase in both GST activity and MT levels in D. Trunculus collected from Sidi Salem in comparison with those of El Battah were observed. The biomarker responses at the Sidi Salem site reflect the presence of certain pro-oxidative compounds such as metals (Cd, Cu, Pb, Zn, Mn and Fe) determined in sediments in winter (January) 2015. Moreover, metal concentrations, except Fe, were higher at Sidi Salem than at El Battah. Overall, the Gulf of Annaba remains contaminated by heavy metal. However, this metallic contamination is relatively low and the risks for local population via this edible species were also low.

Sterol patterns of cultured zooxanthellae isolated from marine invertebrates: Synthesis of gorgosterol and 23-desmethylgorgosterol by aposymbiotic algae.

Science.gov (United States)

Withers, N W; Kokke, W C; Fenical, W; Djerassi, C

1982-06-01

QUANTITATIVE STEROL COMPOSITIONS OF CULTURED ZOOXANTHELLAE ISOLATED FROM VARIOUS PACIFIC AND ATLANTIC INVERTEBRATE HOSTS: Zoanthus sociatus (a zoanthid), Oculina diffusa (a scleractian coral), Tridacna gigas (a giant clam), Melibe pilosa (a nudibranch), and Aiptasia pulchella (a sea anemone) are reported. The results clearly demonstrate large differences in sterol patterns of zooxanthellae and that there is no obvious relationship between the taxonomic affiliation of the host and the sterol pattern of its isolated symbiont. The sterols of the zooxanthellae of O. diffusa (Cnidaria) and T. gigas (Mollusca) are qualitatively equivalent. Based on the structures of the two major free sterols synthesized by each alga, the zooxanthellae from different hosts were separated into three distinct groups. It was also found that an aposymbiotic alga can synthesize the unique marine sterols gorgosterol and 23-desmethylgorgosterol. Most of the sterols were identified by using mass spectroscopy and 360-MHz proton magnetic resonance. Spectroscopic data are reported for four novel sterols-(23,24R)-dimethyl-5alpha-cholest-(22E)-en-3beta-o l, 23-methyl-5alpha-cholest-22E-en-3beta-ol, cholesta-5,14-dien-3beta-ol, and 4alpha-methyl-5alpha-cholesta-8(14)-24-dien-3beta-ol.

ANALISIS KUALITAS PERAIRAN SUNGAI RAMAN DESA PUJODADI TRIMURJO SEBAGAI SUMBER BELAJAR BIOLOGI SMA PADA MATERI EKOSISTEM

Directory of Open Access Journals (Sweden)

Agus Sutanto

2015-06-01

Full Text Available River is one of fresh water ecosystem which is very important in human life since it is the most practical and economical source in fulfilling domestic and industrial needs. Therefore, it should meet the quality standards. The research objectives were: 1 knowing the quality of waterway in Raman River, Pujodadi, Trimurjo, based on the physical, chemical and biological aspects; 2 turning the information intoa Biology learning source on Ecosystem subject. The data were directly observed in the river by measuring the physical factors (temperature, stream, turbidity; chemical factors (pH, DO; and biological factor (macro invertebrates. The results were: temperature 24-29oC ; stream 0.3 – 0.6 mm/s; turbidity 33.5-3.7 NTU; pH 4.1-5.2; and DO 2.07-2.35 ml/I. Furthermore, micro vertebrates found were; a Plecoptra; b Tricoptra; c Mollusca, d Ephemeroptra; and e Hemiptra. In each station, they were classified as insects and non-insects. The insects found were: 1 Odonata; 2 Tricoptra; 3 Ephemeroptra; 4 Plecoptra. Based on those parameters, the waterway quality was qualified as light wasted. The results can be turned into student worksheet as a Biology learning source, especially on Ecosystem subject.

Molecular taxonomy of cupped oysters (Crassostrea, Saccostrea, and Striostrea) in Thailand based on COI, 16S, and 18S rDNA polymorphism.

Science.gov (United States)

Klinbunga, S; Khamnamtong, B; Puanglarp, N; Jarayabhand, P; Yoosukh, W; Menasveta, P

2005-01-01

Genetic diversity of oysters Crassostrea belcheri (Sowerby, 1871), C. iredalei (Faustino, 1932), Saccostrea cucullata (Born, 1778), S. forskali (Gmelin, 1791), and Striostrea (Parastriostrea) mytiloides (Lamarck, 1819) (Ostreoida, Mollusca) was analyzed by polymerase chain reaction - restriction fragment length polymorphism (PCR-RFLP) of 16S ribosomal DNA with AcsI, AluI, DdeI, DraI, RsaI, and TaqI, 18S ribosomal DNA with HinfI, and cytochrome oxidase subunit I with AcsI, DdeI and MboI. A total of 54 composite haplotypes were observed. Species-diagnostic markers were specifically found in C. belcheri, C. iredalei, and S. cucullata, but not in S. forskali and Striostrea mytiloides, which shared common composite haplotypes. Neighbor-joining trees constructed from genetic distances between pairs of composite haplotypes and species indicated large genetic differences between Crassostrea and Saccostrea (including Striostrea mytiloides), but closer relationships were observed within each genus. Four groups of unidentified oysters (Crassostrea sp. and Saccostrea sp. groups 1, 2, and 3) were also genetically analyzed. Fixed RFLP markers were found in Crassostrea sp. and Saccostrea sp. group 2, but not in Saccostrea sp. groups 1 and 3. Phylogenetic and genetic heterogeneity analyses indicated that Crassostrea sp. and Saccostrea sp. group 2 should be considered as newly unidentified oyster species in Thailand.

Diversidade e distribuição do gênero Alvania (Mollusca, Gastropoda: Rissoidae) no litoral brasileiro

OpenAIRE

SILVA, Luciana Soares da

2012-01-01

Os Rissoidae Gray, 1847 são compostos por conchas pequenas ou micro-conchas, abundantes nos mares de todo mundo. Uma grande diversidade das espécies desse grupo é encontrada nas zonas de maré baixa e ao longo do litoral, onde há a maior ocorrência de algas, rochas, corais e outros locais que fornecem abrigo, todavia muitos ocorrem também em zonas de mar profundo. Em Rissoidae, Alvania é um dos mais diversos quanto ao número de espécies, sendo frequentes as descrições ou re-descrições de...

The first observations of Ischnochiton (Mollusca, Polyplacophora movement behaviour, with comparison between habitats differing in complexity

Directory of Open Access Journals (Sweden)

Kiran Liversage

2017-12-01

Full Text Available Most species of Ischnochiton are habitat specialists and are almost always found underneath unstable marine hard-substrata such as boulders. The difficulty of experimenting on these chitons without causing disturbance means little is known about their ecology despite their importance as a group that often contributes greatly to coastal species diversity. In the present study we measured among-boulder distributional patterns of Ischnochiton smaragdinus, and used time-lapse photography to quantify movement behaviours within different habitat types (pebble substrata and rock-platform. In intertidal rock-pools in South Australia, I. smaragdinus were significantly overdispersed among boulders, as most boulders had few individuals but a small proportion harboured large populations. I. smaragdinus individuals emerge from underneath boulders during nocturnal low-tides and move amongst the inter-boulder matrix (pebbles or rock-platform. Seventy-two percent of chitons in the pebble matrix did not move from one pebble to another within the periods of observation (55–130 min but a small proportion moved across as many as five pebbles per hour, indicating a capacity for adults to migrate among disconnected habitat patches. Chitons moved faster and movement paths were less tortuous across rock-platform compared to pebble substrata, which included more discontinuities among substratum patches. Overall, we show that patterns of distribution at the boulder-scale, such as the observed overdispersion, must be set largely by active dispersal of adults across the substratum, and that differing substratum-types may affect the degree of adult dispersal for this and possibly other under-boulder chiton species.

Diversity and biogeography of land snails (Mollusca, Gastropoda) in the limestone hills of Perak, Peninsular Malaysia

Science.gov (United States)

Foon, Junn Kitt; Clements, Gopalasamy Reuben; Liew, Thor-Seng

2017-01-01

Abstract Limestone hills are now gaining global conservation attention as hotspots for short-range endemic species. Levels of land snail endemism can be high at limestone hills, especially at hill clusters that are geographically isolated. In the State of Perak, Peninsular Malaysia, limestone hills have been opportunistically surveyed for land snails in the past, but the majority have yet to be surveyed. To address this knowledge gap, we systematically surveyed the terrestrial malacofauna of 12 limestone hills that, based on our opinion, are a representation of the limestone land snail assemblages within the State. Our inventory yielded high sampling completeness (>85%). We found 122 species of land snails, of which 34 species were unique to one of the surveyed hills. We identified 30 species that are potentially new to science. The number of land snail species recorded at each hill ranged between 39 and 63 species. Four of the sampled limestone hills namely, Prk 01 G. Tempurung, Prk 55 G. Pondok, Prk 47 Kanthan, and Prk 64 Bt Kepala Gajah, have high levels of species richness and unique species, representing 91% of the total species recorded in this study. We identified two clusters of limestone hills in central Perak with distinct differences in land snail species composition – a northern hill cluster on elevated granite bedrock and southern hill cluster in a low-lying valley surrounded by alluvial soils. As limestone hills continue to be quarried to meet the cement demand, the four identified limestone hills, along with other hills from the two clusters, warrant urgent conservation attention in order to maintain high species diversity within Perak’s terrestrial malacofauna. PMID:28769723

THE BIOLOGY OF FISSURELLA MAXIMA SOWERBY (MOLLUSCA: ARCHAEOGASTROPODA) IN NORTHERN CHILE. 2. NOTES ON ITS REPRODUCTION.

Science.gov (United States)

Bretos, Marta; Tesorieri, Italo; Alvarez, Luis

1983-12-01

For 14 months, monthly samples were collected to study reproduction in Fissurella maxima at Huayquique. Results indicate that F. maxima is a dioecious species; no sign of hermaphroditism has been observed. The sex ratio is 1:1 in the different size classes analyzed. Ovaries are green and testis are median brown to yellowish white. Eggs in the ovary measure from 120-280 µ without envelopes. The gonads are parasitized by adult digenea trematods of the genus Proctoeces. Some effects of parasitism are discussed. Variations in mean monthly gonadosomatic index suggest that there is a main spawning period in late November-December (late spring-early summer) and a secondary period in July-August (winter). Fluctuations in mean gonad index show a close correlation with sea water temperature variations. The youngest mature specimens detected were about 5 cm in shell length (over two years old), but the majority of mature animals were over 6.5 cm.

High accumulation of cobalt-60 by the particular organ or part of some species in mollusca

International Nuclear Information System (INIS)

Yoshida, Katsuhiko

1981-01-01

A large amounts of samples in marine Cephalopoda and Tridacna were sampled in north west pacific ocean, near Japan. The samples were separated into organs or parts for determination of Co-60 concentration. A peculiar accumulation of Co-60 by the branchial heart of Octopus was also recognized in field condition, but it had become apparent that branchial heart of squid had not same ability. Liver of Cephalopoda had the ability to highly accumulate the Co-60 and specific activity of squid was one order highter than Octopus. The concentration of Cobalt-60 in visceral muss kidney of Tridacna maxima lineally increased with increasing shell length but that in other soft parts was kept constant. After examination of the other papers it was assumed that Co-60 highly accumulated in these organs was transfered by the food chain. (author)

Genetics and shell morphometrics of assimineids (Mollusca, Caenogastropoda, Truncatelloidea) in the St Lucia Estuary, South Africa.

Science.gov (United States)

Miranda, Nelson A F; van Rooyen, Ryan; MacDonald, Angus; Ponder, Winston; Perissinotto, Renzo

2014-01-01

The Assimineidae are a family of amphibious microgastropods that can be mostly found in estuaries and mangroves in South Africa. These snails often occur in great numbers and are ecologically important to the St Lucia Estuary, which forms a crucial part of the iSimangaliso Wetland Park, a UNESCO World Heritage Site. Genetic and shell morphometric analyses were conducted on individuals collected from nine localities distributed from the northern lake regions to the southern lake and the mouth of the St Lucia estuarine lake. Mitochondrial (COI) and nuclear (28S) DNA was used to construct Bayesian Inference, Neighbour-joining, Maximum Parsimony and Maximum Likelihood trees. Principal Component Analysis and Cluster Analysis were performed on standard shell parameter data. Results indicate that two different taxa are present in St Lucia. The taxon comprising individuals from the South Lake and St Lucia Estuary Mouth is identified as Assiminea cf. capensis Bartsch, in accordance with the latest taxonomic consensus. The taxon comprising assimineid individuals from False Bay, North Lake and South Lake, is here tentatively named "Assiminea" aff. capensis (Sowerby). These two taxa exhibit patterns of spatial overlap that appear to vary depending on environmental parameters, particularly salinity. The need to resolve the complex taxonomy of assimineids is highlighted.

Deep-water Mangeliinae, Taraninae and Clathurellinae (Mollusca: Gastropoda: Conoidea: Turridae from the Campos Basin, southeast Brazil

Directory of Open Access Journals (Sweden)

Raquel Medeiros Andrade Figueira

2010-11-01

Full Text Available During the program “Environmental Characterization of the Campos Basin, RJ, Brazil”, from 2001 to 2003, samples were taken of soft bottoms from the continental slope of Campos Basin (off southeast Brazil by the Research Vessel “Astro-Garoupa” with a 0.25 m2 box corer or by dredging with a Charcot dredge; 117 stations with depths from 700 to 1950 m were sampled. There were molluscs in all samples, and among Gastropoda the Turridae showed the highest diversity. Here we present the results obtained for the subfamilies Mangeliinae, Taraninae and Clathurellinae. Two species were found within Mangeliinae: Benthomangelia cf. macra (Watson, 1881 and Benthomangelia enceladus n. sp. Within Taraninae only one undescribed species was found: Taranis tanata n. sp. Within Clathurellinae we found four species: Corinnaeturris leucomata (Dall, 1881, recorded for the first time in the South Atlantic; Corinnaeturris rhysa (Watson, 1881, extending its described depth range; Corinnaeturris angularis n. sp., Typhlomangelia nivalis (Lovén, 1846, expanding its known distribution farther south; and Drilliola pulchella (Verrill, 1880. The type material of Drilliola loprestiana (Calcara, 1841, previously considered lost, has been located and is illustrated here. Drilliola crispata (Cristofori and Jan, 1832 is considered to be a nomen dubium.

Nonhemocyte sources of selected lysosomal enzymes in Biomphalaria glabrata, B. tenagophila and B. straminea (Mollusca: Pulmonata

Directory of Open Access Journals (Sweden)

Gary E. Rodrick

1981-09-01

Full Text Available The specific activities of acid phosphatase, alkaline phosphatase, β-glucuronidase, lysozymes, glutamate-oxalacetate transaminase and glutamate-pyruvate transaminate were determined in the head-foot and digestive gland of Brazilian Biomphalaria glabrata (Touros, B. tenagophila (Caçapava and B. straminea (Monsenhor Gil. All six enzymes were detected inthe 3000g supernatant. Both cytoplasmic enzymes, glutamate-oxalacetate and glutamate-pyruvate transaminase exhibited the highest specific activities. In the case of the four hydrolytic enzymes assayed, β-glucuronidase exhibited the highest specific activity while lysozyme showed the lowest activity. All six enzymes are thought to be produced by cells within the head-foot and digestive gland of B. glabrata, B. tenagophila and B. straminea.Foram determinadas, na massa cefalopedal e na glândula digestiva de Biomphalaria glabrata de Touros (Rio Grande do Norte B. tenagophila de Cacapava (Sao Paulo e B. straminea de Monsenhor Gil (Piauí, as atividades específicas das seguintes enzimas: fosfatase acida, fosfatase alcalina, beta-glucuronidase, lisozima, transaminase glutâmico-oxalacetica e transaminase glutâmico-piruvica. As seis enzimas referidas foram detectadas no sobrenadante a 3000g. Ambas as enzimas citoplasmaticas - transaminases glutamico-oxalacetica e glutamico-piruvica - mostraram as atividades específicas mais altas. No caso das quatro enzimas hidrolíticas, a beta-glucuronidase revelou a mais alta atividade específica, enquanto a lisozima revelou a mais baixa. E admitido que todas as seis enzimas sao produzidas por celulas presentes na massa cefalopedal e na glândula digestiva das tres especies de moluscos examinadas.

Effect of temperature on growth, mortality, reproduction, and production of adult Lymnaea obrussa Say (Mollusca:Gastropoda)

International Nuclear Information System (INIS)

Mattice, J.S.

1975-01-01

Shell lengths and egg production were measured weekly under constant (K; 10, 15, 20, 25 0 C) and varying temperature regimes during the reproductive period. Varying regimes included natural field temperature in a pond (F; diurnal and seasonal), mean daily field temperature (anti F; seasonal) and 5 and 10 0 C above anti F. Growth rate of large snails (>10 mm) was unaffected by temperature, but small snails (6 to 10 mm) grew fastest at 15 0 C(K). Growth and reproductive periods were longest, production was highest, and mortality rate was lowest at 15 0 C(K). Rate (per snail) of egg production increased with temperature. At equal mean temperature, regime affected growth rate only at anti F. Regime affected the following values as shown: mortality rate,F > anti F = K; rate of reproduction, F > K > anti F; and total production, K > anti F = F. The validity of extrapolation of energetic data from laboratory to field is discussed. Data relating production and temperature are valuable in thermal impact analysis. (U.S.)

A molecular method to detect and identify the native species of southwestern Atlantic Crassostrea (Mollusca: Ostreidae

Directory of Open Access Journals (Sweden)

Sandra Ludwig

2011-08-01

Full Text Available Among oysters, species of Crassostrea (Sacco, 1897 are the most attractive to aquaculture. In Brazil, the genus is represented by C. rhizophorae (Guilding, 1828 and C. brasiliana (Lamarck, 1819. Because the maturation and breeding technology is not well developed for these species, aquaculturists need a reliable method to decide the correct time to place spat collectors in the field, and to identify both species, which are morphologically similar. In this study a specific Multiplex PCR protocol was developed, using one pair of universal primers from 18S rDNA as a positive control and a pair of specific primers for each target species. The sensitivity and specificity of the protocol was evaluated. It detected C. rhizophorae DNA in low concentrations, and C. brasiliana DNA in even lower concentrations. Further, the Multiplex PCR proved efficient in detecting DNA in concentrations equivalent to that of a single larva of each species, either separated or combined, when mixed with total DNA extract of a plankton sample representing 1000 L of filtered water. Field tests confirmed the applicability of the protocol, which holds the promise to become an important tool for aquaculture or conservation programs, allowing for the continuous monitoring of the life cycle of C. brasiliana and C. rhizophorae, by detecting the right periods of larval release and settlement.

Effekte von Xenohormonen auf die limnischen Invertebraten Gammarus fossarum (Crustacea, Amphipoda) und Marisa cornuarietis (Mollusca, Prosobranchia)

OpenAIRE

Schirling, Martin

2005-01-01

In dieser Arbeit werden Effekte von Xenohormonen auf Gammarus fossarum und Marisa cornuarietis anhand verschiedener Parameter, auf unterschiedlichen biologischen Ebenen dargestellt. In einem Laborexperiment mit G. fossarum, das Grundlage für weitere Untersuchungen im Rahmen dieser Arbeit war, konnte gezeigt werden, dass sich die Stressproteine hsp90 und hsp70 im Laufe der Oocytenreifung gegenläufig verhalten. Sowohl in einem Freilandversuch, bei dem der Einfluss von Kläranlageneinleitern ...

Unveiling the oxidative metabolism of Achatina fulica (Mollusca: Gastropoda) experimentally infected to Angiostrongylus cantonensis (Nematoda: Metastrongylidae).

Science.gov (United States)

Tunholi-Alves, Vinícius Menezes; Tunholi, Victor Menezes; Garcia, Juberlan; Mota, Esther Maria; Castro, Rosane Nora; Pontes, Emerson Guedes; Pinheiro, Jairo

2018-06-01

For the first time, alterations in the oxidative metabolism of Achatina fulica experimentally infected with different parasite loads of Angiostrongylus cantonensis were determined. For this, the hemolymph activities of lactate dehydrogenase (LDH) and hexokinase and the glucose concentrations in the hemolymph, as well as the polysaccharide reserves in the digestive gland and cephalopedal mass, were assessed. Additionally, the contents of some carboxylic acids in the hemolymph of infected and uninfected snails were determined by high-performance liquid chromatography (HPLC), permitting a better understanding of the alterations related to the host's oxidative metabolism. As the main results, activation of oxidative pathways, such as the glycolytic pathway, was demonstrated in response to the increase in the activity of hexokinase. This tendency was confirmed by the decrease in the contents of glucose in the hemolymph of parasitized snails, indicating that the infection by A. cantonensis alters the host's metabolism, and that these changes are strongly influenced by the parasite load. This metabolic scenario was accompanied by activation of the anaerobic fermentative metabolism, indicated not only by an increase in the activity of (LDH), but also by a reduction of the content of pyruvic acid and accumulation of lactic acid in the hemolymph of parasitized snails. In this circumstance, maintenance of the host's redox balance occurs through activation of the fermentative pathways, and LDH plays a central role in this process. Together, the results indicate that A. cantonensis infection induces activation of the anaerobic metabolism of A. fulica, characterized not only by the accumulation of lactic acid, but also by a reduction in the pyruvic acid and oxalic acid contents in the hemolymph of the infected snails.

Cutaneous application of an accessory-gland secretion after sperm exchange in a terrestrial slug (Mollusca : Pulmonata)

NARCIS (Netherlands)

Benke, Mandy; Reise, Heike; Montagne-Wajer, Kora; Koene, Joris M

Competition for fertilisation in hermaphroditic animals seems to have led to many odd behaviours and complex morphologies involved in the transfer of accessory-gland products to the partner. Terrestrial slugs of the genus Deroceras show remarkably elaborate and interspecifically diverse penis

Desarrollo morfológico e histológico del sistema reproductor de Pomacea patula catemacensis (Baker 1922 (Mollusca, Caenogastropoda: Ampullariidae Morphological and histological development of the reproductive system of Pomacea patula catemacensis (Baker 1922 (Mollusca, Caenogastropoda: Ampullariidae

Directory of Open Access Journals (Sweden)

AURA CARREÓN-PALAU

2003-12-01

Full Text Available El "tegogolo" Pomacea patula catemacensis es un gasterópodo dulceacuícola comestible, endémico del Lago de Catemaco en Veracruz, México. En los últimos años las poblaciones naturales se han visto diezmadas debido a que su captura se realiza sin control, a lo que se suma el alto grado de deterioro ambiental que presenta el lago, producto del "azolvamiento", así como por la contaminación por plaguicidas y detergentes. El objetivo del presente estudio fue caracterizar histológica y morfológicamente el sistema reproductor de P. patula catemacensis y determinar las etapas de madurez gonádica en condiciones de laboratorio. Se determinó que la maduración depende de la talla y no de la edad de los organismos, y se identificaron cuatro etapas principales en el desarrollo de machos y hembras: Los estadios y sus longitudes promedio ± intervalo de confianza del 95 % son (1 inmadura o indiferenciada (talla de 0,72 a 7 mm, (2 maduración temprana (18,95 ± 1,96 mm, (3 maduración intermedia (29,29 ± 4,9 mm y (4 madurez total (35,89 ± 3,92 mm. En este molusco los sexos están separados, la fertilización es interna y el desarrollo es ovovivíparo. En las hembras la secreción de albúmina y de carbonato de calcio se realiza en la glándula de la albúmina, característica en la que difiere de otras especies como P. paludosa y P. canaliculata, las cuales poseen además glándula de la cápsula. Es posible identificar el grado de madurez de los caracoles utilizando criterios anatómicos visuales, como la glándula de la albúmina, en el caso de la hembra, y el órgano copulador en el machoThe "apple snail" Pomacea patula catemacensis is an edible freshwater mollusc, endemic to the Catemaco Lake in Veracruz, Mexico. During the past few years, the natural populations of this species have been depleted mainly by uncontrolled fishery, and because of environmental degradation and pollution by pesticides and detergents. In the present study, we carried out the histological and morphological characterization of the reproductive system of P. patula catemacensis under laboratory conditions. We found that the reproductive development of this snail depended more on the size than on the age the animals, and identified four development main stages, both for males and females. The main stages and their mean lengths ± confidence interval at P < 0.05 were (1 immature or not differenced (from 0.72 to 7 mm, (2 early maturation (from 18.95 ± 1.96 mm, (3 intermediate maturation (from 29.29 ± 4.9 mm, and (4 full maturity (from 35.89 ± 3.92 mm. This species is ovoviviparous, both sexes are separated, and fertilization is internal. Albumin and calcium carbonate secretion in females are performed through the albumin gland, a trait that distinguishes this species from others, such as P. paludosa and P. canaliculata. The stage of development can be identified by means of using anatomical traits, such as the albumin gland (in the case of females, or the intromittent organ (in males

Desarrollo morfológico e histológico del sistema reproductor de Pomacea patula catemacensis (Baker 1922) (Mollusca, Caenogastropoda: Ampullariidae) Morphological and histological development of the reproductive system of Pomacea patula catemacensis (Baker 1922) (Mollusca, Caenogastropoda: Ampullariidae)

OpenAIRE

AURA CARREÓN-PALAU; ESTHER URIA-GALICIA; FÉLIX ESPINOSA-CHÁVEZ; FERNANDO MARTÍNEZ-JERÓNIMO

2003-01-01

El "tegogolo" Pomacea patula catemacensis es un gasterópodo dulceacuícola comestible, endémico del Lago de Catemaco en Veracruz, México. En los últimos años las poblaciones naturales se han visto diezmadas debido a que su captura se realiza sin control, a lo que se suma el alto grado de deterioro ambiental que presenta el lago, producto del "azolvamiento", así como por la contaminación por plaguicidas y detergentes. El objetivo del presente estudio fue caracterizar histológica y morfológicame...

Potentiality of Achatina fulica Bowdich, 1822 (Mollusca: Gastropoda) as intermediate host of the Angiostrongylus costaricensis Morera & Céspedes 1971 Achatina fulica Bowdich, 1822 (Mollusca: Gastropoda) como hospedeiro intermediário potencial do Angiostrongylus costaricensis Morera & Céspedes 1971

OpenAIRE

Omar dos Santos Carvalho; Horácio MS Teles; Ester Maria Mota; Cristiane Lafetá Gomes Furtado de Mendonça; Henrique Leonel Lenzi

2003-01-01

Samples of Achatina fulica were experimentally infected with Angiostrongylus costaricensis larvae, etiological agent of abdominal angiostrongyliasis, showing that A. fulica is susceptible to the parasite. Achatina fulica may be a risk to urbanization of abdominal angiostrongyliasis presumably due to its high proliferation, continuous dispersion and remarkable adaptation in several Brazilian towns.Exemplares de Achatina fulica foram experimentalmente infectados com larvas de Angiostrongylus co...

Homology modeling of Homo sapiens lipoic acid synthase: Substrate docking and insights on its binding mode.

Science.gov (United States)

Krishnamoorthy, Ezhilarasi; Hassan, Sameer; Hanna, Luke Elizabeth; Padmalayam, Indira; Rajaram, Rama; Viswanathan, Vijay

2017-05-07

Lipoic acid synthase (LIAS) is an iron-sulfur cluster mitochondrial enzyme which catalyzes the final step in the de novo pathway for the biosynthesis of lipoic acid, a potent antioxidant. Recently there has been significant interest in its role in metabolic diseases and its deficiency in LIAS expression has been linked to conditions such as diabetes, atherosclerosis and neonatal-onset epilepsy, suggesting a strong inverse correlation between LIAS reduction and disease status. In this study we use a bioinformatics approach to predict its structure, which would be helpful to understanding its role. A homology model for LIAS protein was generated using X-ray crystallographic structure of Thermosynechococcus elongatus BP-1 (PDB ID: 4U0P). The predicted structure has 93% of the residues in the most favour region of Ramachandran plot. The active site of LIAS protein was mapped and docked with S-Adenosyl Methionine (SAM) using GOLD software. The LIAS-SAM complex was further refined using molecular dynamics simulation within the subsite 1 and subsite 3 of the active site. To the best of our knowledge, this is the first study to report a reliable homology model of LIAS protein. This study will facilitate a better understanding mode of action of the enzyme-substrate complex for future studies in designing drugs that can target LIAS protein. Copyright © 2017 Elsevier Ltd. All rights reserved.

An allele of the crm gene blocks cyanobacterial circadian rhythms.

Science.gov (United States)

Boyd, Joseph S; Bordowitz, Juliana R; Bree, Anna C; Golden, Susan S

2013-08-20

The SasA-RpaA two-component system constitutes a key output pathway of the cyanobacterial Kai circadian oscillator. To date, rhythm of phycobilisome associated (rpaA) is the only gene other than kaiA, kaiB, and kaiC, which encode the oscillator itself, whose mutation causes completely arrhythmic gene expression. Here we report a unique transposon insertion allele in a small ORF located immediately upstream of rpaA in Synechococcus elongatus PCC 7942 termed crm (for circadian rhythmicity modulator), which results in arrhythmic promoter activity but does not affect steady-state levels of RpaA. The crm ORF complements the defect when expressed in trans, but only if it can be translated, suggesting that crm encodes a small protein. The crm1 insertion allele phenotypes are distinct from those of an rpaA null; crm1 mutants are able to grow in a light:dark cycle and have no detectable oscillations of KaiC phosphorylation, whereas low-amplitude KaiC phosphorylation rhythms persist in the absence of RpaA. Levels of phosphorylated RpaA in vivo measured over time are significantly altered compared with WT in the crm1 mutant as well as in the absence of KaiC. Taken together, these results are consistent with the hypothesis that the Crm polypeptide modulates a circadian-specific activity of RpaA.

Transgenic tobacco plants with improved cyanobacterial Rubisco expression but no extra assembly factors grow at near wild-type rates if provided with elevated CO2.

Science.gov (United States)

Occhialini, Alessandro; Lin, Myat T; Andralojc, P John; Hanson, Maureen R; Parry, Martin A J

2016-01-01

Introducing a carbon-concentrating mechanism and a faster Rubisco enzyme from cyanobacteria into higher plant chloroplasts may improve photosynthetic performance by increasing the rate of CO2 fixation while decreasing losses caused by photorespiration. We previously demonstrated that tobacco plants grow photoautotrophically using Rubisco from Synechococcus elongatus, although the plants exhibited considerably slower growth than wild-type and required supplementary CO2 . Because of concerns that vascular plant assembly factors may not be adequate for assembly of a cyanobacterial Rubisco, prior transgenic plants included the cyanobacterial chaperone RbcX or the carboxysomal protein CcmM35. Here we show that neither RbcX nor CcmM35 is needed for assembly of active cyanobacterial Rubisco. Furthermore, by altering the gene regulatory sequences on the Rubisco transgenes, cyanobacterial Rubisco expression was enhanced and the transgenic plants grew at near wild-type growth rates, although still requiring elevated CO2 . We performed detailed kinetic characterization of the enzymes produced with and without the RbcX and CcmM35 cyanobacterial proteins. These transgenic plants exhibit photosynthetic characteristics that confirm the predicted benefits of introduction of non-native forms of Rubisco with higher carboxylation rate constants in vascular plants and the potential nitrogen-use efficiency that may be achieved provided that adequate CO2 is available near the enzyme. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

PSII as an in vivo molecular catalyst for the production of energy rich hydroquinones - A new approach in renewable energy.

Science.gov (United States)

Das, Sai; Maiti, Soumen K

2018-03-01

One of the pertinent issues in the field of energy science today is the quest for an abundant source of hydrogen or hydrogen equivalents. In this study, phenyl-p-benzoquinone (pPBQ) has been used to generate a molecular store of hydrogen equivalents (phenyl-p-hydroquinone; pPBQH 2 ) from thein vivo splitting of water by photosystem II of the marine cyanobacterium Synechococcus elongatus BDU 70542. Using this technique, 10.8 μmol of pPBQH 2 per mg chlorophyll a can be extracted per minute, an efficiency that is orders of magnitude higher when compared to the techniques present in the current literature. Moreover, the photo-reduction process was stable when tested over longer periods of time. Addition of phenyl-p-benzoquinone on an intermittent basis resulted in the precipitation of phenyl-p-hydroquinone, obviating the need for costly downstream processing units for product recovery. Phenyl-p-hydroquinone so obtained is a molecular store of free energy preserved through the light driven photolysis of water and can be used as a cheap and a renewable source of hydrogen equivalents by employing transition metal catalysts or fuel cells with the concomitant regeneration of phenyl-p-benzoquinone. The cyclic nature of this technique makes it an ideal candidate to be utilized in mankind's transition from fossil fuels to solar fuels. Copyright © 2018 Elsevier B.V. All rights reserved.

Species-specific roles of sulfolipid metabolism in acclimation of photosynthetic microbes to sulfur-starvation stress.

Directory of Open Access Journals (Sweden)

Norihiro Sato

Full Text Available Photosynthetic organisms utilize sulfate for the synthesis of sulfur-compounds including proteins and a sulfolipid, sulfoquinovosyl diacylglycerol. Upon ambient deficiency in sulfate, cells of a green alga, Chlamydomonas reinhardtii, degrade the chloroplast membrane sulfolipid to ensure an intracellular-sulfur source for necessary protein synthesis. Here, the effects of sulfate-starvation on the sulfolipid stability were investigated in another green alga, Chlorella kessleri, and two cyanobacteria, Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942. The results showed that sulfolipid degradation was induced only in C. kessleri, raising the possibility that this degradation ability was obtained not by cyanobacteria, but by eukaryotic algae during the evolution of photosynthetic organisms. Meanwhile, Synechococcus disruptants concerning sqdB and sqdX genes, which are involved in successive reactions in the sulfolipid synthesis pathway, were respectively characterized in cellular response to sulfate-starvation. Phycobilisome degradation intrinsic to Synechococcus, but not to Synechocystis, and cell growth under sulfate-starved conditions were repressed in the sqdB and sqdX disruptants, respectively, relative to in the wild type. Their distinct phenotypes, despite the common loss of the sulfolipid, inferred specific roles of sqdB and sqdX. This study demonstrated that sulfolipid metabolism might have been developed to enable species- or cyanobacterial-strain dependent processes for acclimation to sulfate-starvation.

Habitat preferences of ground beetle (Coleoptera: Carabidae) species in the northern Black Hills of South Dakota.

Science.gov (United States)

Bergmann, David J; Brandenburg, Dylan; Petit, Samantha; Gabel, Mark

2012-10-01

Ground beetles (Coleoptera: Carabidae) are a major component of terrestrial invertebrate communities and have been used as bioindicators of habitat change and disturbance. The Black Hills of South Dakota is a small area with a high biodiversity, but the ground beetles of this region are little studied. The habitat preferences of ground beetles in the Black Hills are unknown, and baseline data must be collected if these beetles are to be used in the future as bioindicators. Ground beetles (Coleoptera: Carabidae) were collected from pitfall traps at two sites in each of five kinds of habitats (grassland, bur oak-ironwood forests, ponderosa pine-common juniper forests, aspen-pine forests, and a spruce forest) from which habitat structure characteristics and plant abundance data also were collected. In total, 27 species of ground beetles were identified. Although some species, such as Dicaelus sculptilis Say were found in most habitats, other species showed distinct habitat preferences: Poecilus lucublandus (Say) preferred oak forests, Pasimachus elongatus LeConte preferred grasslands, and Calathus ingratus Dejean preferred high-elevation aspen-pine forests. Pterostichus adstrictus Escholtz was found only in woodlands, and Carabus taedatus Say strictly in higher elevation (over 1,500 m) aspen or coniferous woods, and may represent relict populations of boreal species. Elevation, exposure to sunlight, and cover of woody plants strongly influence the structure of carabid communities in the Black Hills.

Cyanobacterial defense mechanisms against foreign DNA transfer and their impact on genetic engineering

Directory of Open Access Journals (Sweden)

Karina Stucken

2013-01-01

Full Text Available Cyanobacteria display a large diversity of cellular forms ranging from unicellular to complex multicellular filaments or aggregates. Species in the group present a wide range of metabolic characteristics including the fixation of atmospheric nitrogen, resistance to extreme environments, production of hydrogen, secondary metabolites and exopolysaccharides. These characteristics led to the growing interest in cyanobacteria across the fields of ecology, evolution, cell biology and biotechnology. The number of available cyanobacterial genome sequences has increased considerably in recent years, with more than 140 fully sequenced genomes to date. Genetic engineering of cyanobacteria is widely applied to the model unicellular strains Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942. However the establishment of transformation protocols in many other cyanobacterial strains is challenging. One obstacle to the development of these novel model organisms is that many species have doubling times of 48 h or more, much longer than the bacterial models E. coli or B. subtilis. Furthermore, cyanobacterial defense mechanisms against foreign DNA pose a physical and biochemical barrier to DNA insertion in most strains. Here we review the various barriers to DNA uptake in the context of lateral gene transfer among microbes and the various mechanisms for DNA acquisition within the prokaryotic domain. Understanding the cyanobacterial defense mechanisms is expected to assist in the development and establishment of novel transformation protocols that are specifically suitable for this group.

Redescription of Tripaphylus musteli (van Beneden, 1851) (Copepoda: Sphyriidae) and the relegation of Paeon Wilson, 1919 to synonymy with Tripaphylus Richiardi in Anonymous, 1878.

Science.gov (United States)

Benz, George W; Boxshall, Geoffrey A

2017-07-01

Tripaphylus musteli (van Beneden, 1851) (Copepoda, Siphonostomatoida, Sphyriidae) is redescribed from an adult female collected from the branchial chamber of a starry smooth-hound, Mustelus asterias Cloquet (Carcharhiniformes, Triakidae), captured in the English Channel off Portland, UK. The new account of T. musteli is the first based on a complete adult female and highlighted the lack of a robust distinction separating Tripaphylus Richiardi, in Anonymous, 1878 and Paeon Wilson, 1919 prompting us to relegate Paeon to a junior subjective synonym of Tripaphylus. In the light of this synonymy the eight former species of Paeon are transferred to Tripaphylus as follows: T. ferox (Wilson, 1919) new combination, T. elongatus (Wilson, 1932) new combination, T. vassierei (Delamare Deboutteville & Nuñes-Ruivo, 1954) new combination, T. lobatus (Kirtisinghe, 1964) new combination, T. asymboli (Turner, Kyne & Bennett, 2003) new combination, T. versicolor (Wilson, 1919) new combination, T. australis (Kabata, 1993) new combination, and T. triakis (Castro Romero, 2001) new combination. Comparisons between terminology used in this report and that in the literature indicate that all transformed adult females of Tripaphylus probably possess a full complement of cephalic appendages and maxillipeds. All limbs, with the exception of the maxillae share a general morphological similarity to the corresponding appendages of conspecific males. The maxilla of the transformed adult female of Tripaphylus is a small digitiform protuberance associated with a swelling in some species.

Size and metal concentration in the mangrove mussel Mytella guyanensis (Mollusca: Bivalva) from Baia de Sepetiba, Brazil

Energy Technology Data Exchange (ETDEWEB)

de Lacerda, L.D.; Lima, N.R.W.; Pfeiffer, W.C.; Fiszman, M.

1983-11-01

The natural variability of metal concentrations in M. guyanensis was estimated. The chosen parameter was size, as it is well correlated with most other metabolic functions and is of major concern in developing monitoring programs. The sampled area is in the mangrove swamp of Itingussu, Baia de Sepetiba, Rio de Janerio State, an area with increasing industrial activity and consequently with moderate levels of heavy metals in the aquatic environment. The analysis of metals in shells showed a significant inverse relationship for all metals, presenting a constant trend not observed in soft tissues. As the mechanisms of metal uptake and excretion in shells are slower than those of soft tissues, shells should be used as monitoring instruments. The results suggest that the relation between metal concentration and size in mollusks is a significant factor to be considered in monitoring programs. These relationships vary with species, and care should be taken in considering results obtained in species from temperature regions and those from the tropics, even when the species are closely related. 7 references, 2 figures, 1 table.

Thais (Stramonita rustica (Lamarck, 1822 (Mollusca: Gastropoda: Thaididae, a potential bioindicator of contamination by organotin northeast Brazil

Directory of Open Access Journals (Sweden)

Ítalo Braga de Castro

2004-06-01

Full Text Available The use of antifouling paints containing the biocide compound tributyltin (TBT has been shown as an inductor of imposex in neogastropods mollusks. Imposex is characterized by the development of male features in females, mainly the appearance of a no functional vas deferens and penis. Samples of Thais rustica were collected in eight sites in the metropolitan area of Natal city, Rio Grande do Norte state, northeast Brazil, and examined for occurrence of imposex, which was found in many females. The higher imposex levels were presented by samples from sites near city harbor.A utilização de tintas antiincrustrantes contendo o composto biocida tributilestanho (TBT tem induzido moluscos neogastrópodes ao imposex. O imposex é caracterizado pelo surgimento de caracteres sexuais masculinos, sobretudo, pênis e vaso deferente não funcionais em fêmeas desses moluscos. Foram coletadas amostras de Thais rústica em oito estações ao longo da costa da cidade de Natal no Rio Grande do Norte. Esses animais foram analisados quanto a presença e o grau de imposex que apresentavam. Os níveis mais elevados de imposex foram observados na estação mais próxima ao porto.

Imposex induction in Stramonita haemastoma floridana (Conrad, 1837 (Mollusca: Gastropoda: Muricidae submitted to an organotin-contaminated diet

Directory of Open Access Journals (Sweden)

Aline Fernandes Alves de Lima

2006-03-01

Full Text Available Marine organisms are affected by organotin compounds due to the cumulative, deleterious effects of these latter. The most evident and well known consequence of organotin contamination is imposex, a hormonal disruption that causes a superimposition of sexual male features in females of prosobranchia neogastropod molluscs such as Stramonita haemastoma floridana. Molluscs accumulate organotins mainly because of their poor ability to eliminate TBT and DBT from their tissues. The aim of this study was to analyze organotin uptake by ingestion experimentally, using uncontaminated subjects (S. haemastoma floridana fed with organotin-contaminated oysters (Crassostrea rhizophorae. A total of 248 gastropods, distributed in 7 tanks with uncontaminated water and contaminated food, were used in this study, a control group being fed uncontaminated oysters. Every 15 days, the individuals of one of the tanks were examined for the presence of imposex. Development of imposex was measured using the VDSI, RPSI and RPLI indexes. The animals had already developed imposex within the first 15 days, all the indexes measured (RPLI, RPSI and VDSI having increased significantly with duration of exposure, indicating that the animals were probablycontaminated by the food and had accumulated the pollutant. New paths of imposex development were also observed.Organismos marinhos são afetados por compostos organoestânicos que causam uma série de efeitos deletérios aos mesmos. O mais conhecido efeito da contaminação por organoestânicos é o imposex. Esse fenômeno consiste na masculinização de fêmeas de moluscos neogastrópodes tais como Stramonita haemastoma floridana. Esses compostos tendem a se acumular em moluscos devido a sua baixa capacidade de eliminá-los. Um total de 248 indivíduos de S. haemastoma floridana foram coletados de uma população livre qualquer indício de imposex. Esses animais foram mantidos em 7 aquários, com aproximadamente 30 indivíduos cada, 1 desses aquários foi considerado como controle e os animas do mesmo alimentados com ostras obtidas de locais onde não se verificou a ocorrência de imposex em neogastrópodes nativos. Os animais nos outros 6 aquários foram alimentados com ostras obtidas em local onde a incidência de imposex entre os gastrópodes nativos revelou-se muito alta. A cada 15 dias, por um período total de 90 dias, os animais de um dos tanques eram retirados e analisados quanto à presença de imposex. Os níveis de imposex foram quantificados através da % de imposex e dos índices: RPLI, RPSI e VDSI. Observou-se a indução de imposex em S. haemastoma floridana através da dieta a partir de Crassostrea rhizophora e um aumento significativo dos índices com o decorrer do tempo de exposição. Os animais do aquário controle foram analisados ao fim do experimento não revelando qualquer indício de imposex.

Comparative sensitivity of juvenile and adult Potamopyrgus antipodarum (Mollusca: Hydrobiidae) under chronic exposure to cadmium and tributyltin.

Science.gov (United States)

Ruppert, Katharina; Geiß, Cornelia; Ostermann, Sina; Theis, Christina; Oehlmann, Jörg

2016-07-28

To investigate a potential extension of a partial life cycle test protocol to a full life cycle test design, a comparative sensitivity analysis with juvenile and adult Potamopyrgus antipodarum was performed. Neonates and adult snails were exposed to the metal cadmium (Cd) and the endocrine disruptor tributyltin (TBT) at nominal concentrations ranging from 1.56 to 50 μg Cd/L and from 25 to 1,000 ng TBT-Sn/L. The experiments were performed over 28 days at 16°C in a semi-static test design. Mortality was assessed for both life stages. Juvenile snails' specific growth rate and reproduction of adults were investigated as main endpoints. We determined effects on snails' survival, juvenile growth and embryo numbers in the brood pouch of adult snails under exposure to both chemicals. Juvenile control mortality was between 25% and 30% and significantly higher than in the control groups with adult snails. A higher sensitivity of juvenile snails compared to adults was observed for the endpoint mortality. Calculated LC50 in Cd exposed snails was 38.2 μg/L for adults and 15.0 μg/L for juvenile snails. Significant effects on mortality in TBT exposed adult snails occurred at the highest test concentration only with a LC50 of 535 ng Sn/L. Juvenile survival was significantly affected at 50.8 ng Sn/L and higher concentrations. Effect concentrations for the main endpoints reproduction and juvenile growth show comparable sensitivities. For Cd exposed groups, EC50 values were 11.3 μg/L for the endpoint reproduction in adult snails and 3.82 μg/L for juvenile growth with overlapping confidence intervals. TBT also significantly affected juvenile snails' growth (EC50: 178 ng Sn /L). EC50 for embryo numbers was 125 ng TBT-Sn/L. Results indicate the manageability of a FLC test starting with newly hatched snails. Precautions have to be taken to guarantee a sufficient number of surviving snails until adulthood so that reproduction can be assessed. For final decision for the practicability of a FLC, further tests are needed.

Development and validation of an OECD reproductive toxicity test guideline with the mudsnail Potamopyrgus antipodarum (Mollusca, Gastropoda).

Science.gov (United States)

Ruppert, Katharina; Geiß, Cornelia; Askem, Clare; Benstead, Rachel; Brown, Rebecca; Coke, Maira; Ducrot, Virginie; Egeler, Philipp; Holbech, Henrik; Hutchinson, Thomas H; Kinnberg, Karin L; Lagadic, Laurent; Le Page, Gareth; Macken, Ailbhe; Matthiessen, Peter; Ostermann, Sina; Schimera, Agnes; Schmitt, Claudia; Seeland-Fremer, Anne; Smith, Andy J; Weltje, Lennart; Oehlmann, Jörg

2017-08-01

Mollusks are known to be uniquely sensitive to a number of reproductive toxicants including some vertebrate endocrine disrupting chemicals. However, they have widely been ignored in environmental risk assessment procedures for chemicals. This study describes the validation of the Potamopyrgus antipodarum reproduction test within the OECD Conceptual Framework for Endocrine Disrupters Testing and Assessment. The number of embryos in the brood pouch and adult mortality serve as main endpoints. The experiments are conducted as static systems in beakers filled with artificial medium, which is aerated trough glass pipettes. The test chemical is dispersed into the medium, and adult snails are subsequently introduced into the beakers. After 28 days the reproductive success is determined by opening the brood pouch and embryo counting. This study presents the results of two validation studies of the reproduction test with eleven laboratories and the chemicals tributyltin (TBT) with nominal concentrations ranging from 10 to 1000 ng TBT-Sn/L and cadmium with concentrations from 1.56 to 25 μg/L. The test design could be implemented by all laboratories resulting in comparable effect concentrations for the endpoint number of embryos in the brood pouch. After TBT exposure mean EC 10 , EC 50 , NOEC and LOEC were 35.6, 127, 39.2 and 75.7 ng Sn/L, respectively. Mean effect concentrations in cadmium exposed snails were, respectively, 6.53, 14.2, 6.45 and 12.6 μg/L. The effect concentrations are in good accordance with already published data. Both validation studies show that the reproduction test with P. antipodarum is a well-suited tool to assess reproductive effects of chemicals. Copyright © 2017 Elsevier Ltd. All rights reserved.

Recrutamento larval e crescimento de teredinidae (mollusca-bivalvia em região entremarés de manguezais

Directory of Open Access Journals (Sweden)

Sônia Godoy Bueno Carvalho Lopes

1997-01-01

Full Text Available O recrutamento larval e o crescimento de Teredinidae na região entremarés do manguezal da Praia Dura, Ubatuba, SP, foi acompanhado durante doze meses (08/84 a 08/85 utilizando coletores construídos com madeira de mangue. O tempo decorrido para se detectar a presença dos primeiros Teredinidae foi de aproximadamente sete meses após o início do experimento e o número de indivíduos por coletor foi muito reduzido no período de amostragem. Esses resultados contrastam com os obtidos por outros autores que instalaram coletores em ambiente marinho, mas são semelhantes aos obtidos por autores que instalaram coletores em regiões estuarinas do litoral brasileiro. Essas diferenças nos resultados talvez possam ser explicadas pelo fato da salinidade ser mais baixa e mais variável nos estuários que no ambiente marinho. A análise dos dados sobre o recrutamento larval, permite concluir que a espécie mais abundante foi Nausitora fustieula (Jeffreys, 1860, com principal época de instalação em março e taxa inicial de crescimento de 1,86 mm/day. As outras espécies de Teredinidae, Bankiaflmbriatula Moll & Roch, 1931, Bankia roehi Moll, 1931 e Neoteredo reynei (Bartsch, 1920, apresentaram pequeno número de indivíduos e em função disso, não foi possível determinar suas épocas de instalação e respectivas taxas de crescimento.The larval settlement and growth of Teredinidae in the intertidal region of the Praia Dura mangrove, Ubatuba, SP, were undertaken during one year (08/84 to 08/85 using colectors made from mangrove wood. The presence of the first Teredinidae was detected approximately seven month after the inicial experiment and the number of specimens per coletor was small during the sampling period. These results contrast with those obtained by other authors working in a marine environment, but are similar to those obtained in experiments developed in Brazilian estuaries. The differences between data obtained in marine and estuarine environments, might be explained by the lower and more variable salinity gradient in estuaries. Larval settlement data revealed that the most abundant species was Nausitora fustieula (Jeffreys,1860, which settles on wood prefrerably in March, and has an initial growth rate of 1.86 mm/day. The other Teredinidae species Banida fimbriatula Moll & Roch, 1931, Bankia rochi Moll, 1931 and Neoteredo reynei (Bartsch, 1920, occurred in a very small number of specimens and therefore, their time of settlement and growth rates could not be determined.

The Japanese oyster drill Ocinebrellus inornatus (Récluz, 1851) (Mollusca, Gastropoda, Muricidae), introduced to the Limfjord, Denmark

DEFF Research Database (Denmark)

Lützen, Jørgen; Faasse, Marco; Gittenberger, Adriaan

2012-01-01

The predatory neogastropod Ocinebrellus inornatus was first reported from Europe in W France in 1995 and has since been detected at other sites in NW and N France and The Netherlands. It is native to the North Pacific where it preys on the Pacific oyster Crassostrea gigas. Here we report on the o......The predatory neogastropod Ocinebrellus inornatus was first reported from Europe in W France in 1995 and has since been detected at other sites in NW and N France and The Netherlands. It is native to the North Pacific where it preys on the Pacific oyster Crassostrea gigas. Here we report...... on the occurrence of the species in beds of European oysters (Ostrea edulis) in the Limfjord, NW Jutland, Denmark. The morphology-based identification has been confirmed by genetic analysis. The species was probably introduced with oysters imported from France in the 1970s and 1980s. The invasion is still...... relatively localized but as the species has established a reproductive population, it may eventually spread to other parts of the fjord and in time pose a problem to the oyster fishery. The species’ invasion history is reviewed...

In situ distribution and characterization of the organic content of the oyster shell Crassostrea gigas (Mollusca, Bivalvia).

Science.gov (United States)

Dauphin, Yannicke; Ball, Alexander D; Castillo-Michel, Hiram; Chevallard, Corinne; Cuif, Jean-Pierre; Farre, Bastien; Pouvreau, Stéphane; Salomé, Murielle

2013-01-01

Cultivation of commercial oysters is now facing the possible influence of global change in sea water composition, commonly referred to as "ocean acidification". In order to test the potential consequence of the predicted environmental changes, a cultivation experiment was carried out. The left and right valves of the oyster shell Crassostrea gigas differ in their structure; moreover, lenses of non compact layers are irregular. The shell layers of juvenile C. gigas are studied using a variety of highly spatially resolved techniques to establish their composition and structure. Our results confirm the presence of three different calcitic structural types. The role of the lenses of chalky layers is not yet deciplered. Despite a common mineralogy, the elemental composition of the layers differs. The sulphur aminoacids and sulphated polysaccharide contents of the intracrystalline and intercrystalline matrices differ, as well as those of the structural types. The possible different sensitivity of these structures to environmental changes is still unknown. Copyright © 2012 Elsevier Ltd. All rights reserved.

Microsatellite loci for dreissenid mussels (Mollusca: Bivalvia: Dreissenidae) and relatives: markers for assessing exotic and native populations.

Science.gov (United States)

Feldheim, Kevin A; Brown, Joshua E; Murphy, Douglas J; Stepien, Carol A

2011-07-01

We developed and tested 14 new polymorphic microsatellite loci for dreissenid mussels, including the two species that have invaded many freshwater habitats in Eurasia and North America, where they cause serious industrial fouling damage and ecological alterations. These new loci will aid our understanding of their genetic patterns in invasive populations as well as throughout their native Ponto-Caspian distributions. Eight new loci for the zebra mussel Dreissena polymorpha polymorpha and six for the quagga mussel D. rostriformis bugensis were compared with new results from six previously published loci to generate a robust molecular toolkit for dreissenid mussels and their relatives. Taxa tested include D. p. polymorpha, D. r. bugensis, D. r. grimmi, D. presbensis, the 'living fossil'Congeria kusceri, and the dark false mussel Mytilopsis leucophaeata (the latter also is invasive). Overall, most of the 24 zebra mussel (N = 583) and 13 quagga mussel (N = 269) population samples conformed to Hardy-Weinberg equilibrium expectations for the new loci following sequential Bonferroni correction. The 11 loci (eight new, three previously published) evaluated for D. p. polymorpha averaged 35.1 alleles and 0.72 mean observed heterozygosity per locus, and 25.3 and 0.75 for the nine loci (six new, three previously published) developed for D. r. bugensis. All but three of these loci successfully amplified the other species of Dreissena, and all but one also amplified Congeria and Mytilopsis. All species and populations tested were significantly divergent using the microsatellite data, with neighbour-joining trees reflecting their evolutionary relationships; our results reveal broad utility for resolving their biogeographic, evolutionary, population and ecological patterns. © 2011 Blackwell Publishing Ltd.

The effects of mercury exposure on the surface morphology of gill filaments in Perna perna (Mollusca: Bivalvia)

CSIR Research Space (South Africa)

Gregory, MA

1999-01-01

Full Text Available each animal were analysed for mercury using an atomic absorption spectrometer. Mercury concentration increased from 0.13 (pre-immersion) to 87 mu g/g after day 24. Surface morphology remained normal for all animals in tank 2 and for those exposed to Hg...

Development and validation of an OECD reproductive toxicity test guideline with the mudsnail Potamopyrgus antipodarum (Mollusca, Gastropoda)

DEFF Research Database (Denmark)

Ruppert, Katharina; Geiß, Cornelia; Askem, Clare

2017-01-01

Mollusks are known to be uniquely sensitive to a number of reproductive toxicants including some vertebrate endocrine disrupting chemicals. However, they have widely been ignored in environmental risk assessment procedures for chemicals. This study describes the validation of the Potamopyrgus ant...

Inhibition of dye-coupling in Patella (mollusca) embryos by microinjection of antiserum against Nephrops (arthropoda) gap junctions

NARCIS (Netherlands)

Serras, F.; Buultjens, T.E.J.; Finbow, M.E.

1988-01-01

Antiserum raised against Nephrops gap junctions was injected into single cells of the 2-, 4-, 8-, 16-, and 32-cell stage of the Patella vulgata embryos. The pattern of junctional communication by iontophoresis of Lucifer Yellow CH was tested at the 32-cell stage. The results show that the normal

Biomonitoring study of an estuarine coastal ecosystem, the Sacca di Goro lagoon, using Ruditapes philippinarum (Mollusca: Bivalvia)

International Nuclear Information System (INIS)

Sacchi, Angela; Mouneyrac, Catherine; Bolognesi, Claudia; Sciutto, Andrea; Roggieri, Paola; Fusi, Marco; Beone, Gian Maria; Capri, Ettore

2013-01-01

Coastal lagoons are constantly subjected to releases of chemical pollutants, and so organisms may be exposed to such toxicants. This study investigated through a multivariate approach the physiological status of bivalve Ruditapes philippinarum, farmed in Sacca di Goro lagoon. Biomarkers at different levels of biological organization (catalase, superoxide dismutase, genotoxicity, reburrowing behavior) were evaluated at three sites exposed to different environmental conditions. A seasonal trend was observed, and micronucleus frequency was significantly lowest at the relatively pristine reference site. Enzymatic activity toward oxyradicals be quite efficient since variations in responsiveness were not consistent. However, behavioral impairment was observed in reburrowing rates. Sediment concentrations showed low PAH levels and high natural levels of trace metals Cr and Ni. DistLM statistical analysis revealed a non-significant relationship between selected biomarkers and xenobiotics. Therefore other potentially toxic compounds in admixture at low doses may be involved in driving differing spatial distribution of physiological impairment. -- Highlights: ► Health status assessment of bivalve Ruditapes philippinarum, from lagoon of Sacca di Goro. ► Multiparametric approach (chemical analysis, biochemical and behavioral biomarkers). ► Impairments of burrowing kinetics in the contaminated site. ► Micronucleus genotoxicity test to detect effects of contaminants complex mixture. ► Multiple stress of chemicals in estuarine costal ecosystem. -- The bivalve Ruditapes philippinarum as a bioindicator in monitoring pollution of estuaries

Phytochemical and molluscicidal activity of Mikania glomerata Sprengel (Asteraceae in different lifestages of Subulina octona (Mollusca, Subulinidade

Directory of Open Access Journals (Sweden)

Bruna Aparecida de Souza

2014-04-01

Full Text Available The objective of this work was to study the molluscicidal activity of aqueous extract of Mikania glomerata on the land snail Subulina octona and to assess the changes caused on the snail's fecundity, growth, hatchability and the offspring produced after exposure. Eggs, newly hatched and 30 day old snails were exposed to the sublethal concentration of M. glomerata extract for 24 and 48 h and the observations were made for 120 days. The presence of tannins, flavonoids and saponins were shown by phytochemical tests. The extract reduced significantly the hatchability and the survival of the offspring hatched from the exposed eggs. The eggs exposed for 48 h presented lower hatchability rates. There was a reduction on survival and growth of newly hatched and 30-days old snails exposed to the extract. These results indicated that the aqueous extract of M. glomerata could be applied as an alternative molluscicide for the control of this snail species efficiently.

Detection of Bioactive Compounds in the Mucus Nets of Dendropoma maxima, Sowerby 1825 (Prosobranch Gastropod Vermetidae, Mollusca

Directory of Open Access Journals (Sweden)

Anne Klöppel

2013-01-01

Full Text Available The sessile suspension-feeding wormsnail Dendropoma maxima, Sowerby 1825 (Vermetidae secretes a mucus net to capture planktonic prey. The nets are spread out over the corals and often have remarkable deleterious effects on them like changes in growth form and pigmentation shifts not uncommonly resulting in tissue necrosis. Until now, there is no explanation for this phenomenon although the indication as well as theories about its genesis is mentioned in several publications. Vermetids are well studied concerning the intraspecific competition with neighboring individuals but not in their interaction with other taxa like corals or fish. We did extensive in situ video recording and observed that fish avoided the plankton-load nets although several specialized taxa are known to be molluscivores, mucivores, and/or feed on plankton. As many molluscs use chemical weapons to combat feeding pressure and to defend themselves against predators, we screened empty and plankton-load mucus nets for potential bioactive metabolites. Bioactivity testing was performed with a recently developed system based on a chromatographic separation (high-performance thin-layer chromatography (HPTLC and a bioassay with luminescent bacteria Vibrio fischeri. Thus, we found at least two active compounds exclusively accumulated by the wormsnails themselves. This is the first record of bioactive properties in the whole family of Vermetidae.

Myogenesis in Aplysia californica (Cooper, 1863) (Mollusca, Gastropoda, Opisthobranchia) with special focus on muscular remodeling during metamorphosis

DEFF Research Database (Denmark)

Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

2008-01-01

To date only few comparative approaches tried to reconstruct the ontogeny of the musculature in invertebrates. This may be due to the difficulties involved in reconstructing three dimensionally arranged muscle systems by means of classical histological techniques combined with light or transmissi...

First record of a nematode Metastrongyloidea (Aelurostrongylus abstrusus larvae) in Achatina (Lissachatina) fulica (Mollusca, Achatinidae) in Brazil.

Science.gov (United States)

Thiengo, Silvana C; Fernandez, Monica A; Torres, Eduardo J L; Coelho, Pablo M; Lanfredi, Reinalda M

2008-05-01

Achatina (Lissachatina) fulica was introduced in Brazil in the 1980s for commercial purposes ("escargot" farming) and nowadays, mainly by human activity, it is widespread in at least 23 out of 26 Brazilian states and Brasília, including the Amazonian region and natural reserves, where besides a general nuisance for people it is a pest and also a public health concern, since it is one of the natural intermediate host of Angiostrongylus cantonensis, ethiological agent of the meningoencephalitis in Asia. As Brazil is experiencing the explosive phase of the invasion, the Laboratório de Malacologia do Instituto Oswaldo Cruz/Fiocruz has been receiving samples of these molluscs for identification and search for Angiostrongylus cantonensis and Angiostrongylus costaricensis larvae. While examining samples of A. fulica different nematode larvae were obtained, including Aelurostrongylus, whose different species are parasites of felids, dogs, primates, and badger. Morphological and morphometric analyses presented herein indicated the species Aelurostrongylus abstrusus, as well as the occurrence of other nematode larvae (Strongyluris-like) found in the interior of the pallial cavity of A. fulica. This is the first report in Brazil of the development of A. abstrusus infective larvae in A. fulica evidencing the veterinary importance of this mollusc in the transmission of A. abstrusus to domestic cats. Since the spread of A. fulica is pointed out in the literature as one of the main causative spread of the meningoencephalitis caused by A. cantonensis the authors emphasize the need of sanitary vigilance of snails and rats from vulnerable areas for A. cantonensis introduction as the port side areas.

First report of Angiostrongylus cantonensis (Nematoda: Metastrongylidae in Achatina fulica (Mollusca: Gastropoda from Southeast and South Brazil

Directory of Open Access Journals (Sweden)

Arnaldo Maldonado Júnior

2010-11-01

Full Text Available The rat lungworm Angiostrongylus cantonensis is a worldwide-distributed zoonotic nematode that can cause human eosinophilic meningoencephalitis. Here, for the first time, we report the isolation of A. cantonensis from Achatina fulica from two Brazilian states: Rio de Janeiro (specifically the municipalities of Barra do Piraí, situated at the Paraiba River Valley region and São Gonçalo, situated at the edge of Guanabara Bay and Santa Catarina (in municipality of Joinville. The lungworms were identified by comparing morphological and morphometrical data obtained from adult worms to values obtained from experimental infections of A. cantonensis from Pernambuco, Brazil, and Akita, Japan. Only a few minor morphological differences that were determined to represent intra-specific variation were observed. This report of A. cantonensis in South and Southeast Brazil, together with the recent report of the zoonosis and parasite-infected molluscs in Northeast Brazil, provide evidence of the wide distribution of A. cantonensis in the country. The need for efforts to better understand the role of A. fulica in the transmission of meningoencephalitis in Brazil and the surveillance of molluscs and rodents, particularly in ports, is emphasized.

First report of Angiostrongylus cantonensis (Nematoda: Metastrongylidae) in Achatina fulica (Mollusca: Gastropoda) from Southeast and South Brazil.

Science.gov (United States)

Maldonado, Arnaldo; Simões, Raquel O; Oliveira, Ana Paula M; Motta, Esther M; Fernandez, Mônica A; Pereira, Zilene M; Monteiro, Simone S; Torres, Eduardo J Lopes; Thiengo, Silvana Carvalho

2010-11-01

The rat lungworm Angiostrongylus cantonensis is a worldwide-distributed zoonotic nematode that can cause human eosinophilic meningoencephalitis. Here, for the first time, we report the isolation of A. cantonensis from Achatina fulica from two Brazilian states: Rio de Janeiro (specifically the municipalities of Barra do Piraí, situated at the Paraiba River Valley region and São Gonçalo, situated at the edge of Guanabara Bay) and Santa Catarina (in municipality of Joinville). The lungworms were identified by comparing morphological and morphometrical data obtained from adult worms to values obtained from experimental infections of A. cantonensis from Pernambuco, Brazil, and Akita, Japan. Only a few minor morphological differences that were determined to represent intra-specific variation were observed. This report of A. cantonensis in South and Southeast Brazil, together with the recent report of the zoonosis and parasite-infected molluscs in Northeast Brazil, provide evidence of the wide distribution of A. cantonensis in the country. The need for efforts to better understand the role of A. fulica in the transmission of meningoencephalitis in Brazil and the surveillance of molluscs and rodents, particularly in ports, is emphasized.

Cytogenetic characterisation of the razor shells Ensis directus (Conrad, 1843) and E. minor (Chenu, 1843) (Mollusca: Bivalvia)

Science.gov (United States)

González-Tizón, Ana M.; Rojo, Verónica; Vierna, Joaquín; Jensen, K. Thomas; Egea, Emilie; Martínez-Lage, Andrés

2013-03-01

The European razor shell Ensis minor (Chenu 1843) and the American E. directus (Conrad 1843) have a diploid chromosome number of 38 and remarkable differences in their karyotypes: E. minor has four metacentric, one metacentric-submetacentric, five submetacentric, one subtelocentric and eight telocentric chromosome pairs, whereas E. directus has three metacentric, two metacentric-submetacentric, six submetacentric, six subtelocentric and two telocentric pairs. Fluorescent in situ hybridisation (FISH) using a major ribosomal DNA probe located the major ribosomal genes on one submetacentric chromosome pair in both species; FISH with a 5S ribosomal DNA (5S rDNA) probe rendered one chromosomal (weak) signal for E. minor and no signal for E. directus, supporting a more dispersed organisation of 5S rDNA compared to the major ribosomal genes. The vertebrate telomeric sequence (TTAGGG) n was located on both ends of each chromosome, and no interstitial signals were detected. In this work, a comparative karyological analysis was also performed between the four Ensis species analysed revealing that the three European species studied so far, namely E. minor, E. siliqua (Linné 1758) and E. magnus Schumacher 1817 show more similarities among them than compared to the American species E. directus. In addition, clear karyotype differences were found between the morphologically similar species E. minor and E. siliqua.

Annotated type catalogue of the Bulimulidae (Mollusca, Gastropoda, Orthalicoidea in the Natural History Museum, London

Directory of Open Access Journals (Sweden)

Abraham Breure

2014-03-01

Full Text Available The type status is described of 404 taxa classified within the family Bulimulidae (superfamily Orthalicoidea and kept in the London museum. Lectotypes are designated for Bulimus aurifluus Pfeiffer, 1857; Otostomus bartletti H. Adams, 1867; Helix cactorum d’Orbigny, 1835; Bulimus caliginosus Reeve, 1849; Bulimus chemnitzioides Forbes, 1850; Bulimus cinereus Reeve, 1849; Helix cora d’Orbigny, 1835; Bulimus fallax Pfeiffer, 1853; Bulimus felix Pfeiffer, 1862; Bulimus fontainii d’Orbigny, 1838; Bulimus fourmiersi d’Orbigny, 1837; Bulimus (Mesembrinus gealei H. Adams, 1867; Bulimus gruneri Pfeiffer, 1846; Bulimus humboldtii Reeve, 1849; Helix hygrohylaea d’Orbigny, 1835; Bulimus jussieui Pfeiffer, 1846; Bulimulus (Drymaeus binominis lascellianus E.A. Smith, 1895; Helix lichnorum d’Orbigny, 1835; Bulimulus (Drymaeus lucidus da Costa, 1898; Bulimus luridus Pfeiffer, 1863; Bulimus meleagris Pfeiffer, 1853; Bulimus monachus Pfeiffer, 1857; Bulimus montagnei d’Orbigny, 1837; Helix montivaga d’Orbigny, 1835; Bulimus muliebris Reeve, 1849; Bulimus nigrofasciatus Pfeiffer in Philippi 1846; Bulimus nitelinus Reeve, 1849; Helix oreades d’Orbigny, 1835; Helix polymorpha d’Orbigny, 1835; Bulimus praetextus Reeve, 1849; Bulinus proteus Broderip, 1832; Bulimus rusticellus Morelet, 1860; Helix sporadica d’Orbigny, 1835; Bulimus sulphureus Pfeiffer, 1857; Helix thamnoica var. marmorata d’Orbigny, 1835; Bulinus translucens Broderip in Broderip and Sowerby I 1832; Helix trichoda d’Orbigny, 1835; Bulinus ustulatus Sowerby I, 1833; Bulimus voithianus Pfeiffer, 1847; Bulimus yungasensis d’Orbigny, 1837.The type status of the following taxa is changed to lectotype in accordance with Art. 74.6 ICZN: Bulimulus (Drymaeus caucaensis da Costa, 1898; Drymaeus exoticus da Costa, 1901; Bulimulus (Drymaeus hidalgoi da Costa, 1898; Bulimulus (Drymaeus interruptus Preston, 1909; Bulimulus (Drymaeus inusitatus Fulton, 1900; Bulimulus latecolumellaris Preston, 1909; Bulimus (Otostomus napo Angas, 1878; Drymaeus notabilis da Costa, 1906; Drymaeus notatus da Costa, 1906; Bulimulus (Drymaeus nubilus Preston, 1903; Drymaeus obliquistriatus da Costa, 1901; Bulimus (Drymaeus ochrocheilus E.A. Smith, 1877; Bulimus (Drymaeus orthostoma E.A. Smith, 1877; Drymaeus expansus perenensis da Costa, 1901; Bulimulus pergracilis Rolle, 1904; Bulimulus (Drymaeus plicatoliratus da Costa, 1898; Drymaeus prestoni da Costa, 1906; Drymaeus punctatus da Costa, 1907; Bulimus (Leptomerus sanctaeluciae E.A. Smith, 1889; Bulimulus (Drymaeus selli Preston, 1909; Drymaeus subventricosus da Costa, 1901; Bulimulus ( Drymaeus tigrinus da Costa, 1898; Drymaeus volsus Fulton, 1907; Drymaeus wintlei Finch, 1929; Bulimus zhorquinensis Angas, 1879; Bulimulus (Drymaeus ziczac da Costa, 1898.The following junior subjective synonyms are established: Bulimus antioquensis Pfeiffer, 1855 = Bulimus baranguillanus Pfeiffer, 1853; Drymaeus bellus da Costa, 1906 = Drymaeus blandi Pilsbry, 1897; Bulimus hachensis Reeve 1850 = Bulimus gruneri Pfeiffer, 1846 = Bulimus columbianus Lea, 1838; Bulimus (Otostomus lamas Higgins 1868 = Bulimus trujillensis Philippi, 1867; Bulimulus (Drymaeus binominis lascellianus E.A. Smith, 1895 = Bulimulus (Drymaeus binominis E.A. Smith, 1895; Drymaeus multispira da Costa, 1904 = Helix torallyi d’Orbigny, 1835; Bulimulus (Drymaeus plicatoliratus Da Costa, 1898 = Bulimus convexus Pfeiffer, 1855; Bulimus sugillatus Pfeiffer, 1857 = Bulimus rivasii d’Orbigny, 1837; Bulimus meridionalis Reeve 1848 [June] = Bulimus voithianus Pfeiffer, 1847.New combinations are: Bostryx montagnei (d’Orbigny, 1837; Bostryx obliquiportus (da Costa, 1901; Bulimulus heloicus (d’Orbigny, 1835; Drymaeus (Drymaeus lusorius (Pfeiffer, 1855; Drymaeus (Drymaeus trigonostomus (Jonas, 1844; Drymaeus (Drymaeus wintlei Finch, 1929; Drymaeus (Mesembrinus conicus da Costa, 1907; Kuschelenia (Kuschelenia culminea culminea (d’Orbigny, 1835; Kuschelenia (K. culmineus edwardsi (Morelet, 1863; Kuschelenia (K. gayi (Pfeiffer, 1857; Kuschelenia (K. tupacii (d’Orbigny, 1835; Kuschelenia (Vermiculatus anthisanensis (Pfeiffer, 1853; Kuschelenia (Vermiculatus aquilus (Reeve, 1848; Kuschelenia (Vermiculatus bicolor (Sowerby I, 1835; Kuschelenia (Vermiculatus caliginosus (Reeve, 1849; Kuschelenia (Vermiculatus cotopaxiensis (Pfeiffer, 1853; Kuschelenia (Vermiculatus filaris (Pfeiffer, 1853; Kuschelenia (Vermiculatus ochracea (Morelet, 1863; Kuschelenia (Vermiculatus petiti (Pfeiffer, 1846; Kuschelenia (Vermiculatus purpuratus (Reeve, 1849; Kuschelenia (Vermiculatus quechuarum (Crawford, 1939; Naesiotus cinereus (Reeve, 1849; Naesiotus dentritis (Morelet, 1863; Naesiotus fontainii (d’Orbigny, 1838; Naesiotus orbignyi (Pfeiffer, 1846; Protoglyptus pilosus (Guppy, 1871; Protoglyptus sanctaeluciae (E.A. Smith, 1889.Type material of the following taxa is figured herein for the first time: Bulimus cinereus Reeve, 1849; Bulimus coriaceus Pfeiffer, 1857; Bulimulus laxostylus Rolle, 1904; Bulimus pliculatus Pfeiffer, 1857; Bulimus simpliculus Pfeiffer, 1855.

The Effects of Mercury Exposure on the Surface Morphology of Gill Filaments in Perna perna (Mollusca: Bivalvia)

International Nuclear Information System (INIS)

Gregory, M.A.; George, R.C.; Marshall, D.J.; Anandraj, A.; McClurg, T.P.

1999-01-01

This study investigated the possibility that changes in the surface morphology of mussel (Perna perna) gill filaments may be used to indicate the relative toxicity of pollutants in the marine environment. Healthy, adult P. perna were collected and immersed in 2 free-flow tanks. Mercury was added to seawater as it entered tank 1 to achieve a constant level of 50 μg/l -1 over 24 days. Uncontaminated seawater was circulated over the mussels in tank 2 (control) for the same period. A 25 mm 2 area of gill filament was removed from each of the 5 specimens before and after 24 days immersion in tank 2, and after immersion for 1, 2, 4, 8, 16 and 24 days in tank 1. These were examined using a scanning electron microscope. The remaining soft tissues from each animal were analysed for mercury using an atomic absorption spectrometer. Mercury concentration increased from 0.13 (pre-immersion) to 87 μg/g after day 24. Surface morphology remained normal for all animals in tank 2 and for those exposed to Hg for up to 8 days. However, from 16 to 24 days exposure there was a gradual increase in the diameters of microvilli, a depletion of abfrontal cilia, an increase in abnormal, perhaps necrotic cells and an unusual increase in the number of cilia on the lateral surfaces. These results confirm that P. perna is an efficient bio-accumulator and suggest that their gill pathomorphology may be a useful indicator of toxicity

Molecular discrimination of Perna (Mollusca: Bivalvia) species using the polymerase chain reaction and species-specific mitochondrial primers

DEFF Research Database (Denmark)

Blair, D.; Waycott, M.; Byrne, L.

2006-01-01

This work was prompted by the need to be able to identify the invasive mussel species, Perna viridis, in tropical Australian seas using techniques that do not rely solely on morphology. DNA-based molecular methods utilizing a polymerase chain reaction (PCR) approach were developed to distinguish...

Putative midkine family protein up-regulation in Patella caerulea (Mollusca, Gastropoda) exposed to sublethal concentrations of cadmium

International Nuclear Information System (INIS)

Vanucci, Silvana; Minerdi, Daniela; Kadomatsu, Kenji; Mengoni, Alessio; Bazzicalupo, Marco

2005-01-01

A cDNA sequence of a putative midkine (MK) family protein was identified and characterised in the mollusc Patella caerulea. The midkine family consists of two members, midkine and pleiotrophin (PTN), and it is one of the recently discovered cytokines. Our results show that this putative midkine protein is up-regulated in specimens of P. caerulea exposed to sublethal cadmium concentrations (i.e. 0.5 and 1 mg l -1 Cd) over a 10-day exposure period. Semiquantitative RT-PCR and quantitative Real time RT-PCR estimations indicate elevated expression of midkine mRNA in exposed specimens compared to controls. Moreover, RT-PCR Real time values were higher in the viscera (here defined as the part of the soft tissue including digestive gland plus gills) than in the foot (i.e. foot plus head plus heart) of the limpets. At present, information on the functional signalling significance of the midkine family proteins suggests that the up-regulation of P. caerulea putative midkine family protein is a distress signal likely with informative value on health status of the organism and with potential prognostic capability

Assessing the performance of macroinvertebrate metrics in the Challhuaco-Ñireco System (Northern Patagonia, Argentina

Directory of Open Access Journals (Sweden)

Melina Mauad

2015-09-01

Full Text Available ABSTRACT Seven sites were examined in the Challhuaco-Ñireco system, located in the reserve of the Nahuel Huapi National Park, however part of the catchment is urbanized, being San Carlos de Bariloche (150,000 inhabitants placed in the lower part of the basin. Physico-chemical variables were measured and benthic macroinvertebrates were collected during three consecutive years at seven sites from the headwater to the river outlet. Sites near the source of the river were characterised by Plecoptera, Ephemeroptera, Trichoptera and Diptera, whereas sites close to the river mouth were dominated by Diptera, Oligochaeta and Mollusca. Regarding functional feeding groups, collector-gatherers were dominant at all sites and this pattern was consistent among years. Ordination Analysis (RDA revealed that species assemblages distribution responded to the climatic and topographic gradient (temperature and elevation, but also were associated with variables related to human impact (conductivity, nitrate and phosphate contents. Species assemblages at headwaters were mostly represented by sensitive insects, whereas tolerant taxa such as Tubificidae, Lumbriculidae, Chironomidae and crustacean Aegla sp. were dominant at urbanised sites. Regarding macroinvertebrate metrics employed, total richness, EPT taxa, Shannon diversity index and Biotic Monitoring Patagonian Stream index resulted fairly consistent and evidenced different levels of disturbances at the stream, meaning that this measures are suitable for evaluation of the status of Patagonian mountain streams.

Correlation between macrobenthic structure (biotic) and water-sediment characteristics (abiotic) adjacent aquaculture areas at Tembelas Island, indonesia

Science.gov (United States)

Sharani, Jeanny; Hidayat, Jafron W.; Putro, Sapto P.

2018-05-01

Macrobenthic community play important role in sedimentary habitats as a part of food chain. Their structure may be influenced by environmental characteristic spatially and temporally. The purpose of this study is to access the correlation between macrobenthic structure (biotic) and water-sediment characteristics (abiotic) adjacent aquaculture areas at Tembelas Island, Indonesia. Water and sediments samples were taken twice, where the first and second sampling time were taken in June and October 2016, respectively. Samples were taken in the area of fish farming at coastal area of policulture/IMTA (as Location I), site of 1 km away from fish farming area as a reference site (as Location II), and monoculture sites (as Location III), with three stations for each location. Data of abiotic parameters included the composition of sediment substrate and DO, pH, salinity, temperature, and. Sediment samples were taken using Ekman grab. The organisms were 1 mm -size sieved and fixed using 10% formalin for further analysis, i.e. sorting, preserving, enumerating, identifying, and grouping. The relationship between biotics (macrobentos) and abiotics (physical-chemical factors) was assessed using a non-parametric multivariate procedure (BIOENV). This study found 61 species consisting of 46 families and 5 classes of macrobenthos. The most common classes were member of Mollusca and Polychaeta. Total nitrogen, silt, and clay were the abiotic factors most influencing macrobenthic structure (BIO-ENV; r = 0.46; R2 = 21.16%).

Studies on radioactivity monitoring proceedure for marine organisms

International Nuclear Information System (INIS)

Koyanagi, Taku; Hirano, Shigeki

1978-01-01

Suitability of several species of mollusca and seaweeds as indicator organisms for radioactivity monitoring of marine environment was examined by radioisotope tracer experiments or stable elements analyses from the standpoints of the affinities for radionuclides, the sampling procedures, and the distribution of radioactive and stable elements in the body of these organisms. Extremely high concentration factor of 54 Mn was shown by kidney of scallop suggesting the suitability for the efficient monitoring of the nuclide though the contribution of kidney to the weight of scallop was very small. Higher concentration of 54 Mn in midgut gland rather than kidney was observed in the case of other species of shellfishes but distribution of the nuclide among organs or tissues of the organisms varied during the period of intake and excretion. Ununiform distribution of radioactive and stable elements among the species of seaweeds and in the body of seaweeds observed by the tracer experiments and stable element analyses suggested the necessity of careful selection of the samples for monitoring of these nuclides. From the results of tracer experiments carried out in order to elucidate the relation between existing state of radionuclides in seawater and uptake by marine organisms, it was supposed that the complexed forms with inorganic or organic ligands in seawater were predominant species of radioactive cerium in seawater. (author)

Complete mitochondrial genome sequence of the polychaete annelidPlatynereis dumerilii

Energy Technology Data Exchange (ETDEWEB)

Boore, Jeffrey L.

2004-08-15

Complete mitochondrial genome sequences are now available for 126 metazoans (see Boore 1999; Mitochondrial Genomics link at http://www.jgi.doe.gov), but the taxonomic representation is highly biased. For example, 80 are from a single phylum, Chordata, and show little variation for many molecular features. Arthropoda is represented by 16 taxa, Mollusca by eight, and Echinodermata by five, with only 17 others from the remaining {approx}30 metazoan phyla. With few exceptions (see Wolstenholme 1992 and Boore 1999) these are circular DNA molecules, about 16 kb in size, and encode the same set of 37 genes. A variety of non-standard names are sometimes used for animal mitochondrial genes; see Boore (1999) for gene nomenclature and a table of synonyms. Mitochondrial genome comparisons serve as a model of genome evolution. In this system, much smaller and simpler than that of the nucleus, are all of the same factors of genome evolution, where one may find tractable the changes in tRNA structure, base composition, genetic code, gene arrangement, etc. Further, patterns of mitochondrial gene rearrangements are an exceptionally reliable indicator of phylogenetic relationships (Smith et al.1993; Boore et al. 1995; Boore, Lavrov, and Brown 1998; Boore and Brown 1998, 2000; Dowton 1999; Stechmann and Schlegel 1999; Kurabayashi and Ueshima 2000). To these ends, we are sampling further the variation among major animal groups in features of their mitochondrial genomes.

The British Lower Palaeolithic of the early Middle Pleistocene

Science.gov (United States)

Hosfield, Robert

2011-06-01

The archaeology of Britain during the early Middle Pleistocene (MIS 19-12) is represented by a number of key sites across eastern and southern England. These sites include Pakefield, Happisburgh 1, High Lodge, Warren Hill, Waverley Wood, Boxgrove, Kent's Cavern, and Westbury-sub-Mendip, alongside a 'background scatter' lithic record associated with the principal river systems (Bytham, pre-diversion Thames, and Solent) and raised beaches (Westbourne-Arundel). Hominin behaviour can be characterised in terms of: preferences for temperate or cool temperate climates and open/woodland mosaic habitats (indicated by mammalian fauna, mollusca, insects, and sediments); a biface-dominated material culture characterised by technological diversity, although with accompanying evidence for distinctive core and flake (Pakefield) and flake tool (High Lodge) assemblages; probable direct hunting-based subsistence strategies (with a focus upon large mammal fauna); and generally locally-focused spatial and landscape behaviours (principally indicated by raw material sources data), although with some evidence of dynamic, mobile and structured technological systems. The British data continues to support a 'modified short chronology' to the north of the Alps and the Pyrenees, with highly sporadic evidence for a hominin presence prior to 500-600 ka, although the ages of key assemblages are subject to ongoing debates regarding the chronology of the Bytham river terraces and the early Middle Pleistocene glaciations of East Anglia.

South America-Africa missing links revealed by the taxonomy of deep-sea molluscs: Examples from prochaetodermatid aplacophorans

Science.gov (United States)

Corrêa, Paulo Vinicius Ferraz; Miranda, Marcel Sabino; Passos, Flávio Dias

2018-02-01

Prochaetodermatidae (Mollusca, Aplacophora, Caudofoveata), typical inhabitants of the deep sea, occur mainly along the continental slope, sometimes in high abundance. Their diversity in some regions, such as the South Atlantic Ocean, is little studied. The genus Claviderma is so far composed of one Pacific Ocean, two Indian Ocean and seven Atlantic Ocean species. Collections of the southeastern Brazilian coast contained three species of this genus. One, C. virium sp. nov., is new to science, and the other two, C. crassum and C. amplum, are new occurrences, extending their distributions southward into the western Atlantic. The external morphology and details of their radula and sclerites are described. The new species is distinguished by its long trunk and comparatively narrow, short posterium, and its trunk sclerites bearing numerous evident transverse growth lines. In the Atlantic Ocean, species with similar body forms and with sclerites of the same shape occur off the western and eastern coasts: the South American C. compactum is similar externally to the African C. brevicaudatum, and the Brazilian C. virium sp. nov. is comparable to the eastern Atlantic C. gladiatum. This suggests that these pairs of species are sister-groups, sharing the same morphological traits as a result of common ancestry. In the western and eastern Atlantic, most species of Claviderma that live over a wider range of depths are more widely distributed.

[A case of occupational contact urticaria and oral allergy syndrome due to seafood].

Science.gov (United States)

Yamaguchi, Junko; Inomata, Naoko; Hirokado, Michiko; Shimakura, Kuniyoshi; Shiomi, Kazuo; Ikezawa, Zenro

2007-01-01

A 20-year-old woman was referred for evaluation after about 2 years of recurrent episodes of localized urticaria during handling of several kinds of raw fish in a sushi shop, where she had worked part-time for 2 years. She had also experienced allergic symptoms such as itching and swelling of her lips, generalized urticaria, laryngeal tightness, stridor and dyspnea immediately after ingestion of raw and cooked seafood, including sole, horse mackerel, sea eel and shellfish, over the previous 1 year before referral. Skin prick tests and blood test for specific IgE antibodies were positive for many kinds of seafood, including sole, horse mackerel, sea eel, eel, crab, and abalone, which belonged to different taxonomic phyla, including Chordata, Arthropoda, and Mollusca. A challenge with a piece of broiled sole induced swelling of the lips, obstruction of the larynx, difficulty with deglutition, and abdominal pain. In addition, serum-specific IgE antibodies to two major fish allergens, parvalbumin and collagen, were detected by ELISA, suggesting that allergic symptoms could be induced by many kinds of seafood in the present patient. She was therefore diagnosed with occupational contact urticaria and oral allergy syndrome due to seafood. At the time of this report, the present patient had been followed for one year and no reactions have occurred since she started to avoid the causative types of seafood.

Additions to the knowledge of the land snails of Sabah (Malaysia, Borneo), including 48 new species

Science.gov (United States)

Vermeulen, Jaap J.; Liew, Thor-Seng; Schilthuizen, Menno

2015-01-01

Abstract We present reviews of the Sabah (Malaysia, on the island of Borneo) species of the following problematical genera of land snails (Mollusca, Gastropoda): Acmella and Anaglyphula (Caenogastropoda: Assimineidae); Ditropopsis (Caenogastropoda: Cyclophoridae); Microcystina (Pulmonata: Ariophantidae); Philalanka and Thysanota (Pulmonata: Endodontidae); Kaliella, Rahula, (Pulmonata: Euconulidae); Trochomorpha and Geotrochus (Pulmonata: Trochomorphidae). Next to this, we describe new species in previously revised genera, such as Diplommatina (Diplommatinidae); Georissa (Hydrocenidae); as well as some new species of genera not revised previously, such as Japonia (Cyclophoridae); Durgella and Dyakia (Ariophantidae); Amphidromus, and Trachia (Camaenidae); Paralaoma (Punctidae); Curvella (Subulinidae). All descriptions are based on the morphology of the shells. We distinguish the following 48 new species: Acmella cyrtoglyphe, Acmella umbilicata, Acmella ovoidea, Acmella nana, Acmella subcancellata, Acmella striata, and Anaglyphula sauroderma (Assimineidae); Ditropopsis davisoni, Ditropopsis trachychilus, Ditropopsis constricta, Ditropopsis tyloacron, Ditropopsis cincta, and Japonia anceps (Cyclophoridae); Diplommatina bidentata and Diplommatina tylocheilos (Diplommatinidae); Georissa leucococca and Georissa nephrostoma (Hydrocenidae); Durgella densestriata, Dyakia chlorosoma, Microcystina microrhynchus, Microcystina callifera, Microcystina striatula, Microcystina planiuscula, and Microcystina physotrochus (Ariophantidae); Amphidromus psephos and Trachia serpentinitica (Camaenidae); Philalanka tambunanensis, Philalanka obscura, Philalanka anomphala, Philalanka rugulosa, and Philalanka malimgunung (Endodontidae); Kaliella eurytrochus, Kaliella sublaxa, Kaliella phacomorpha, Kaliella punctata, Kaliella microsoma, Rahula delopleura, (Euconulidae); Paralaoma angusta (Punctidae); Curvella hadrotes (Subulinidae); Trochomorpha trachus, Trochomorpha haptoderma, Trochomorpha

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

NARCIS (Netherlands)

Danchin, Etienne G.J.; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Rocha, Da Martine; Bajew, Simon; Neilson, Roy; Sokolova, Elena; Silva, Da Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Hans; Jones, John T.; Eves-van den Akker, Sebastian

2017-01-01

Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been

A Carboniferous chiton (Mollusca, Polyplacophora) at the end of its trail: a unique find from the Czech Republic

Czech Academy of Sciences Publication Activity Database

Mikuláš, Radek; Rindsberg, A. K.; Santos, A.; Pavela, M.

2017-01-01

Roč. 56, č. 2 (2017), s. 171-179 ISSN 0375-7633 Institutional support: RVO:67985831 Keywords : Viséan * Recent * locomotion traces * tracemakers * Proleptochiton Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 0.903, year: 2016

Assessment of tributyltin contamination based on imposex in Stramonita rustica (Mollusca: Gastropoda along southern Bahia coast, northeastern Brazil

Directory of Open Access Journals (Sweden)

G. C. Zeidan

Full Text Available Abstract This study investigated the effects of tributyltin (TBT on the morphology of the genital system of the gastropod Stramonita rustica in southern Bahia, Brazil. For this, 330 specimens were collected during the summer of 2014 at eight sampling points to ascertain whether male sex organs had developed in addition to the complete female genital tract in females (= imposex. The analyses were made under a stereoscopic microscope. Imposex and their associated indexes, and the sterile females, exhibited the highest rates in harbors and shipyards areas. Despite the total ban of TBT in anti-fouling paints on a global scale since 2003, the results of this and other studies indicate the continued use of those paints on the Brazilian coast. This shows the inefficiency of existing legislation and the need to strengthen enforcement of the ban.

Assessment of tributyltin contamination based on imposex in Stramonita rustica (Mollusca: Gastropoda) along southern Bahia coast, northeastern Brazil.

Science.gov (United States)

Zeidan, G C; Boehs, G

2017-03-01

This study investigated the effects of tributyltin (TBT) on the morphology of the genital system of the gastropod Stramonita rustica in southern Bahia, Brazil. For this, 330 specimens were collected during the summer of 2014 at eight sampling points to ascertain whether male sex organs had developed in addition to the complete female genital tract in females (= imposex). The analyses were made under a stereoscopic microscope. Imposex and their associated indexes, and the sterile females, exhibited the highest rates in harbors and shipyards areas. Despite the total ban of TBT in anti-fouling paints on a global scale since 2003, the results of this and other studies indicate the continued use of those paints on the Brazilian coast. This shows the inefficiency of existing legislation and the need to strengthen enforcement of the ban.

Spermatozoan ultrastructure in the trigonioid bivalve Neotrigonia margaritacea Lamarck (Mollusca): Comparison with other bivalves, especially Trigonioida and Unionoida

Science.gov (United States)

Healy, J. M.

1996-06-01

Spermatozoa of the trigonioid bivalve Neotrigonia margaritacea (Lamarck) (Trigoniidae, Trigonioida) are examined ultrastructurally. A cluster of discoidal, proacrosomal vesicles (between 9 to 15 in number) constitutes the acrosomal complex at the nuclear apex. The nucleus is short (2.4 2.6 μm long, maximum diameter 2.2 μm), blunt-conical in shape, and exhibits irregular lacunae within its contents. Five or sometimes four round mitochondria are impressed into shallow depressions in the base of the nucleus as is a discrete centriolar fossa. The mitochondria surround two orthogonally arranged centrioles to form, collectively, the midpiece region. The distal centriole, anchored by nine satellite fibres to the plasma membrane, acts as a basal body to the sperm flagellum. The presence of numerous proacrosomal vesicles instead of a single, conical acrosomal vesicle sets Neotrigonia (and the Trigonioida) apart from other bivalves, with the exception of the Unionoida which are also known to exhibit this multivesicular condition. Spermatozoa of N. margaritacea are very similar to those of the related species Neotrigonia bednalli (Verco) with the exception that the proacrosomal vesicles of N. margaritacea are noticeably larger than those of N. bednalli.

Anisospira velascorum, a new land snail from Mexico, with notes on the anatomy and histology (Mollusca, Gastropoda, Urocoptidae)

NARCIS (Netherlands)

Breure, A.S.H.

1977-01-01

During a collecting trip through southern and central Mexico (Breure, 1974) special attention has been paid to Bulimulidae and Urocoptidae. Among the material of urocoptids a new species has been found. Anisospira velascorum sp. n. (figs. 1-10, pl. 1) Description. — Shell up to 30.5 mm, 2.39 times

Seasonal variation in the abundance and distribution of Anomalocardia flexuosa (Mollusca, Bivalvia, Veneridae in an estuarine intertidal plain

Directory of Open Access Journals (Sweden)

Jacqueline S. Silva-Cavalcanti

2018-02-01

Full Text Available Spatial and temporal density and biomass of the infaunal mollusk Anomalocardia flexuosa (Linnaeus, 1767 evaluated a tidal plain at Goiana estuary (Northeast Brazil. Three hundred and sixty core samples were taken during an annual cycle from three intertidal habitats (A, B and C. Shell ranged from 2.20 to 28.48 mm (15.08 ± 4.08 mm. Recruitment occurred more intensely from January to March. Total (0–1,129 g m−2 differed seasons (rainy and dry, with highest values in the early rainy season (221.0 ± 231.44 g m−2; and lowest values in the late dry season (57.34 ± 97 g m−2. The lowest occurred during the late rainy (319 ± 259 ind m−2 and early dry (496 ± 607 ind m−2 seasons. Extreme environmental situations (e.g., river flow, salinity and water temperature at the end of each season also affected density ranges (late dry: 0–5,798 ind m−2; late rainy: 0–1,170 ind m−2. A. flexuosa in the Goiana estuary presented a dominance of juvenile individuals (shell length < 20 mm, with high biomass main the recruitment period. Average shell length, density and biomass values suggest overfishing of the stock unit. A. flexuosa is an important food and income resource along its whole distribution range. The species was previously also known as Anomalocardia brasiliana (Gmelin, 1791.

Immunochemical localization of ribulose-1,5-bisphosphate carboxylase in the symbiont-containing gills of Solemya velum (Bivalvia : Mollusca)

NARCIS (Netherlands)

Cavanaugh, Colleen M.; Abbott, Marilyn S.; Veenhuis, Marten

1988-01-01

The distribution of the Calvin cycle enzyme ribulose-1,5-bisphosphate carboxylase (RbuP2Case; EC 4.1.1.39) was examined by using two immunological methods in tissues of Solemya velum, an Atlantic coast bivalve containing putative chemoautotrophic symbionts. Antibodies elicited by the purified large

Immunochemical localization of ribulose-1,5-bisphosphate carboxylase in the symbiont-containing gills of Solemya velum (Bivalvia: Mollusca).

Science.gov (United States)

Cavanaugh, C M; Abbott, M S; Veenhuis, M

1988-10-01

The distribution of the Calvin cycle enzyme ribulose-1,5-bisphosphate carboxylase (RbuP(2)Case; EC 4.1.1.39) was examined by using two immunological methods in tissues of Solemya velum, an Atlantic coast bivalve containing putative chemoautotrophic symbionts. Antibodies elicited by the purified large subunit of RbuP(2)Case from tobacco (Nicotiana tabacum) cross-reacted on immunoblots with a protein of similar molecular mass occurring in extracts of the symbiont-containing gill tissue of S. velum. No cross-reactivity was detected in symbiont-free tissue extracts. The antiserum also cross-reacted in immunoblots with proteins of Thiobacillus neapolitanus, a free-living sulfuroxidizing chemoautotroph whose RbuP(2)Case has been well characterized. In protein A-gold immunoelectron microscopy studies, this antiserum consistently labeled the symbionts but not surrounding host gill tissue, indicating that the symbionts are responsible for the RbuP(2)Case activity.

Opisthobranchs from the western Indian Ocean, with descriptions of two new species and ten new records (Mollusca, Gastropoda

Directory of Open Access Journals (Sweden)

Nathalie Yonow

2012-05-01

Full Text Available Seventy species of opisthobranchs are described in this work based on collections from the Persian Gulf, Socotra, Kenya, Zanzibar, Madagascar, La Réunion, Mauritius, the Seychelles, the Maldives, and Sri Lanka. Ten species are newly recorded from the western Indian Ocean and four species are recorded in the scientific literature for the first time since their original descriptions. Two species are described as new: Cyerce bourbonica sp. n. from La Réand Doriopsilla nigrocera sp. n. from the Persian Gulf coast of Saudi Arabia. Chromodoris cavae is removed from its synonymy with C. tennentana and redescribed from specimens from La Réunion, while several new synonyms are proposed for some commonly occurring species. Risbecia bullockii is recorded for the second time from the Indian Ocean and assigned to its correct genus.

Los moluscos terrestres (Mollusca: Gastropoda de Costa Rica: clasificación, distribución y conservación

Directory of Open Access Journals (Sweden)

Zaidett Barrientos Llosa

2010-12-01

Full Text Available Los moluscos terrestres son un grupo muy poco estudiado a nivel mundial. Hay 183 especies reportadas para Costa Rica, 30% son endémicas y 7% posiblemente están extintas. Se espera que en el país haya alrededor de 400 especies, de más del 95% se desconoce su biología, ecología, distribución, genética y otros campos de estudio. En Costa Rica las familias con mayor número de especies son Spiraxidae, Orthalicidae y Subulinidae. No obstante, es posible que Euconulidae sea aun más diversa, pues habitan las zonas altas del país que es en donde menos trabajo se ha hecho. El estudio de regiones altas aumentará el porcentaje de endemismo. Los futuros trabajos malacológicos taxonómicos, biológicos y ecológicos deben considerar la poca movilidad de este grupo, su tendencia a formar especies nuevas en simpatría, la especificidad de requerimientos de microhábitat, el hermafroditismo, la alta tasa de evolución (10% por millón de años y la divergencia entre especies (2-30%. Para proteger adecuadamente la biodiversidad de la malacofauna costarricense, se requiere de estudios que determinen la distribución y abundancia de las especies y el efecto del uso de la tierra y del climático.

Development and validation of an OECD reproductive toxicity test guideline with the pond snail Lymnaea stagnalis (Mollusca, Gastropoda).

Science.gov (United States)

Ducrot, Virginie; Askem, Clare; Azam, Didier; Brettschneider, Denise; Brown, Rebecca; Charles, Sandrine; Coke, Maïra; Collinet, Marc; Delignette-Muller, Marie-Laure; Forfait-Dubuc, Carole; Holbech, Henrik; Hutchinson, Thomas; Jach, Arne; Kinnberg, Karin L; Lacoste, Cédric; Le Page, Gareth; Matthiessen, Peter; Oehlmann, Jörg; Rice, Lynsey; Roberts, Edward; Ruppert, Katharina; Davis, Jessica Elphinstone; Veauvy, Clemence; Weltje, Lennart; Wortham, Ruth; Lagadic, Laurent

2014-12-01

The OECD test guideline development program has been extended in 2011 to establish a partial life-cycle protocol for assessing the reproductive toxicity of chemicals to several mollusk species, including the great pond snail Lymnaea stagnalis. In this paper, we summarize the standard draft protocol for a reproduction test with this species, and present inter-comparison results obtained in a 56-day prevalidation ring-test using this protocol. Seven European laboratories performed semi-static tests with cultured snails of the strain Renilys® exposed to nominal concentrations of cadmium chloride (from 53 to 608μgCdL(-1)). Cd concentrations in test solutions were analytically determined to confirm accuracy in the metal exposure concentrations in all laboratories. Physico-chemical and biological validity criteria (namely dissolved oxygen content >60% ASV, water temperature 20±1°C, control snail survival >80% and control snail fecundity >8 egg-masses per snail over the test period) were met in all laboratories which consistently demonstrated the reproductive toxicity of Cd in snails using the proposed draft protocol. Effect concentrations for fecundity after 56days were reproducible between laboratories (68

Annotated type catalogue of the Megaspiridae, Orthalicidae, and Simpulopsidae (Mollusca, Gastropoda, Orthalicoidea in the Natural History Museum, London

Directory of Open Access Journals (Sweden)

Abraham S.H. Breure

2015-01-01

Full Text Available The type status is described for 65 taxa of the Orthalicoidea, classified within the families Megaspiridae (14, Orthalicidae (30, and Simpulopsidae (20; one taxon is considered a nomen inquirendum. Lectotypes are designated for the following taxa: Helix brephoides d’Orbigny, 1835; Simpulopsis cumingi Pfeiffer, 1861; Bulimulus (Protoglyptus dejectus Fulton, 1907; Bulimus iris Pfeiffer, 1853. The type status of Bulimus salteri Sowerby III, 1890, and Strophocheilus (Eurytus subirroratus da Costa, 1898 is now changed to lectotype according Art. 74.6 ICZN. The taxa Bulimus loxostomus Pfeiffer, 1853, Bulimus marmatensis Pfeiffer, 1855, Bulimus meobambensis Pfeiffer, 1855, and Orthalicus powissianus var. niveus Preston 1909 are now figured for the first time. The following taxa are now considered junior subjective synonyms: Bulimus marmatensis Pfeiffer, 1855 = Helix (Cochlogena citrinovitrea Moricand, 1836; Vermiculatus Breure, 1978 = Bocourtia Rochebrune, 1882. New combinations are: Kuschelenia (Bocourtia Rochebrune, 1882; Kuschelenia (Bocourtia aequatoria (Pfeiffer, 1853; Kuschelenia (Bocourtia anthisanensis (Pfeiffer, 1853; Kuschelenia (Bocourtia aquila (Reeve, 1848; Kuschelenia (Bocourtia badia (Sowerby I, 1835; Kuschelenia (Bocourtia bicolor (Sowerby I, 1835; Kuschelenia (Bocourtia caliginosa (Reeve, 1849; Kuschelenia (Bocourtia coagulata (Reeve, 1849; Kuschelenia (Bocourtia cotopaxiensis (Pfeiffer, 1853; Kuschelenia (Bocourtia filaris (Pfeiffer, 1853; Kara indentata (da Costa, 1901; Clathrorthalicus magnificus (Pfeiffer, 1848; Simpulopsis (Eudioptus marmartensis (Pfeiffer, 1855; Kuschelenia (Bocourtia nucina (Reeve, 1850; Kuschelenia (Bocourtia ochracea (Morelet, 1863; Kuschelenia (Bocourtia peaki (Breure, 1978; Kuschelenia (Bocourtia petiti (Pfeiffer, 1846; Clathrorthalicus phoebus (Pfeiffer, 1863; Kuschelenia (Bocourtia polymorpha (d’Orbigny, 1835; Scholvienia porphyria (Pfeiffer, 1847; Kuschelenia (Bocourtia purpurata (Reeve, 1849; Kuschelenia (Bocourtia quechuarum Crawford, 1939; Quechua salteri (Sowerby III, 1890; Kuschelenia (Bocourtia subfasciata Pfeiffer, 1853; Clathrorthalicus victor (Pfeiffer, 1854. In an addedum a lectotype is being designated for Bulimulus (Drymaeus interruptus var. pallidus Preston, 1909. An index is included to all taxa mentioned in this paper and the preceding ones in this series (Breure and Ablett 2011, 2012, 2014.

Effect of heavy metals (Cu, Cd and Pb) on aspartate and alanine aminotransferase in Ruditapes philippinarum (Mollusca: Bivalvia)

International Nuclear Information System (INIS)

Blasco, J.; Puppo, J.

1999-01-01

The accumulation of cadmium, copper and lead and their effects on aspartate and alanine aminotransferases in digestive gland, gills, foot and soft body in the clam Ruditapes philippinarum were examined. The animals were exposed to different concentrations: Cd (200-600 μg·l -1 ), Pb (350-700 μg·l -1 ) and Cu (10-20 μg·l -1 ) for 7 days. The highest concentrations were found in digestive gland for cadmium and copper, and in gills for lead, and the lowest values were observed in the foot. Aspartate aminotransferase activity (AST), in general, was not inhibited by cadmium, lead or copper during the exposure. Only in clams exposed to cadmium (600 μg·l -1 , 7 days) and copper (20 μg·l -1 , 5 days) were observed significant differences (P -1 . A significant correlation (P<0.05) was observed between ALT and metal accumulation for cadmium, copper and lead in gills. In the case of soft body, only cadmium and lead showed a significant correlation. In summary, R. philippinarum can be considered a bioindicator species for cadmium and lead accumulation and ALT could be useful as biomarker of sublethal stress for these metals in soft tissues and gills. Only gills can be considered an adequate target tissue for copper. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

Effects of food type, feeding frequency, and temperature on juvenile survival and growth of Marisa cornuarietis (Mollusca: Gastropoda).

Science.gov (United States)

Selck, Henriette; Aufderheide, John; Pounds, Nadine; Staples, Charles; Caspers, Norbert; Forbes, Valery

2006-06-01

The present experiments are part of a larger study designed to investigate the influence of husbandry parameters on the life history of the ramshorn snail, Marisa cornuarietis, in order to identify suitable husbandry conditions for maintaining multi-generation populations in the laboratory for use in ecotoxicological testing. In this paper we focus on the effects of a combination of food types and feeding frequencies (i.e., the frequency with which the snails were offered food) on juvenile growth and survival at different temperatures. Offspring produced in the laboratory by wild specimens of M. cornuarietis, from Puerto Rico, were used to test the effects of three types of food (lettuce, alginate with fish food, alginate with snail mix) fed at three frequencies (given ad libitum on 4/4, 2/4, or 1/4 d) on juvenile survival and growth. The 4-d feeding regimens were repeated four times, giving a total of 16 d for the experiments. The experiments were conducted at two temperatures (22 degrees and 25 degrees C) under a 12 h light:12 h dark photoperiod. Juvenile growth rates increased with increasing feeding frequency for all food types. The most rapid growth rates occurred in the high-frequency lettuce treatments and the slowest growth rates in the low-frequency lettuce and alginate with snail mix treatments. Juvenile snails grew faster at 25 degrees than at 22 degrees C, and mortality was about twice as high at the lower temperature. Growth rates were used to provide a rough estimate of time to maturity, which was determined to take about twice as long at 22 degrees than at 25 degrees C. The results showed that lettuce is the best food if supplied in abundance, but effects on growth are very dependent on feeding frequency and temperature. We conclude that 25 degrees C is a more appropriate temperature for maintaining populations than 22 degrees C, that lettuce provides a suitable food source, and that food should be supplied continuously for husbandry and toxicity testing of populations of M. cornuarietis.

Effects of food type, feeding frequency, and temperature on juvenile survival and growth of Marisa cornuarietis (Mollusca: Gastropoda)

OpenAIRE

Selck, Henriette; Aufderheide, John; Pounds, Nadine; Staples, Charles; Caspers, Norbert; Forbes, Valery

2006-01-01

The present experiments are part of a larger study designed to investigate the influence of husbandry parameters on the life history of the ramshorn snail, Marisa cornuarietis, in order to identify suitable husbandry conditions for maintaining multi-generation populations in the laboratory for use in ecotoxicological testing. In this paper we focus on the effects of a combination of food types and feeding frequencies (i.e., the frequency with which the snails were offered food) on juvenile gr...