Free ion spectroscopy of einsteinium and comments on fermium
International Nuclear Information System (INIS)
Conway, J.G.
1979-01-01
The spectroscopy of einsteinium is presented and other relevant atomic data are cited to give an understanding of the status of that element. Information on the continuing work on einsteinium is given. A few comments on fermium are made. 6 figures, 1 table
Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium
International Nuclear Information System (INIS)
Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.
1984-01-01
The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal
Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei
Energy Technology Data Exchange (ETDEWEB)
Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)
2000-01-01
Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242Es was produced via the 233U(14N,5n)242Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (PDF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233U(14N,xn)247-xEs and 233U(15N,xn)248-xEs reactions were measured for 243Es, 244Es and 245Es at projectile energies between 80 MeV and 100 MeV.
Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei
International Nuclear Information System (INIS)
Shaughnessy, Dawn A.
2000-01-01
Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV
International Nuclear Information System (INIS)
Beitz, J.V.; Wester, D.W.; Williams, C.W.
1983-01-01
The interaction between 5f electron states of einsteinium 3+ ion and coordinated ligands in solution has been probed using laser-induced fluorescence. Aquo einsteinium 3+ ion was observed to fluoresce from its first excited J = 5 state in a broad-band peaking at 9260 wavenumbers. The observed fluorescence lifetimes were 1.05 microseconds and 2.78 microseconds in H 2 O and D 2 O (99+ % D atom), respectively. The non-radiative decay rates derived from the lifetime data are compared with previously reported data for Cm, Sm, Eu, Tb, and Dy aquo 3+ ions. The 5f actinide states exhibit substantially greater non-radiative decay rates than do lanthanide 4f states of similar energy gap. This provides evidence that actinide 5f electrons interact more strongly with their inner coordination sphere than do lanthanide ion 4f electrons. The fluorescence lifetime of einsteinium 3+ ion complexed with 1 formal di(2-ethylhexyl)orthophosphoric acid in h-heptane was 2.34 microseconds. 3 figures, 1 table
International Nuclear Information System (INIS)
Bauer, R.E.
1998-01-01
This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244
Infrared spectrum of curium-244
International Nuclear Information System (INIS)
Conway, J.G.; Blaise, J.; Verges, J.
1974-09-01
The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI 3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels
49 CFR 244.3 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 244.3 Section 244.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MERGERS, AND ACQUISITIONS OF CONTROL General § 244.3 Preemptive effect. Under 49 U.S.C. 20106, issuance of...
12 CFR 24.4 - Investment limits.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment limits. 24.4 Section 24.4 Banks and... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.4 Investment limits. (a) Limits on aggregate outstanding investments. A national bank's aggregate outstanding investments under...
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Travel abroad. 244.15 Section 244.15 Aliens... NATIONALS OF DESIGNATED STATES § 244.15 Travel abroad. (a) After the grant of Temporary Protected Status... to travel abroad. Permission to travel may be granted by the director pursuant to the Service's...
8 CFR 244.4 - Ineligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 244.4 Section 244.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.4 Ineligible aliens. An alien is ineligible for Temporary...
International Nuclear Information System (INIS)
Kuroda, P.K.; Myers, W.A.
1992-01-01
Re-examination of a vast amount of lead and xenon isotope data that have been accumulated since the Apollo 11 landing on the moon in July 1969 reveals that some of the lunar fines and breccia started to retain their radiogenic lead and fissiogenic xenon isotopes about 5 billion years ago when the ratios of 235 U and 244 Pu to 238 U in the early solar system were approximately 4 and 2 atoms per 10 atoms of 238 U, respectively. (author) 11 refs.; 8 figs.; 5 tabs
Nesaraja, C. D.
2017-12-01
Available information pertaining to the nuclear structure of ground and excited states for all known nuclei with mass numbers A=244 have been compiled and evaluated. The adopted level and decay schemes, as well as the detailed nuclear properties and configuration assignments based on experimental data are presented for these nuclides. When there are insufficient data, expected values from systematics of nuclear properties and/or theoretical calculations are quoted. Unexpected or discrepant experimental results are also noted. Information provided in 244U is tentative as it is from the possible production in the study of 1960Di03 of debris of the first large-scale thermonuclear test (Ivy Mike) of November 1, 1952 in the Pacific Ocean. No new experimental data are available for 244Np with the information for g.s Jπ considered tentative. Experimental work is needed for 244Np as theoretical work and systematics along with the Gallagher-Moszkowski rules that suggest either Jπ=2+ or 7-. Jπ = (7-) g.s has been considered by the evaluator due to population of high spin states in the beta decay study. In 244Pu, a new K isomer was identified and in addition rotational bands built on the isomer have been observed via the deep inelastic excitation. However, there has been no new measurements since the last evaluation to determine the ratio of the energy levels of the first 4+ state to the first 2+ state (E4+/E2+) in 244Pu that showed a discrepancy from a typical value of 3.333. In the current evaluation, the evaluator has considered the 110γ measured in the 244Np β-decay questionable. Further research into the determination of the gammas depopulating these levels is necessary. In 244Am, specifically the (d,p) transfer reaction and in the (n, γ) secondary γ's, there are a large number of gammas that are unplaced. Since its last measurement in 1966, the electron capture dataset has been updated with a tentative partial level scheme for 244Cm which also provided a new half
27 CFR 70.244 - Payroll period.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Payroll period. 70.244... Excise and Special (Occupational) Tax Limitations § 70.244 Payroll period. For purpose of determining the... established calendar period regularly used by the employer or other person levied upon for payroll or payment...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Applicability. 24.4 Section 24.4 Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE REQUIREMENTS FOR...; Maternal and Child Health Services; Social Services; Low-Income Home Energy Assistance; States' Program of...
48 CFR 244.403 - Contract clause.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause. 244.403... OF DEFENSE CONTRACT MANAGEMENT SUBCONTRACTING POLICIES AND PROCEDURES Subcontracts for Commercial Items and Commercial Components 244.403 Contract clause. (1) 252.225-7009, Restriction on Acquisition of...
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.19 Disposition. (a) Standard of review. FRA reviews an...
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.17 Procedures. (a) Each applicant shall file one...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFK244 (Link to dictyBase) - - - Contig-U16513-1 VFK244E (Link to Original site) VFK2...44F 710 VFK244Z 703 VFK244P 1393 VFK244E 1166 Show VFK244 Library VF (Link to library) Clone ID VFK2...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-B/VFK244Q.Seq.d/ Re...presentative seq. ID VFK244E (Link to Original site) Representative DNA sequence >VFK244 (VFK244Q) /CSM/VF/VFK2-B/VFK2...nsif*nlsnqnklnlfrk*k*ikkkn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFK244 (VFK2
Hazard Evaluation for 244-CR Vault
International Nuclear Information System (INIS)
GRAMS, W.H.
1999-01-01
This document presents the results of a hazards identification and evaluation performed on the 244-CR Vault to close a USQ (USQ No.TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed In HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities
Hazard Evaluation for 244-CR Vault
Energy Technology Data Exchange (ETDEWEB)
GRAMS, W.H.
1999-08-19
This document presents the results of a hazards identification and evaluation performed on the 244-CR Vault to close a USQ (USQ No.TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed In HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities.
Hazard evaluation for 244-AR vault facility
International Nuclear Information System (INIS)
BRAUN, D.J.
1999-01-01
This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
Tank 244A tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1994-01-01
The Double-Shell Tank (DST) System currently receives waste from the Single-Shell Tank (SST) System in support of SST stabilization efforts or from other on-site facilities which generate or store waste. Waste is also transferred between individual DSTs. The mixing or commingling of potentially incompatible waste types at the Hanford Site must be addressed prior to any waste transfers into the DSTs. The primary goal of the Waste Compatibility Program is to prevent the formation of an Unreviewed Safety Question (USQ) as a result of improper waste management. Tank 244A is a Double Contained Receiver Tank (DCRT) which serves as any overflow tank for the East Area Farms. Waste material is able to flow freely between the underground storage tanks and tank 244A. Therefore, it is necessary to test the waste in tank 244A for compatibility purposes. Two issues related to the overall problem of waste compatibility must be evaluated: Assurance of continued operability during waste transfer and waste concentration and Assurance that safety problems are not created as a result of commingling wastes under interim storage. The results of the grab sampling activity prescribed by this Tank Characterization Plan shall help determine the potential for four kinds of safety problems: criticality, flammable gas accumulation, energetics, and corrosion and leakage
244-AR Vault Interim Stabilization Project Plan
International Nuclear Information System (INIS)
LANEY, T.
2000-01-01
The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated
Preparation of additional supplies of 244Pu
International Nuclear Information System (INIS)
Bigelow, J.E.; Newman, E.; Alexander, C.W.
1985-01-01
In the mid-1970s, gram quantities of the man-made isotope 244 Pu were produced in high purity for basic research as a by-product of a program to prepare gram quantities of 252 Cf. Because 244 Pu is not produced in appreciable quantities in standard power reactor fuel, this nuclide has become extremely useful in the application of isotope dilution mass spectrometry (IDMS), a high-precision analytical technique, to problems of plutonium accountability in support of international safeguards agreements. Although only a small amount (a fraction of a microgram) is needed for each analysis, the present supply of certified nuclear reference standard SRM-996 is expected to last only an additional 3 to 5 years. Three options for producing additional supplies of this rare and valuable material were examined. The options encompassed the production of from 1 to 8.5 g during time spans of from 3 to 10 years. Unit costs ranged from $2300 to $7200 per mg of plutonium of >97% 244 Pu. While the paper concludes that the short-term option can be pursued along with further study of the longer-term options, this should not be regarded as an offer or a commitment on the part of the US Department of Energy (USDOE) to furnish the described material
Preparation of additional supplies of 244Pu
International Nuclear Information System (INIS)
Bigelow, J.E.; Newman, E.; Alexander, C.W.
1985-01-01
In the mid-1970s, gram quantities of the man-made isotope 244 Pu were produced in high purity for basic research as a by-product of a program to prepare gram quantities of 252 Cf. Because 244 Pu is not produced in appreciable quantities in standard power reactor fuel, this nuclide has become extremely useful in the application of isotope dilution mass spectrometry (IDMS), a high-precision analytical technique, to problems of plutonium accountability in support of international safeguards agreements. Although only a small amount (a fraction of a microgram) is needed for each analysis, the present supply of certified nuclear reference standard SRM-996 is expected to last only an additional 3 to 5 years. Three options for producing additional supplies of this rare and valuable material were examined. The options encompassed the production of from 1 to 8.5 g during time spans of from 3 to 10 years. Unit costs ranged from $2300 to $7200 per mg of plutonium of >97% 244 Pu. While the paper concludes that the short-term option can be pursued along with further study of the longer-term options, this should not be regarded as an offer or a commitment on the part of the U.S. Department of Energy (USDOE) to furnish the described material. (author)
12 CFR 19.244 - Automatic removal, suspension, and debarment.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Automatic removal, suspension, and debarment. 19.244 Section 19.244 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES... Services § 19.244 Automatic removal, suspension, and debarment. (a) An independent public accountant or...
10 CFR 600.244 - Termination for convenience.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Termination for convenience. 600.244 Section 600.244 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform... Requirements § 600.244 Termination for convenience. Except as provided in § 600.443 awards may be terminated in...
42 CFR 456.244 - Data sources for studies.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Data sources for studies. 456.244 Section 456.244 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES...: Medical Care Evaluation Studies § 456.244 Data sources for studies. Data that the committee uses to...
Crippling load test of Budd Pioneer Car 244, test 3.
2013-04-01
This report summarizes Test 3, a crippling load test on Budd Pioneer Car 244, conducted on June 28, 2011. Before the crippling load test, Transportation Technology Center, Inc., conducted two 800,000-pound (lb) quasi-static tests on Car 244 in accord...
40 CFR 52.244 - Motor vehicle emissions budgets.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Motor vehicle emissions budgets. 52.244... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.244 Motor vehicle emissions budgets. (a) Approval of the motor vehicle emissions budgets for the following ozone rate-of-progress and...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFH244 (Link to dictyBase) - - - - VFH244F (Link to Original s...ite) VFH244F 594 - - - - - - Show VFH244 Library VF (Link to library) Clone ID VFH244 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...is centranthoides cDNA clone hj81f04, mRNA sequence. 36 3e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFH244 (Link to dictyBase) - - - Contig-U16381-1 CFH244F (Link... to Original site) CFH244F 124 - - - - - - Show CFH244 Library CF (Link to library) Clone ID CFH244 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...ts) Value N AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, compl...ete sequence. 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict
49 CFR 244.21 - Compliance and Enforcement.
2010-10-01
... Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.21 Compliance and Enforcement. (a...
Magnetic susceptibility of 244Cm metal and 249Cf metal
International Nuclear Information System (INIS)
Fujita, D.K.; Parsons, T.C.; Edelstein, N.; Noe, M.; Peterson, J.R.
1975-07-01
The first magnetic susceptibility measurements made on the expanded fcc phase of 249 Cf metal are reported. Further measurements are needed on other Cf metal phases. Another measurement of the magnetic susceptibility of 244 Cm metal in a limited temperature range has been reported. The result does not agree with previously reported values. Further work is continuing on the synthesis of 244 Cm metal and 248 Cm metal and magnetic measurements on these samples. (auth)
International Nuclear Information System (INIS)
Esch, R.A.
1997-01-01
This document is the final report for the double-contained receiver tank (DCRT) 244-TX grab samples. Three grabs samples were collected from riser 8 on May 29, 1997. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in a table
Evaluation of nuclear data of 244Pu and 237Pu
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Konshin, V.A.
1995-10-01
The evaluation of nuclear data for 244 Pu and 237 Pu was made in the neutron energy region from 10 -5 eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for 244 Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author)
47 CFR 1.244 - Designation of a settlement judge.
2010-10-01
... Proceedings Presiding Officer § 1.244 Designation of a settlement judge. (a) In broadcast comparative cases... Administrative Law Judge for action. (c) If, in the discretion of the Chief Administrative Law Judge, it appears... Commission's Administrative Law Judges are eligible to act as settlement judges, except that an...
244-AR vault cooling water stream-specific report
International Nuclear Information System (INIS)
1990-08-01
The proposed wastestream designation for the 244-AR Vault cooling water wastestream is that this stream is not a dangerous waste, pursuant to the Washington (State) Administration Code (WAC) 173-303, Dangerous Waste Regulations. A combination of process knowledge and sampling data was used to make this determination. 21 refs., 6 figs., 7 tabs
A 244Pu spike reference material CBNM IRM-042A
International Nuclear Information System (INIS)
Verbruggen, A.; Gallet, M.; Hendrickx, F.; Bievre, P. de
1991-01-01
An highly enriched 244 Pu isotopic reference material (CBNM IRM-042a) has been prepared and certified for 244 Pu isotope concentration. The certified value of (2.257 7 ± 0.004 4).10 18 atoms 242 Pu.kg -1 of solution has been established by isotope dilution mass spectrometry. The plutonium isotopic composition has been determined by thermal ionization mass spectrometry and calibration of these measurements by means of synthetic 242 Pu/ 239 Pu mixtures. The isotopic reference material is supplied in a sealed glass ampoule containing approximately 10 g of a 5M nitric acid solution at an approximate concentration of 1 μg Pu per g solution. This isotopic reference material is part of a systematic CBNM programme to supply spike isotopic reference materials of various isotopes at different concentrations
Unsafe Coulomb excitation of $^{240-244}Pu$
Wiedenhöver, I; Hackman, L; Ahmad, I; Greene, J P; Amro, H; Carpenter, M P; Nisius, D T; Reiter, P; Lauritsen, T; Lister, C J; Khoo, T L; Siem, S; Cizewski, J A; Seweryniak, D; Uusitalo, J; Macchiavelli, A O; Chowdhury, P; Seabury, E H; Cline, D; Wu, C Y
1999-01-01
The high spin states of /sup 240/Pu and /sup 244/Pu have been investigated with GAMMASPHERE at ATLAS, using Coulomb excitation with a /sup 208/Pb beam at energies above the Coulomb barrier. Data on a transfer channel leading to /sup 242/Pu were obtained as well. In the case of /sup 244/Pu, the yrast band was extended to 34h(cross), revealing the completed pi i/sub 13/2/ alignment, a "first" for actinide nuclei. The yrast sequence of /sup 242/Pu was also extended to higher spin and a similar backbend was delineated. In contrast, while the ground state band of /sup 240/Pu was measured up to the highest rotational frequencies ever reported in the actinide region (~300 keV), no sign of particle alignment was observed. (11 refs).
8 CFR 244.11 - Renewal of application; appeal to the Board of Immigration Appeals.
2010-01-01
... of Immigration Appeals. 244.11 Section 244.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.11 Renewal of application; appeal to the Board of Immigration Appeals. If a charging document is served on the alien with a...
48 CFR 1852.244-70 - Geographic participation in the aerospace program.
2010-10-01
... the aerospace program. 1852.244-70 Section 1852.244-70 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.244-70 Geographic participation in the aerospace program. As prescribed in 1844.204-70, insert the following clause: Geographic Participation in the Aerospace Program (APR 1985) (a...
27 CFR 24.244 - Use of acid to stabilize standard wine.
2010-04-01
... standard wine. 24.244 Section 24.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.244 Use of acid to stabilize standard wine. Standard wine other than citrus wine, regardless of the fixed...
Operability test procedure for 244-U DCRT. Revision 1
International Nuclear Information System (INIS)
Erhart, M.F.
1995-01-01
This OPT will insure the operability of various systems and their general equipment, used in the operation of the 244-U DCRT. Systems that will be tested include the following: Leak Detection Systems; Heat Trace System; Vessel Temperature Measurement System; Dip Tube Water System; Weight Factor and Specific Gravity System; Instrument Air System; Vessel Liquid Level System; Vessel Liquid Transfer System; and Exhauster Differential Pressure Indicating Controller System. The tests will cover checks on equipment operation and electrical interlocks, but will not cover checks on associated annunciator alarms which are covered in a separate OTP
Unsafe Coulomb excitation of 240-244Pu
International Nuclear Information System (INIS)
Ahmad, I.; Amro, H.; Carpenter, M. P.; Chowdhury, P.; Cizewski, J.; Cline, D.; Greene, J. P.; Hackman, G.; Janssens, R. V. F.; Khoo, T. L.; Lauritsen, T.; Lister, C. J.; Macchiavelli, A. O.; Nisius, D. T.; Reiter, P.; Seabury, E. H.; Seweryniak, D.; Siem, S.; Uusitalo, J.; Wiedenhoever, I.; Wu, C. Y.
1999-01-01
The high spin states of 240 Pu and 244 Pu have been investigated with GAMMASPHERE at ATLAS, using Coulomb excitation with a 208 Pb beam at energies above the Coulomb barrier. Data on a transfer channel leading to 242 Pu were obtained as well. In the case of 244 Pu, the yrast band was extended to 34h b ar revealing the completed πi 13/2 alignment, a ''first'' for actinide nuclei. The yrast sequence of 242 Pu was also extended to higher spin and a similar backbend was delineated. In contrast, while the ground state band of 240 Pu was measured up to the highest rotational frequencies ever reported in the actinide region (approximately300 keV), no sign of particle alignment was observed. In this case, several observable such as the large B(E1)/B(E2) branching ratios in the negative parity band, and the vanishing energy staggering between the negative and positive parity bands suggest that the strength of octupole correlations increases with rotational frequency. These stronger correlations may well be responsible for delaying or suppressing the πi 13/2 particle alignment
Evaluation of two cases of 244Cm inhalation
International Nuclear Information System (INIS)
Parkinson, W.W.; Henley, L.C.; Goans, R.E.; Good, W.M.
1976-01-01
Chest and systematic burdens have been estimated for two employees who inhaled largely soluble compounds of 244 Cm. Chest burdens by whole body counting were: Case A, 28 nCi; Case B, 34 nCi. The urinary excretion of the employees appeared to conform to a series of exponentials similar to those reported for blood and whole body retention of Am in baboons. Accordingly, retention functions composed of a series of exponentials having 4, 12-17, and 72 day half-times were derived from urinary excretion and used to calculate body burdens, Case A - 7 nCi an Case B - 16 nCi. Cumulative fecal excretion by Case B was some 20 times that by Case A (63 nCi vs. 3.2) probably due to differences in deposition in the respiratory tract. Calculated organ doses for the first year were approximately 20% of recommended maxima
Crystal and solution spectroscopy of einsteinium
International Nuclear Information System (INIS)
Carnall, W.T.
1978-01-01
Work on spectra and electronic structure of Es 3+ is reviewed. Laser-excited fluorescence spectroscopy was used to study Es 3+ -doped LaCl 3 crystals; fluorescence transitions and lifetimes were determined. A complete ground-state splitting diagram was also constructed for Es 3+ : LaCl 3 . Some data on excited states of Fm 3+ are also included. 12 figures
Table of radionuclides (Vol. 5 - A = 22 to 244)
International Nuclear Information System (INIS)
Be, M.M.; Chiste, V.; Dulieu, C.; Mougeot, X.; Browne, E.; Chechev, V.; Kuzmenko, N.; Kondev, F.; Luca, A.; Galan, M.; Arinc, A.; Huang, X.
2010-01-01
methodologies to be used and the CD-ROM included with this monograph contains the evaluators' comments for each radionuclide in addition to the data tables included in the monograph. This volume includes the evaluation of the following radionuclides: 22 Na, 40 K, 75 Se, 124 Sb, 207 Bi, 211 Bi, 217 At, 222 Ra, 225 Ac, 228 Ra, 231 Th, 232 Th, 233 Th, 233 Pa, 234 Th, 235 U, 237 U, 238 Pu, 240 Pu, 241 Am, 242 Pu, 242 Am, 243 Am, 244 Am, 244 Am m . Primary recommended data comprise half-lives, decay modes, X-rays, gamma-rays, electron emissions, alpha -and beta- particle transitions and emissions, and their uncertainties
9 CFR 354.244 - Temperatures and cooling and freezing procedures.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Temperatures and cooling and freezing procedures. 354.244 Section 354.244 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... and cooling and freezing procedures. Temperatures and procedures which are necessary for cooling and...
49 CFR 244.11 - Contents of a Safety Integration Plan.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Contents of a Safety Integration Plan. 244.11 Section 244.11 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD...
8 CFR 244.5 - Temporary treatment benefits for eligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Temporary treatment benefits for eligible aliens. 244.5 Section 244.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... for eligible aliens. (a) Prior to the registration period. Prior to the registration period...
2010-10-01
... associates and consultants (Architect-engineer services). 52.244-4 Section 52.244-4 Federal Acquisition... consultants (Architect-engineer services). As prescribed in 44.204(b), insert the following clause: Subcontractors and Outside Associates and Consultants (Architect-Engineer Services) (AUG 1998) Any subcontractors...
Neutron spectra of /sup 242/Cm-Be and /sup 244/Cm-Be neutron sources
Energy Technology Data Exchange (ETDEWEB)
Kumar, A; Nagarajan, P S [Bhabha Atomic Research Centre, Bombay (India). Div. of Radiation Protection
1977-02-15
Neutron spectra of /sup 242/Cm-Be(..cap alpha..,n) and /sup 244/Cm-Be(..cap alpha..,n) sources have been calculated including the spontaneous fission contribution which is negligible for /sup 242/Cm and amounts to about 4% for /sup 244/Cm. The agreement of the present work with experimental results is poor.
Involvement of CD244 in regulating CD4+ T cell immunity in patients with active tuberculosis.
Directory of Open Access Journals (Sweden)
Bingfen Yang
Full Text Available CD244 (2B4 is a member of the signaling lymphocyte activation molecule (SLAM family of immune cell receptors and it plays an important role in modulating NK cell and CD8(+ T cell immunity. In this study, we investigated the expression and function of CD244/2B4 on CD4(+ T cells from active TB patients and latent infection individuals. Active TB patients had significantly elevated CD244/2B4 expression on M. tuberculosis antigen-specific CD4(+ T cells compared with latent infection individuals. The frequencies of CD244/2B4-expressing antigen-specific CD4(+ T cells were significantly higher in retreatment active TB patients than in new active TB patients. Compared with CD244/2B4-dull and -middle CD4(+ T cells, CD244/2B4-bright CD4(+ T cell subset had significantly reduced expression of IFN-γ, suggesting that CD244/2B4 expression may modulate IFN-γ production in M. tuberculosis antigen-responsive CD4(+ T cells. Activation of CD244/2B4 signaling by cross-linking led to significantly decreased production of IFN-γ. Blockage of CD244/2B4 signaling pathway of T cells from patients with active TB resulted in significantly increased production of IFN-γ, compared with isotype antibody control. In conclusion, CD244/2B4 signaling pathway has an inhibitory role on M. tuberculosis antigen-specific CD4(+ T cell function.
Table of radionuclides (Vol.3 - Α = 3 to 244)
International Nuclear Information System (INIS)
Be, M.M.; Chiste, V.; Dulieu, Ch.; Browne, E.; Baglin, C.; Chechev, V.; Kuzmenko; Helmer, R.; Kondev, F.; MacMahon, T.D.; Lee, K.B.
2006-01-01
evaluating nuclear data is on-going and the recommended values are updated on the LNHB web site at http://www.nucleide.org/DDEP WG/DDEPdata.htm. The publication of further volumes of Monographie 5 is envisaged as and when necessary to add new radionuclide data or re-evaluations in a more permanent format that can be referenced easily. Although other data sets may still be used when evaluating radionuclide activity, use of this common, recommended data set should help to reduce the uncertainties in activity evaluations and lead to more coherent results for comparisons. This volume includes the evaluation of the following radionuclides: 3 H, 55 Fe, 56 Co, 60 Co, 63 Ni, 65 Zn, 79 Se, 90 Sr, 90 Y, 90 Y m , 108 Ag, 108 Ag mn 111 In, 125 Sb, 137 Cs, 153 Sm, 159 Gd, 203 Pb, 233 Pa, 233 Th, 234 U, 236 Np, 236 Np m , 237 U, 238 U, 242 Cm, 243 Am, 244 Cm. Primary recommended data comprise half-lives, decay modes, X-rays, gamma-rays, electron emissions, alpha- and beta-particle transitions and emissions, and their uncertainties. (authors)
Design analysis report for the 244-AR vault Interim Stabilization interior transfer system
International Nuclear Information System (INIS)
CARLSON, A.B.
2002-01-01
The purpose of this calculation note is to verify that the 244-AR Vault Interior Transfer System piping installed in the vault meets ASME B31.3 code requirements. This calculation also evaluates the pipe support loads
Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm
International Nuclear Information System (INIS)
Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.
1977-01-01
An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience
Isotopic yield in cold binary fission of even-even 230-244U isotopes
International Nuclear Information System (INIS)
Cyriac, Annu; Krishnan, Sreejith; Santhosh, K.P.
2017-01-01
The binary fission of even-even 230-244 U isotopes has been studied using the concept of cold reaction valley which was introduced in relation to the structure of minima in the so called driving potential
Above-threshold structure in {sup 244}Cm neutron-induced fission cross section
Energy Technology Data Exchange (ETDEWEB)
Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)
1997-03-01
The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)
The early solar system abundance of 244Pu as inferred from the St. Severin chondrite
International Nuclear Information System (INIS)
Hudson, G.B.; Kennedy, B.M.; Podosek, F.A.; Hohenberg, C.M.
1987-03-01
We describe the analysis of Xe released in stepwise heating of neutron-irradiated samples of the St. Severin chondrite. This analysis indicates that at the time of formation of most chondritic meteorites, approximately 4.56 x 10 9 years ago, the atomic ratio of 244 Pu/ 238 U was 0.0068 +- 0.0010 in chondritic meteorites. We believe that this value is more reliable than that inferred from earlier analyses of St. Severin. We feel that this value is currently the best available estimate for the early solar system abundance of 244 Pu. 42 refs., 2 tabs
The early solar system abundance of /sup 244/Pu as inferred from the St. Severin chondrite
Energy Technology Data Exchange (ETDEWEB)
Hudson, G.B.; Kennedy, B.M.; Podosek, F.A.; Hohenberg, C.M.
1987-03-01
We describe the analysis of Xe released in stepwise heating of neutron-irradiated samples of the St. Severin chondrite. This analysis indicates that at the time of formation of most chondritic meteorites, approximately 4.56 x 10/sup 9/ years ago, the atomic ratio of /sup 244/Pu//sup 238/U was 0.0068 +- 0.0010 in chondritic meteorites. We believe that this value is more reliable than that inferred from earlier analyses of St. Severin. We feel that this value is currently the best available estimate for the early solar system abundance of /sup 244/Pu. 42 refs., 2 tabs.
HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy
Directory of Open Access Journals (Sweden)
Fahrmann Michael G.
2014-01-01
Full Text Available HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability as they pertain to the intended use in rings and seals of advanced gas turbines.
Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu
Energy Technology Data Exchange (ETDEWEB)
Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1995-10-01
The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).
The measurement of prompt neutron spectrum in spontaneous fission of {sup 244}Cm
Energy Technology Data Exchange (ETDEWEB)
Batenkov, O.I.; Boykov, G.S.; Drapchinsky, L.V.; Majorov, M.Ju.; Trenkin, V.A. [V.G. Khlopin Radium Inst., Saint Petersburg (Russian Federation)
1997-03-01
Under the Program of Measurements of Prompt Fission Neutron Spectra of Minor Actinides for Transmutation Purposes the integral neutron spectrum in spontaneous fission of {sup 244}Cm has been measured by the time-of-flight method in the energy range of 0.1-15 MeV relative to the standard neutron spectrum in {sup 252}Cf spontaneous fission. Essential attention was paid to revealing of possible systematic errors. It is shown, that the {sup 244}Cm spectrum shape may be well described by using Mannhart evaluation with appropriate parameter of Maxwell temperature T{sub M} = 1.37 MeV. (author)
Efforts to save 244Pu in Mark 18A targets for use in international safeguards measurements
International Nuclear Information System (INIS)
Goldberg, Steven A.; Cappis, John; Clarke, Stephanie; Whitesel, Robert
2001-01-01
Full text: The Office of Arms Control and Nonproliferation and the Office of Security and Emergency Operations are working collaboratively to evaluate the disposition of a large quantity of the 244 Pu isotope contained in 65 Mark ISA targets at the Savannah River Site (SRS). 244 Pu is used as a standard reference material for plutonium analytical measurements required for both domestic and international safeguards. 244 Pu is particularly valuable for high accuracy measurements of plutonium in small samples containing trace quantities of plutonium (environmental analysis) and for measurements of material through-put in bulk processing facilities handling large volumes of plutonium and plutonium-bearing materials. In October 2000, an assessment team was tasked by the U.S. Department of Energy (DOE) Under Secretary to evaluate pathways and costs for the chemical separation and isotopic enrichment of the 244 Pu identified in the targets. Even though the target materials have recently been designated as a National Resource, they are scheduled for waste disposal unless funds can be identified and assigned to the project. Background information on the Mark ISA targets and a review of the assessment process are presented below to inform other organizations and governments of current efforts to examine potential disposition options and to solicit international cooperation for the extraction of the 244 Pu. Background - The United States possesses the bulk of the world's supply of the rare isotope 244 Pu. This isotope was produced by extremely long neutron irradiation of 242 Pu in a high-flux reactor during experiments used primarily to create isotopes of medical interest. In its separated enriched form, 244 Pu is regarded as the most accurate and desirable spike for safeguards, forensics, and environmental analysis of plutonium, allowing the simultaneous measurement of a sample for isotopic abundances and elemental concentration. Such measurements are a critical component of
Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction
Energy Technology Data Exchange (ETDEWEB)
Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)
27 CFR 28.244a - Shipment to a customs bonded warehouse.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to a customs... Export Consignment § 28.244a Shipment to a customs bonded warehouse. Distilled spirits and wine withdrawn for shipment to a customs bonded warehouse shall be consigned in care of the customs officer in charge...
Indian Academy of Sciences (India)
tribpo
et al. 1994) or by using high frequency chopping mechanism (like the ZIMPOL, Povel. 1995) which eliminates seeing induced spurious polarisation signals. In an earlier attempt at the KTT (Ananth et al. 1994), a chopping scheme was utilised with a peltier cooled CCD detector achieving a rate of 0.5 Hz. However, this CCD ...
48 CFR 252.244-7000 - Subcontracts for Commercial Items and Commercial Components (DoD Contracts).
2010-10-01
... under this contract: (a) 252.225-7009 Restriction on Acquisition of Certain Articles Containing... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracts for Commercial Items and Commercial Components (DoD Contracts). 252.244-7000 Section 252.244-7000 Federal...
Estimation of 244Cm intake by bioassay measurements following a contamination incident
International Nuclear Information System (INIS)
Thein, M.; Bogard, J.S.; Eckerman, K.F.
1990-01-01
An employee was contaminated with radioactive material consisting primarily of 244 Cm and 246 Cm as a consequence of handling a curium nitrate solution at a reprocessing facility. In vivo gamma analysis and in vitro (urine and fecal) bioassay measurements were performed. A sample of the curium solution from the workplace was obtained to confirm that the nitrate was the chemical form and to identify the isotopes of curium present. The mass ratio of 244 Cm/ 246 Cm was determined to be 91 to 7. Observed excretion rates were consistent with available information on curium. The results of the in vivo and in vitro measurements are presented and intake estimates for the incident are developed. (author) 11 refs.; 3 figs.; 2 tabs
Bioaccumulation, distribution, and dose of 241Am, 244Cm, and 238Pu in developing fish embryos
International Nuclear Information System (INIS)
Till, J.E.; Frank, M.L.
1977-01-01
The dose from several actinide elements to a sensitive stage in the development of one type of aquatic biota, the fish egg, was assessed. An investigation was made of the uptake and distribution of 241 Am, 244 Cm and 238 Pu by developing embryos of fish. Eggs from ripe carp, Cyprinos carpio, that had been spawned in the laboratory were placed in dishes containing 241 Am(III)- 244 Cm(III)-, or 238 Pu(IV)-citrate in solution at an activity concentration of approximately 10 -3 μCi/ml. Samples of eggs were taken at seven intervals during the 72-hour period of embryogenesis. Egg contents were separated from the membrane prior to analysis to quantify the activity that penetrated the chorion. Autoradiographs of 16-μm thick egg sections confirmed that alpha radioactivity was present in the egg contents and permitted the distribution of activity to be determined. Concentration factors were calculated based on activity ratios for the egg contents (excluding the chorion) over the development period. Maximum concentration factors occurred at hatching and were found to be 25, 40 and 3 for 241 Am, 244 Cm and 238 Pu, respectively. Collectively, these data were used to estimate the dose from americium, curium and plutonium in natural ecosystems to developing fish eggs which have similar embryological characteristics as carp
OXA-244-Producing Escherichia coli Isolates, a Challenge for Clinical Microbiology Laboratories.
Hoyos-Mallecot, Yannick; Naas, Thierry; Bonnin, Rémy A; Patino, Rafael; Glaser, Philippe; Fortineau, Nicolas; Dortet, Laurent
2017-09-01
OXA-244 is a single-point-mutant derivative of OXA-48 displaying reduced carbapenemase activity. Here, we report the microbiological features of seven OXA-244-producing Escherichia coli isolates. Only one isolate grew on ChromID Carba Smart medium (bioMérieux), but six of the seven isolates grew on ChromID extended-spectrum-β-lactamase (ESBL) medium (bioMérieux), as they coproduced an ESBL and/or a plasmid-encoded cephalosporinase. The production of a carbapenemase was detected in 57.1%, 71.4%, 71.4%, and 100% of the E. coli isolates using the Carba NP test, the Rapidec Carba NP test (bioMérieux), a matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS) hydrolysis assay (Bruker), and the OXA-48 K-SeT assay (Coris BioConcept), respectively. Our results indicate that OXA-244-producing E. coli isolates are difficult to detect, which may lead to their silent spread. Copyright © 2017 American Society for Microbiology.
International Nuclear Information System (INIS)
YEH, T.
2002-01-01
This document reports on the analysis, testing and conclusions of the software verification and validation for the 244-AR Vault Interim Stabilization ventilation system. Automation control system will use the Allen-Bradley software tools for programming and programmable logic controller (PLC) configuration. The 244-AR Interim Stabilization Ventilation System will be used to control the release of radioactive particles to the environment in the containment tent, located inside the canyon of the 244-AR facility, and to assist the waste stabilization efforts. The HVAC equipment, ducts, instruments, PLC hardware, the ladder logic executable software (documented code), and message display terminal are considered part of the temporary ventilation system. The system consists of a supply air skid, temporary ductwork (to distribute airflow), and two skid-mounted, 500-cfm exhausters connected to the east filter building and the vessel vent system. The Interim Stabilization Ventilation System is a temporary, portable ventilation system consisting of supply side and exhaust side. Air is supplied to the containment tent from an air supply skid. This skid contains a constant speed fan, a pre-filter, an electric heating coil, a cooling coil, and a constant flow device (CFD). The CFD uses a passive component that allows a constant flow of air to pass through the device. Air is drawn out of the containment tent, cells, and tanks by two 500-cfm exhauster skids running in parallel. These skids are equipped with fans, filters, stack, stack monitoring instrumentation, and a PLC for control. The 500CFM exhaust skids were fabricated and tested previously for saltwell pumping activities. The objective of the temporary ventilation system is to maintain a higher pressure to the containment tent, relative to the canyon and cell areas, to prevent contaminants from reaching the containment tent
Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986
International Nuclear Information System (INIS)
Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.
1986-04-01
This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances
The comparative carcinogenicity of 239Pu, 241Am, and 244Cm in the rat
International Nuclear Information System (INIS)
Taylor, D.M.
1986-01-01
Five completed studies compared the effects of 239 Pu, 241 Am, and 244 Cm in August-Marshall F 1 hybrid rats. Osteosarcomas were observed in all the treated groups but not in any control group. More than 70% of the osteosarcomas occurred in the lumber or thoracic vertebrae, the femur, or the tibia with all three radionuclides, but there is an indication that a smaller proportion of the tumors arises in the vertebrae after 239 Pu administration than after either of the other two radionuclides. Risk coefficients are 239 Pu, 487 +- 52; 241 Am, 175 +- 32; 244 Cm, 162 +- 45. These risk coefficients suggest that in the rat 239 Pu is about three times more effective for bone tumor induction than the other two radionuclides. A small number of leukemias, mainly of myelogenous origin, and a small number of other soft-tissue tumors were observed in the radionuclide-injected groups. No leukemias were observed in many hundreds of control animals. 14 refs., 4 tabs
2018-02-01
Retracted Review article: Nucleophagy in Human Disease: Beyond the Physiological Role. [Tohoku J. Exp. Med., 2018, 244 (1), 75-81. doi: 10.1620/tjem.244.75.] The above Review article was published online on January 27, 2018. Soon after its publication (on February 1, 2018), Dr. Nian Fu and Prof. Linxi Chen informed the Editor-in-Chief, The Tohoku Journal of Experimental Medicine (TJEM), about serious violation of publication ethics. Indeed, Dr. Nian Fu and Prof. Linxi Chen were astonished to find their names as coauthors of this Review article, because they were not involved in the submission process of this Review article and they do not know any of other coauthors. In addition, the Review article is similar to their unpublished manuscript. After a thorough investigation in accordance with the recommendations of the Committee on Publication Ethics (COPE), the Editor-in-Chief of TJEM decided to retract this Review article. The reasons for Retraction are summarized below: forged authors and an unexpected case of plagiarism. Forged authors: Dr. Nian Fu and Prof. Linxi Chen were added as co-authors of the Review article without their knowledge. In fact, the signature provided by Prof. Linxi Chen is apparently different from the signature of a coauthor, named Linxi Chen, on the AUTHORS’ RESPONSIBILITY FORM, provided by the corresponding author of the Review article. More critically, the signature provided by Dr. Nian Fu is completely different from the signature of Nian Fu, because the Chinese characters are different between the two signatures. In addition, the replies from three authors (Ming Zhou, Hongwen Ji and Yong Xia) clearly indicate that they misunderstand the identity of Dr. Nina Fu. We also attempted to contact two authors, named Nian Fu and Linxi Chen, via e-mail. As expected, the forged authors did not respond to our inquiries, despite that their e-mail addresses appear to be active. An unexpected case of plagiarism: This Review article is similar to the
Estimation of radioactive contaminants in Cm242 and Cm244 isotopic fuels
International Nuclear Information System (INIS)
Terent'ev, V.P.; Makarenko, A.I.
1972-01-01
The radiation properties of Cm 242 and Cm 244 preparations and the effect on them of possible contaminants are considered. One of the most important requirements for K alpha active fuels for radioisotope thermoelectric batteries is ensuring a low ionizing radiation background. In determining the effect of impurities on the radiation properties of a preparation, quantitative evaluation of certain factors is sufficient. In a Cm 242 preparation it is possible to show that Am 241 and Cm 243 are undesirable impurities. The presence of Am 241 increases the soft gamma output by 20%. The presence of Cm 243 may double the dose rate from an unshielded preparation and increase the hard gamma output 10-fold. The properties of Cm 242 preparations deteriorate when Am 243 and Cm 243 are present
Production and testing of 244Cm-labeled fluorescent polystyrene latex microspheres
International Nuclear Information System (INIS)
Guilmette, R.A.; Mueller, H.L.; Brodbeck, R.D.
1988-01-01
To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating 244 Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to μm-size (AMAD) 239 Pu0 2 particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)
Production and testing of {sup 244}Cm-labeled fluorescent polystyrene latex microspheres
Energy Technology Data Exchange (ETDEWEB)
Guilmette, R A; Mueller, H L; Brodbeck, R D
1988-12-01
To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating {sup 244}Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to {mu}m-size (AMAD) {sup 239}Pu0{sub 2} particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)
[The effect of occupational stress on depression symptoms among 244 policemen in a city].
Gu, Guizhen; Yu, Shanfa; Wu, Hui; Zhou, Wenhui
2015-10-01
To explore the influence of occupational stress related factors on depression symptoms among 244 policemen in a city in China. In May 2011, 287 policemen from a city public security bureau were recruited to this survey by cluster sampling method. We deleted questionnaires which include missing variables on demographic characteristics and factors associated with occupational stress questionnaires which include over 3 missing items. 244 policemen were included in this study. Depression symptoms and occupational stressors were measured using Chinese version of depression self-reported questionnaire, job content questionnaire, Chinese version of effort-reward imbalances questionnaire, job hazard scale and occupational stress inventory. Depression symptom scores and the relationship between the variables and occupational stress were analyzed by Spearman correlation analysis and multiple regression analysis. The Median (P25-P75) of depression symptom scores of all respondents was 16.50 (11.00-25.00). 144 were policemen with no depression symptoms and 100 were with depression symptoms. The median (P25-P75) of depression symptoms scores among policemen with length of serves stress and negative affectivity among policemen with depression symptoms were 17.00 (8.00-26.00), 16.00 (11.00-24.50), 19.00 (12.00-27.00), and 12.00 (6.25-15.00), respectively, which were higher than those with no depression symptoms (24.00 (22.00-25.00), 8.00 (5.00-13.00), 8.00 (6.00-10.00), 1.00 (0-2.75)), and the differences were significant (Z=3.82, 5.39, 5.15, 6.41, Pstress, negative affectivity and job hazards scores. Correlations coefficient were 0.44, 0.28, 0.28, 0.33, 0.38, 0.44, and 0.38, respectively (Pstress and negative affectivity had bigger contribution on the depression symptoms scores. The standard regression coefficient was -0.46, 0.19 and 0.13, respectively (Pstress, negative affectivity and job hazards scores were the inducement of depression symptoms for policemen. To reduce the
29 CFR 779.244 - “Covered enterprises” of interest to retailers of goods or services.
2010-07-01
... part 776 of this chapter. The statutory definitions of enterprises of interest to retailers under the... Apply; Enterprise Coverage Covered Retail Enterprise § 779.244 “Covered enterprises” of interest to retailers of goods or services. Retailers of goods or services are primarily concerned with the enterprises...
30 CFR 250.244 - What geological and geophysical (G&G) information must accompany the DPP or DOCD?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... Operations Coordination Documents (docd) § 250.244 What geological and geophysical (G&G) information must accompany the DPP or DOCD? The following G&G information must accompany your DPP or DOCD: (a) Geological...
Changing trends in blood transfusion: an analysis of 244,013 hospitalizations.
Shehata, Nadine; Forster, Alan; Lawrence, Nadine; Rothwell, Deanna M; Fergusson, Dean; Tinmouth, Alan; Wilson, Kumanan
2014-10-01
Identifying recipients of blood transfusion and the trends in transfusion are needed to properly identify and target clinical services in need of patient blood management strategies. We determined the proportion of admissions to each clinical service that received blood, the mean number of units utilized, and the 5-year trends in utilization. We used a large administrative database, a repository for three campuses of one university-affiliated hospital, and included all adults that were hospitalized from November 1, 2006, to June 2012. The data were analyzed as the proportion of admissions transfused and the mean number units transfused per admission. Of 244,013 hospitalizations, 38,265 received at least one transfusion (29,165 for red blood cells [RBCs], 6760 for plasma, and 5795 for platelets [PLTs]). Although there has been a gradual decrease in the mean number of RBCs transfused (percent change, -9.8%; p = 0.002), an increase in the proportion of admissions receiving RBCs (17.2% increase, p conservation strategies. © 2014 AABB.
The synthesis of superheavy nuclei in the 48Ca + 244Pu reaction
International Nuclear Information System (INIS)
Oganesyan, Yu.Ts.; Utenkov, V.K.; Lobanov, Yu.V.
1999-01-01
In the bombardment of a 244 Pu target with 48 Ca ions, we observed a decay sequence consisting of an implanted heavy atom, three subsequent α-decays, and a spontaneous fission, all correlated in time and position. The measured α-energies and corresponding time intervals were: E α = 9.71 MeV (Δt = 30.4 s), 8.67 MeV (Δt = 15.4 min) and 8.83 MeV (Δt = 1.6 min); for the spontaneous fission (Δt = 16.5 min) the total deposited energy was approximately 190 MeV. The large alpha-particle energies together with the long decay times and spontaneous fission terminating the chain offer evidence of the decay of nuclei with high atomic numbers. This decay chain is a good candidate for originating from the α-decay of the parent nucleus 289 114, produced in the 3n-evaporation channel with a cross section of about 1 pb. The significant increase in the lifetimes of the new Z = 112 and 110 daughters of the Z = 114 nuclide (by a factor of ∼ 10 6 ) with respect to the known heaviest isotopes of elements 112 and 110 can be considered as a direct proof of the existence of the 'island of stability' of superheavy elements
Isotopic composition of primary xenon and the fission of Pu-244
Energy Technology Data Exchange (ETDEWEB)
Levskii, L K
1983-05-01
The hypothesis that the origin of xenon on earth is due to the fission of uranium and/or transuranium elements is examined. The isotopic composition of primary xenon on earth is calculated using a model (Levskii, 1980) of the isotopic composition of rare gases which is based on the hypothesis of the heterogeneity of the isotopic composition of the elements of the solar system. The isotopic composition of fission-produced xenon in the atmosphere and solid earth is determined to correspond to the abundance of xenon isotopes as a result of the spontaneous fission of Pu-244 (half-life of 8.2 x 10 to the 7th years). The amount of fission-produced xenon in the atmosphere is shown to amount to about 30 percent (Xe-136). Under certain conditions, the degree of the degassing of the solid earth for xenon is 25 percent, which corresponds to a ratio of Kr-84/Xe-130 45 for the earth as a whole.
Thomson, Jodi M; Distler, Anne M; Bonomo, Robert A
2007-10-09
Amino acid changes at Ambler position R244 in class A TEM and SHV beta-lactamases confer resistance to ampicillin/clavulanate, a beta-lactam/beta-lactamase inhibitor combination used to treat serious infections. To gain a deeper understanding of this resistance phenotype, we investigated the activities of sulbactam and two novel penem beta-lactamase inhibitors with sp2 hybridized C3 carboxylates and bicyclic R1 side chains against a library of SHV beta-lactamase variants at the 244 position. Compared to SHV-1 expressed in Escherichia coli, all 19 R244 variants exhibited increased susceptibility to ampicillin/sulbactam, an important difference compared to ampicillin/clavulanate. Kinetic analyses of SHV-1 and three SHV R244 (-S, -Q, and -L) variants revealed the Ki for sulbactam was significantly elevated for the R244 variants, but the partition ratios, kcat/kinact, were markedly reduced (13 000 -->
Energy Technology Data Exchange (ETDEWEB)
Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)
1997-03-01
The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)
International Nuclear Information System (INIS)
Carrell, D.J.
1997-01-01
This document serves as a notice of construction (NOC), pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to construct, pursuant to 40 Code of Federal Regulations (CFR) 61.96, a portable exhauster at the 244-AR Vault. The exhauster would be used during air jetting of accumulated liquids from the cell sumps into the tanks and to make transfers among the tanks within the vault when needed. The 244-AR Vault is considered to be a double-contained receiver tank (OCRT) based on its functional characteristics, although it is not listed as one of the five designated DCRTs in the 200 Area Tank Farm systems. Process operations at the vault have been inactive since 1978 and the vault's two stacks have not operated since 1993. Since cessation of vault operations an extremely large amount of rain water and snow melt have accumulated in the cell sumps. The water level in the sumps is substantially above their respective operating levels and there is concern for leakage to the environment through containment failure due to corrosion from backed-up sump liquid. Active ventilation is required to provide contamination control during air jetting operations within the vault. It has been determined that it would not be cost effective to repair the existing exhaust systems to an operational condition; thus, a portable exhauster will be used to support the intermittent operations
Energy Technology Data Exchange (ETDEWEB)
Costa, Danilo Manuel Cerqueira; Salvadori, Priscila Silveira; Monjardim, Rodrigo da Fonseca; Bretas, Elisa Almeida Sathler; Torres, Lucas Rios; Caldana, Rogerio Pedreschi; Shigueoka, David Carlos; Medeiros, Regina Bitelli; D' ippolito, Giuseppe, E-mail: giuseppe_dr@uol.com.br [Universidade Federal de Sao Paulo (EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Departamento de Diagnostico por Imagem
2013-06-15
Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)
CM-244 as multiplier and breeder in a ThO/sub 2/ hybrid blanket driven by a (D,T) source
International Nuclear Information System (INIS)
Sahin, S.; Al-Kusayer, T.A.
1986-01-01
The safeguard aspects of Cm-244 - a nuclear waste product in LWRs - in a cylindrical hybrid blanket, driven by a (D,T) fusion neutron source have been analyzed. Cm-244 is investigated for two different applications: 1) as a neutron multiplier between the first wall and the fuel zone in a blanket with ThO/sub 2/; and 2) as a component of the mixed fuel, ThO/sub 2/-Cm/sup 244/O/sub 2/, used for power flattening in a hybrid blanket. The calculations show that a relatively small driven with 100 MW/sub th/ fusion power could produce about 5 kg/year Cm-245, enough to provide nuclear fuel for up to 50 explosives. The study suggests an extension of the safe-guarding regulations prior to the commercial introduction of fusion reactors in the energy market
2012-05-08
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-74,850; TA-W-74,850A] StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc., 1250 H Street, Greeley, CO; Amended... workers and former workers of StarTek USA, Inc., Greeley, Colorado. The Department's notice of...
Directory of Open Access Journals (Sweden)
Irina Yu. Petrushanko
2017-10-01
Full Text Available Our previous findings suggested that reversible thiol modifications of cysteine residues within the actuator (AD and nucleotide binding domain (NBD of the Na,K-ATPase may represent a powerful regulatory mechanism conveying redox- and oxygen-sensitivity of this multifunctional enzyme. S-glutathionylation of Cys244 in the AD and Cys 454-458-459 in the NBD inhibited the enzyme and protected cysteines’ thiol groups from irreversible oxidation under hypoxic conditions. In this study mutagenesis approach was used to assess the role these cysteines play in regulation of the Na,K-ATPase hydrolytic and signaling functions. Several constructs of mouse α1 subunit of the Na,K-ATPase were produced in which Cys244, Cys 454-458-459 or Cys 244-454-458-459 were replaced by alanine. These constructs were expressed in human HEK293 cells. Non-transfected cells and those expressing murine α1 subunit were exposed to hypoxia or treated with oxidized glutathione (GSSG. Both conditions induced inhibition of the wild type Na,K-ATPase. Enzymes containing mutated mouse α1 lacking Cys244 or all four cysteines (Cys 244-454-458-459 were insensitive to hypoxia. Inhibitory effect of GSSG was observed for wild type murine Na,K-ATPase, but was less pronounced in Cys454-458-459Ala mutant and completely absent in the Cys244Ala and Cys 244-454-458-459Ala mutants. In cells, expressing wild type enzyme, ouabain induced activation of Src and Erk kinases under normoxic conditions, whereas under hypoxic conditions this effect was inversed. Cys454-458-459Ala substitution abolished Src kinase activation in response to ouabain treatment, uncoupled Src from Erk signaling, and interfered with O2-sensitivity of Na,K-ATPase signaling function. Moreover, modeling predicted that S-glutathionylation of Cys 458 and 459 should prevent inhibitory binding of Src to NBD. Our data indicate for the first time that cysteine residues within the AD and NBD influence hydrolytic as well as receptor
International Nuclear Information System (INIS)
Akhter, Nasima; Shiba, Kazuhiro; Ogawa, Kazuma; Kinuya, Seigo; Nakajima, Kenichi; Mori, Hirofumi
2007-01-01
In this study, the (+)-enantiomer of radioiodinated 2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 125 I]-p-iodovesamicol] [(+)-[ 125 I]pIV], which is reported to bind with high affinity to σ-1 receptors in vitro, was tested for its usefulness in imaging σ-1 receptors in the central nervous system (CNS) in vivo. In biodistribution studies, significant amounts (approximately 3% of the injected dose) of (+)-[ 125 I]pIV accumulated in rat brain, and its retention was prolonged. In blocking studies, the accumulation of (+)-[ 125 I]pIV in the rat brain was significantly reduced by the coadministration of σ-ligands such as pentazocine (5.0 μmol), haloperidol (0.5 μmol) or SA4503 (0.5 μmol). The blocking effect of pentazocine (selective σ-1 ligand) was similar to the blocking effects of SA4503 and haloperidol [nonselective σ (σ-1 and σ-2) ligands]. Ex vivo autoradiography of the rat brain at 45 min following intravenous injection of (+)-[ 125 I]pIV showed high localization in brain areas rich in σ-1 receptors. Thus, the distribution of (+)-[ 125 I]pIV was thought to bind to σ-1 receptors in the CNS in vivo. These results indicate that radioiodinated (+)-pIV may have the potential to image σ-1 receptors in vivo
Evolving role of 2B4/CD244 in T and NK cell responses during virus infection
Directory of Open Access Journals (Sweden)
Stephen Noel Waggoner
2012-12-01
Full Text Available The signaling lymphocyte activation molecule (SLAM family receptor, 2B4/CD244, was first implicated in anti-viral immunity by the discovery that mutations of the SLAM-associated protein, SAP/SH2D1A, impaired 2B4-dependent stimulation of T and natural killer (NK cell anti-viral functions in X-linked lymphoproliferative (XLP syndrome patients with uncontrolled Epstein-Barr virus (EBV infections. Engagement of 2B4 has been variably shown to either activate or inhibit lymphocytes which express this receptor. While SAP expression is required for stimulatory functions of 2B4 on lymphocytes, it remains unclear whether inhibitory signals derived from 2B4 can predominate even in the presence of SAP. Regardless, mounting evidence suggests that 2B4 expression by NK and CD8 T cells is altered by virus infection in mice as well as in humans, and 2B4-mediated signaling may be an important determinant of effective immune control of chronic virus infections. In this review, recent findings regarding the expression and function of 2B4 as well as SAP on T and NK cells during virus infection is discussed, with a focus on the role of 2B4-CD48 interactions in crosstalk between innate and adaptive immunity.
Bordes, J; Loheas, D; Benois, A
2015-01-01
The pratice of intensive care in Africa is marked by a wide variety of health care delivery. Only a few centers offer specialized intensive care units, as cardiac or neurological units. That may explain the need for aeromedical evacuations for patients whose condition exceeds local capacity. Our objective was to assess whether the proportion of patients admitted to intensive care and evacuated had increased between 1997 and 2013 in a developing country, Djibouti. We examined the activity register of Bouffard Hospital intensive care unit in Djibouti to determine the number and characteristics of patients evacuated by air ambulance during a 16 years period. From January 1997 to December 2013, a total of 244 patients were evacuated. The evacuation rate was 5.74ù of the patients admitted to the entire duration of the study. The rate of patients evacuated was not different between 1997 and 2013 (5,69ù versus 8,33ù respectively, p = 0,269). However, the rate of djiboutian evacuated patients was statistically different between 1997 and 2013 (0,96ù versus 4,46ù, p = 0,02). The main causes were severe trauma injuries, cardiovascular diseases and neurological diseases. The aeromedical evacuation of a critically ill patient in a developing country is a process requiring heavy logistics and depending on the medical skills available in the area, and financial resources that can be implemented for the patient. Our study shows that medical evacuations in favor of Djiboutian patients are marginal but are increasing over the past decade.
Qureshi, Muhammad A; Robbie, Scott J; Hengerer, Fritz H; Auffarth, Gerd U; Conrad-Hengerer, Ina; Artal, Pablo
2018-03-01
To determine safety and visual outcomes in eyes with age-related macular degeneration (AMD) implanted with a novel intraocular lens (IOL) that delivers an optimized retinal image to all macular areas within 10 degrees of retinal eccentricity. This was a consecutive case series of 244 eyes with dry/stable wet AMD and logMAR visual acuity ≥0.3 implanted with iolAMD Eyemax mono TM (London Eye Hospital Pharma), a single-piece, injectable, hydrophobic acrylic IOL sited in the capsular bag. Primary outcome was safety. Secondary outcomes were changes in corrected distance visual acuity (CDVA) and corrected near visual acuity (CNVA) (logMAR). Mean age at surgery was 80 years. Mean duration of follow-up was 3 months (range 1-16 months). No eyes had worsening of CDVA. Frequency of perioperative complications was equivalent to standard IOL implantation. Postoperative refractive outcomes were within ±1 D of the target refraction in 88% of cases. Mean preoperative CDVA improved from 1.06 to 0.71 postoperatively (mean of differences -0.35; 95% confidence interval [CI] -0.3886 to -0.3223; p<0.0001), equating to an approximate Early Treatment Diabetic Retinopathy Study gain of 18 letters. Mean preoperative CNVA (N-point; logMAR conversion) improved from 1.36 to 0.88 postoperatively (mean of differences -0.48; 95% CI -0.53 to -0.44; p<0.0001). This novel IOL appears safe in the short to medium term. Improvements in postoperative CDVA and CNVA exceed those observed with standard implants.
International Nuclear Information System (INIS)
Odintsov, A.A.; Sazhenyuk, A.D.
2004-01-01
The paper deals with data of research on the distribution of the radionuclides 137Cs, 90Sr, 239+240Pu, 241Am and 244Cm of ''the Chornobyl rains'' by the fractions of the organic matters of derno-podzolic sandy, derno-meadow and peat soils sampled in the alienation zone of the Chornobyl NPP. Functioning of organic matters was carried according to Tyurin's method. It is stressed that, independently on soil type, 137Cs is connected with the mineral contituent by 80-95%. It is found out that, independently on the soil type, 50-70% 137Sr and 15-45% 241Am are associated with fulvic acid fractions. The 241Am and 244Cm distribution according to organic acids taking into account deviations while carrying out determinations is unambiguous. It is found out that in all the soils tested the main quality of 239+24Pu is connected with humic acids
Marr, Joachim; Niknian, Minoo; Shulman, Lee P; Lynen, Richard
2011-07-01
A combined oral contraceptive comprising ethinylestradiol (EE) 20 mcg/drospirenone 3 mg in a 24/4 regimen has been clinically shown to alleviate the symptoms associated with premenstrual dysphoric disorder (PMDD). However, previous studies did not report data according to cycle-by-cycle improvement. This was a subanalysis of a Phase III, double-blind, multicenter, United States-based study. Women with confirmed PMDD were randomized to EE 20 mcg/drospirenone 3 mg 24/4 or placebo for three treatment cycles. Ten of the 21 emotional and physical items on the Daily Record of Severity of Problems scale were grouped to define three symptom clusters: (a) negative emotions, (b) food cravings and (c) water retention-related symptoms. The change from baseline at each treatment cycle was compared between groups using a weighted analysis of covariance model. The full analysis set comprised 449 women. Daily Record of Severity of Problems scores for each symptom cluster were significantly reduced from baseline with both EE 20 mcg/drospirenone 3 mg 24/4 and placebo (pemotions, food cravings and water retention-related symptoms to a significantly greater extent than placebo during all three cycles of treatment. Copyright © 2011 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Ahmad, I.; Kondev, F. G.; Greene, J. P.; Zhu, S.
2018-01-01
Electron capture decays of Bk-243 and Bk-244 have been studied by measuring the gamma-ray spectra of mass-separated sources and level structures of Cm-243 and Cm-244 have been deduced. In Cm-243, the electron capture population to the ground state, 1/2(+)[631], and 1/2(+)[620] Nilsson states have been observed. The octupole K-pi = 2(-) band was identified in Cm-244 at 933.6 keV. In addition, spins and parities were deduced for several other states and two-quasiparticle configurations have been tentatively assigned to them
DEFF Research Database (Denmark)
Kirchhoff, Maria; Bisgaard, Anne-Marie; Stoeva, Radka
2009-01-01
Partial deletions of the long arm of chromosome 13 lead to variable phenotypes dependant on the size and position of the deleted region. In order to update the phenotypic map of chromosome 13q21.1-qter deletions, we applied 244k Agilent oligonucleotide-based array-CGH to determine the exact break......-genotype correlation on chromosome 13. In contrast to previous reports of carriers of 13q32 band deletions as the most seriously affected patients, we present two such individuals with long-term survival, 28 and 2.5 years....
International Nuclear Information System (INIS)
Brusilovets, A.I.; Rusanov, Eh.B.; Chernega, A.N.
1995-01-01
Complex of zirconium tetrachloride with 1-tert.-butyl-2,4,4-trimethyl--2-thio-3-trimethyl-silyl-1,3,2,4-diazaphosphasilatedine interacts with methylene chloride with formation of bis[3-tert.-butyl-2,4,4-trimethyl-1--trimethylsilyl-2-chloremethylthio-1,3,2,4-diazaphosphasilatedinium] decachlorodizirconate. Specific features of crystal and molecular structure of the compound prepared have been studied by X-ray diffraction method. 21 refs.; 2 figs.; 2 tabs
Discovery of a 7.6-hour high-spin isomer of einsteinium-256
International Nuclear Information System (INIS)
Hoffman, D.C.; Daniels, W.R.; Wilhelmy, J.B.; Bunker, M.E.; Starner, J.W.; Jackson, S.V.; Lougheed, R.W.; Landrum, J.H.
1976-01-01
A 7.6-hour, beta-emitting isomer of 256 Es has been produced via the (t,p) reaction by bombarding /sup 254g/Es with 16-MeV tritons. No evidence for an alpha branch was found. A number of gamma rays were observed, on the basis of which a partial decay scheme is proposed. It is concluded that the isomer has spin 7 or 8
International Nuclear Information System (INIS)
Stepanov, A.; Belyaev, B.; Buljanitsa, L.
1989-11-01
The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233 U, 236 U, 242 Pu and 244 Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233 U/ 236 U ratio and the 236 U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235 U/ 238 U ratio of NBS500 used as internal standard. The coefficients of variation of the 244 Pu/ 242 Pu ratio and the 242 Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240 Pu/ 239 Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs
Zhou, Wen-Juan; Luo, Zhen-Ni; Tang, Chang-Min; Zou, Xiao-Xu; Zhao, Lu; Fang, Peng-Qian
2016-10-01
The improvement of antibiotic rational use in China was studied by usage analysis of combination antibiotic therapy for type I incisions in 244 hospitals. Five kinds of hospitals, including general hospital, maternity hospital, children's hospital, stomatological hospital and cancer hospital, from 30 provinces were surveyed. A systematic random sampling strategy was employed to select outpatient prescriptions and inpatient cases in 2011 and 2012. A total of 29 280 outpatient prescriptions and 73 200 inpatient cases from 244 hospitals in each year were analyzed. Data were collected with regards to the implementation of the national antibiotic stewardship program (NASP), the overall usage and the prophylactic use of antibiotic for type I incisions. Univariate analysis was used for microbiological diagnosis rate before antimicrobial therapy, prophylactic use of antibiotics for type I incision operation, and so on. For multivariate analysis, the use of antibiotics was dichotomized according to the guidelines, and entered as binary values into logistic regression analysis. The results were compared with the corresponding criteria given by the guidelines of this campaign. The antibiotic stewardship in China was effective in that more than 80% of each kind of hospitals achieved the criteria of recommended antibiotics varieties. Hospital type appeared to be a factor statistically associated with stewardship outcome. The prophylactic use of antibiotics on type I incision operations decreased by 16.22% (Pbench marking. More efforts addressing the root cause of antibiotics abuse would continue to improve the rational use of antibiotics in China.
Vo, Van; Tanthmanatham, Ontida; Han, Haesook; Bhowmik, Pradip K; Spangelo, Bryan L
2013-08-01
A series of [Pt(II)Cl2(4,4'-dialkoxy-2,2'-bipyridine)] complexes of the general formula of [Pt(II)Cl2(4,4'-bis(RO)-2,2'-bipyridine)] (where R = -(CH2)n-1CH3, n = 2-6, 8) were synthesized and characterized using (1)H NMR, (13)C NMR spectroscopy, elemental analysis, mass spectroscopy, and differential scanning calorimetry measurements. The in vitro anti-proliferative activities of these compounds were evaluated against human cancer cell lines A549 (lung adenocarcinoma), DU145 (prostate carcinoma), MCF-7 (breast adenocarcinoma), and MDA-MB-435 (melanoma) using the MTS cell proliferation assay. Several Pt(II) coordination compounds were found to have greatly enhanced activity compared to cisplatin after a one hour treatment in all cell lines tested. A structure-activity relationship was observed, that is, the activity increases as the carbon chain length of the alkyl group increases. The activity was maximum when the carbon chain length reached four or five carbons and decreased with the longer carbon chain length. Fluorescence microscopy and flow cytometry data indicate that the main mode of cell death is through apoptosis with some necrotic responses.
Vo, Van; Tanthmanatham, Ontida; Han, Haesook; Bhowmik, Pradip K.; Spangelo, Bryan L.
2013-01-01
A series of [Pt(II)Cl2(4,4′-dialkoxy-2,2′-bipyridine)] complexes of the general formula of[Pt(II)Cl2(4,4′-bis(RO)-2,2′-bipyridine)] (where R = −(CH2)n−1CH3, n = 2–6,8) were synthesized and characterized using 1H NMR, 13C NMR spectroscopy, elemental analysis, mass spectroscopy, and differential scanning calorimetry measurements. The in vitro anti-proliferative activities of these compounds were evaluated against human cancer cell lines A549 (lung adenocarcinoma), DU145 (prostate carcinoma), MCF-7 (breast adenocarcinoma), and MDA-MB-435 (melanoma) using the MTS cell proliferation assay. Several Pt(II) coordination compounds were found to have greatly enhanced activity compared to cisplatin after a one hour treatment in all cell lines tested. A structure-activity relationship was observed, that is, the activity increases as the carbon chain length of the alkyl group increases. The activity was maximum when the carbon chain length reaches four or five carbons and decreased with the longer carbon chain length. Fluorescence microscopy and flow cytometry data indicate that the main mode of cell death is through apoptosis with some necrotic responses. PMID:23817622
International Nuclear Information System (INIS)
Endo, A.; Sato, T.
2013-01-01
Absorbed doses, linear energy transfers (LETs) and quality factors of secondary charged particles in organs and tissues, generated via the interactions of the spontaneous fission neutrons from. 252 Cf and. 244 Pu within the human body, were studied using the Particle and Heavy Ion Transport Code System (PHITS) coupled with the ICRP Reference Phantom. Both the absorbed doses and the quality factors in target organs generally decrease with increasing distance from the source organ. The analysis of LET distributions of secondary charged particles led to the identification of the relationship between LET spectra and target-source organ locations. A comparison between human body-averaged mean quality factors and fluence-averaged radiation weighting factors showed that the current numerical conventions for the radiation weighting factors of neutrons, updated in ICRP103, and the quality factors for internal exposure are valid. (authors)
Artun, Ozan
2017-07-01
In this paper, we intend to extend the nuclear data of 244Cm, 241Am, 238Pu, 210Po, 147Pm, 137Cs, 90Sr and 63Ni nuclei used in nuclear battery technology, because, these nuclei are quite important for space investigations in radioisotope thermoelectric generator (RTG) and for microelectronic technologies in betavoltaic batteries. Therefore, the nuclear structure properties of nuclei such as separation energies, neutron skin thicknesses, proton, charge and neutron density distributions as a function of radius, the root mean square (rms) proton, charge and neutron radii, binding energies per particle, have been investigated by Hartree-Fock with eight different Skyrme forces. The obtained results have been compared with the experimental data in literature and relativistic mean field theory (RMFT) results.
International Nuclear Information System (INIS)
Gates, J. M.; Duellmann, Ch. E.; Schaedel, M.; Ackermann, D.; Block, M.; Bruechle, W.; Essel, H. G.; Hartmann, W.; Hessberger, F. P.; Huebner, A.; Jaeger, E.; Khuyagbaatar, J.; Kindler, B.; Krier, J.; Kurz, N.; Lommel, B.; Schaffner, H.; Schausten, B.; Schimpf, E.; Steiner, J.
2011-01-01
Experiments with the new recoil separator, Transactinide Separator and Chemistry Apparatus (TASCA), at the GSI were performed by using beams of 48 Ca to irradiate targets of 206-208 Pb, which led to the production of 252-254 No isotopes. These studies allowed for evaluation of the performance of TASCA when coupled to a new detector and electronics system. By following these studies, the isotopes of element 114 ( 288-291 114) were produced in irradiations of 244 Pu targets with 48 Ca beams at compound nucleus excitation energies around 41.7 and 37.5 MeV, demonstrating TASCA's ability to perform experiments with picobarn-level cross sections. A total of 15 decay chains were observed and were assigned to the decay of 288-291 114. A new α-decay branch in 281 Ds was observed, leading to the new nucleus 277 Hs.
International Nuclear Information System (INIS)
Singh, Manpreet; Sengupta, Arijit; Murali, M.S.; Adya, V.C.; Kadam, R.M.
2016-01-01
Room temperature ionic liquid has been world-wide considered as the potential 'green' alternatives to the molecular diluents. A comparative study was carried out for studying selective separation of uranium from radioactive waste solution using Bis(2,4,4-trimethylpentyl phosphinic) acid in molecular diluent (xylene) and ionic liquid (C 8 mimNTf 2 ). For ionic liquid based system, the extraction kinetics was found to be slower compared to the molecular diluents. This was attributed to the higher viscosity of ionic liquid. In ionic liquid the extraction occurs with the predominance of 'ion exchange' mechanism through (UO 2 (NO 3 ). 2L) + species, while for xylene based system 'solvation' mechanism predominates at higher feed acidity. The extraction process in ionic liquid was found to be thermodynamically more favoured than in xylene. The nature of the extracted species was found to be different in ionic liquid and xylene as obtained from difference in luminescence emission profiles and lifetime of the extracted complex. Ionic liquid based system was found to be radiolytically more stable than the molecular diluents based solvent system. Na 2 CO 3 solution was found to back extract the uranyl ion almost quantitatively (99.9 %) from the loaded organic phase but overall stripping from ionic liquid phase is comparatively poorer than that of xylene phase. The processing of Simulated High Level Waste (SHLW) of Pressurized Heavy Water Reactor (PHWR) or Research Reactor (RR) origin revealed that bis(2,4,4-trimethylpentyl phosphinic) acid can effectively be used for the preferential extraction of U with better selectivity for ionic liquid phase. But the ion exchange mechanism is one of the disadvantages for its plant scale application. (author)
International Nuclear Information System (INIS)
Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.
2013-01-01
Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)
Fursova, Nadezhda K; Astashkin, Eugeny I; Knyazeva, Anastasia I; Kartsev, Nikolay N; Leonova, Ekaterina S; Ershova, Olga N; Alexandrova, Irina A; Kurdyumova, Natalia V; Sazikina, Svetlana Yu; Volozhantsev, Nikolay V; Svetoch, Edward A; Dyatlov, Ivan A
2015-11-02
The spread of carbapenemase-producing Enterobacteriaceae (CPE) is a great problem of healthcare worldwide. Study of the spread for bla OXA-48-like genes coding epidemically significant carbapenemases among hospital pathogens is important for the regional and global epidemiology of antimicrobial resistance. Antibacterial resistant isolates of Klebsiella pneumoniae (n = 95) from 54 patients, P. mirabilis (n = 32) from 20 patients, Enterobacter aerogenes (n = 6) from four patients, and Enterobacter cloacae (n = 4) from four patients were collected from January, 2013 to October, 2014 in neurosurgical intensive care unit (ICU) of the Burdenko Neurosurgery Institute, Moscow. Characteristics of the isolates were done using susceptibility tests, PCR detection of the resistance genes, genotyping, conjugation, DNA sequencing, and bioinformatic analysis. Major strains under study were multi drug resistant (MDR), resistant to three or more functional classes of drugs simultaneously-98.9 % K. pneumoniae, 100 % P. mirabilis, one E. aerogenes isolate, and one E. cloacae isolate. Molecular-genetic mechanism of MDR in K. pneumoniae and P. mirabilis isolates were based on carrying of epidemic extended-spectrum beta-lactamase bla CTX-M-15 gene (87.2 and 90.6 % accordingly), carbapenemase bla OXA-48-like gene (55.3 and 23.3 % accordingly), and class 1 (54.8 and 31.3 % accordingly) and class 2 (90.6 % P. mirabilis) integrons. The bla OXA-48-like-positive K. pneumoniae were collected during whole two-year surveillance period, while P. mirabilis and Enterobacter spp. carrying bla OXA-48-like genes were detected only after four and 18 months after the research start, respectively. The bla OXA-48-like gene acquisition was shown for P. mirabilis isolates collected from five patients and for E. cloacae isolate collected from one patient during their stay in the ICU, presumably from bla OXA-48-like-positive K. pneumoniae. The source of the bla OXA-244 gene acquired by E
Matsjeh, Sabirin; Swasono, Respati Tri; Anwar, Chairil; Solikhah, Eti Nurwening; Lestari, Endang
2017-03-01
The compound 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone have been synthesized through Claisen-Schmidt reaction from 2-hydroxyacetophenone and 2,4-dihydroxyacetophenone with 4-hydroxy-3-methoxy benzaldehida (vanillin) in aqueous KOH 40% and KSF montmorillonite as catalyst in methanol. All these products were characterized by FT-IR, TLC Scanner, GC-MS, MS-Direct, and 1H-NMR and 13C-NMR spectrometer. Both of these compounds were tested citotoxycity activity as an anticancer against cervical, colon, and breast cancer cells (Hela, WiDr, and T47D cell lines) using MTT assay in vitro. Dose series given test solution concentration on Hela, WiDr, and T47D cells started from 6,25; 25; 50 and 100 µg/mL with incubation treatment for 24 hours. The result of study showed that the 2',4-dihydroxy-3-methoxychalcone as bright yellow crystal with the melting point of 114-115 °C and the yield of 13.77% and the 2',4',4-trihydroxy-3-methoxychalcone as bright yellow crystals with the melting point of 195-197 °C and the yield of 6%. Other 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone also exhibited cytotoxic activity against the cancer cell lines, with the 2',4',4-trihydroxy-3-methoxychalcone showed greater activities than the 2',4-dihydroxy-3-methoxychalcone in WiDr cell lines. The 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone exhibited strong anticancer activities with IC50 value below 20 µg/mL. The activity of 2',4',4-trihydroxy-3-methoxychalcone showed the most active against Hela and WiDr cell lines with IC50 value 8.53 and 2.66 µg/mL respectively, than T47D cell lines with IC50 value 24.61 µg/mL. The test results cytotoxic of 2',4-dihydroxy-3-methoxychalcone showed the most active against Hela and WiDr cell lines with IC50 value 12.80, 19.57 µg/mL than T47D cell lines with IC50 value of 20.73 µg/mL. IC50 value indicated that 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3
International Nuclear Information System (INIS)
Akhter, Nasima; Kinuya, Seigo; Nakajima, Kenichi; Shiba, Kazuhiro; Ogawa, Kazuma; Mori, Hirofumi
2007-01-01
Full text: In this study, (+)-enantiomer of radioiodinated 2-[4-(4- iodophenyl)piperidino]cyclohexanol ((+)-[ 125 I]-p- iodovesamicol) [(+)-[ 125 I]pIV], which is reported to bind with high affinity to the sigma-1 receptor both in vitro and in vivo, was tested to compare the in vivo characteristics between high and low specific activity (+)-[ 125 I]pIV to image sigma-1 receptor in the central nervous system. In the biodistribution study, no significant difference was observed between two methods. Accumulation of (+)- [ 125 I]pIV in rat brain was significant (approximately 3% of the injected dose) and its retention was prolonged. In the blocking study, the accumulation of (+)-[ 125 I] pIV in the rat brain was significantly reduced by the co-administration of sigma ligands such as pentazocine, haloperidol or SA4503 in both methods. But the blocking effect was relatively stronger in the study using high specific activity radioiodinated (+)pIV. Though, the distribution of high and low specific activity (+)-[ 125 I] pIV was more or less similar to bind to sigma-1 receptor in the central nervous system in vivo, high specific activity radioiodinated (+) pIV might have a better specificity to bind sigma-1 receptor in brain. (author)
International Nuclear Information System (INIS)
Ageyev, V.A.; Sajeniouk, A.D.
2005-01-01
Routine analytical procedures have been developed for the reliable simultaneous determination of 90 Sr, 238 Pu, 239+240 Pu, 241 Am and 242-244 Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90 Sr in a Mineral Matrix' and 'Proficiency Test for 239 Pu, 241 Pu and 241 Am Measurement in a Mineral Matrix' accuracy and precision for 90 Sr, 239 Pu and 241 Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)
International Nuclear Information System (INIS)
Sun Xiaobo; Zhao Junmei; Meng Shulan; Li Deqian
2005-01-01
Synergistic extraction and separation of yttrium (Y) from heavy rare earths (HRE) in chloride medium using mixture of sec-octylphenoxy acetic acid (CA-12, HA) and bis(2,4,4-trimethylpentyl)phosphinic acid (Cyanex272, HL) in n-heptane has been investigated. The synergistic enhancement coefficients, R max , were obtained for Ho 3+ (5.12), Y 3+ (5.34), Er 3+ (7.04), Tm 3+ (7.50), Yb 3+ (13.12) and Lu 3+ (17.58). The separation factors (SF) between Y 3+ and HRE were obtained, and it was found that Er 3+ would form the new complex as ErH 6 A 4 L 5 in the mixture system. A cation exchange mechanism was proposed. The equilibrium constant, formation constant and thermodynamic parameters such as ΔG = -18.48 kJ/mol, ΔH = -1.36 kJ/mol and ΔS = 0.058 kJ/mol were determined. The CA-12 and Cyanex272 mixture system showed higher extraction efficiency, larger separation factors as well as excellent stripping behaviors. The application potential of the mixture system to separate Y from HRE has been discussed
International Nuclear Information System (INIS)
Reber, E.L.; Gehrke, R.J.; Aryaeinejad, R.; Hartwell, J.K.
2005-01-01
Gamma-ray spectrometry measurements have been made of the fission yields of selected γ -rays emitted by the spontaneously fissioning isotopes 252 Cf and 244 Cm. The measured γ-rays were selected based on their relative abundance in the spectrum and their freedom from interference or, in a few instances, ease of interference correction. From these data and the cumulative and independent yield data of England and Rider, those γ-rays that are primarily produced by radioactive decay, as opposed to direct yield, were converted into the decays per spontaneous fission expressed in percent and compared to cumulative yield values of England and Rider. For those γ-rays whose production is dominated by direct (independent) yield, the ratio of γ-rays per spontaneous fission is reported. The γ-ray yield can be compared to the independent yield values of England and Rider when 100% of the direct feeding passes through the γ-ray. In those cases where both cumulative and independent yields contribute to the observed γ-ray emission rate, a direct comparison is not possible but a method to quantify the contribution from each is proposed. (author)
Ozadali-Sari, Keriman; Tüylü Küçükkılınç, Tuba; Ayazgok, Beyza; Balkan, Ayla; Unsal-Tan, Oya
2017-06-01
The present study describes the synthesis, pharmacological evaluation (BChE/AChE inhibition, Aβ antiaggregation, and neuroprotective effects), and molecular modeling studies of novel 2-[4-(4-substitutedpiperazin-1-yl)phenyl]benzimidazole derivatives. The alkyl-substituted derivatives exhibited selective inhibition on BChE with varying efficiency. Compounds 3b and 3d were found to be the most potent inhibitors of BChE with IC 50 values of 5.18 and 5.22μM, respectively. The kinetic studies revealed that 3b is a partial non-competitive BChE inhibitor. Molecular modeling studies also showed that the alkyl-substituted derivatives were able to reach the catalytic anionic site of the BChE. The compounds with an inhibitory effect on BChE were subsequently screened for their Aβ antiaggregating and neuroprotective activities. Compounds 3a and 3b exerted a potential neuroprotective effect against H 2 O 2 and Aβ-induced cytotoxicity in SH-SY5Y cells. Collectively, 3b was found as the most promising compound for the development of multi-target directed ligands against Alzheimer's disease. Copyright © 2017 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Holcomb, H.P.
1993-01-01
The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively
International Nuclear Information System (INIS)
Louwrier, K.P.; Richter, K.
1976-01-01
During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)
Flood, Margaret; McDonald, Susan J; Pollock, Wendy; Cullinane, Fiona; Davey, Mary-Ann
2018-05-22
Increasing incidence and severity of postpartum haemorrhage, together with postpartum haemorrhage-associated morbidities, have been reported in many high-resource countries. In-depth analysis of such factors in Victorian births since 2002 was lacking. Our aim was to determine the incidence and trends for primary postpartum haemorrhage (World Health Organization and International Classification of Diseases 10th revision, Australian Modification definitions) for all confinements in Victoria, Australia, for the years 2003-2013 and the incidence and trends for severe postpartum haemorrhage (≥1500 mL) for 2009-2013. In this population-based cross-sectional study de-identified data from the Victorian Perinatal Data Collection were analysed for confinements (excluding terminations) from 2003 to 2013 (n = 764 244). Perinatal information for all births ≥20 weeks (or of at least 400 g birthweight if gestation was unknown) were prospectively collected. One in five women (21.8%) who gave birth between 2009 and 2013 experienced a primary postpartum haemorrhage and one in 71 women (1.4%) experienced a severe primary postpartum haemorrhage. The increasing trends in incidence of primary postpartum haemorrhage, severe primary postpartum haemorrhage, blood transfusion, admission to an intensive care or high dependency unit and peripartum hysterectomy were significant (P primary postpartum haemorrhage. The highest incidence was experienced by women who had an unplanned caesarean section birth. Women who had a forceps birth had the highest incidence of severe primary postpartum haemorrhage. The incidence of primary postpartum haemorrhage, severe primary postpartum haemorrhage and associated maternal morbidities have increased significantly over time in Victoria. © 2018 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.
Directory of Open Access Journals (Sweden)
Jiaxi Chen, Jing Sun*, Jufang Kong, Wenxiu Chen and Hongqing Hao*
2015-03-01
Full Text Available Abstract: A new Ru(II polypyridyl complex, [Ru(phen2(4,4'-dicarboxy-2,2'-bipyridine]PF6·1.5H2O, was synthesized andcharacterized by single crystal X-ray diffraction, elementalanalyses, electrospray ionization mass spectrometry, infraredspectra, ultraviolet (UV spectra, and emission spectra. Thestructure of the cation [Ru(phen2(4,4'-(COO-,(COOH-2,2'-bpy]+ consists of a six-coordinated ruthenium atom chelated bytwo phen ligands and one 4,4'-dicarboxy-2,2'-bipyridine ligand.The absorption spectrum of the Ru(II complex is characterizedby two intense ligand-centered transitions in the UV region andone metal to ligand charge transfer in the visible region. Moreover,the complex can display luminescence in water at roomtemperature, with maximum emission at 623 nm.Supporting information: Cif file
Ma, Xiao-Hong; Zhao, Ling; Lin, Zhi-Rong; Dong, Yuan-Hua
2016-04-01
Detoxification by chemical oxidation of polychlorinated biphenyls (PCBs) in contaminated soils is very difficult and inefficient because PCBs typically associate with the solid phase or exist as non-aqueous-phase liquids due to their low solubility and slow desorption rates, and thus, they are difficult to remove from soils by using traditional, water-based elution techniques. Surfactant can enhance washing efficiency of PCBs from contaminated soils. This study used Brij 58, Brij 30, Tween 80, and 2-hydroxypropyl-β-cyclodextrin (HPCD) to solubilize 2,4,4'-trichlorodiphenyl (PCB28) from soil contaminated with capacitor oil into solution. The feasibility of PCB28 oxidation in soil washing wastewater through a Fe(3+)-catalyzed Fenton-like reaction was subsequently examined. Washing with 10 g L(-1) Brij 58 solution showed the highest extraction efficiency (up to 61.5 %) compared with that of the three other surfactants. The total concentration of PCB28 in contaminated soil at 25 °C after 48-h extraction was 286 mg L(-1). In contrast to conditions in which no washing agent was added, addition of the four washing agents decreased the efficiency of PCB28 degradation by the Fenton-like reaction, with the decrease due to addition of 10 g L(-1) Brij 58 solution being the smallest. The optimal concentration of H2O2 for preventing its useless decomposition was found to be 50 mM. The efficiency of PCB28 removal was lower when the initial concentration of PCB28 treated in the Fenton-like reaction was higher. The degradation efficiencies of PCB28 at initial concentrations of 0.1, 10, and 176 mg L(-1) in 10 g L(-1) Brij 58 solution at 25 °C and pH 3.0 and 9 h of reaction using 50 mM H2O2 were 64.1, 42.0, and 34.6 %, respectively. This result indicates that soil washing combined with Fenton-like oxidation may be a practical approach for the remediation of PCB-contaminated soil.
Energy Technology Data Exchange (ETDEWEB)
Holste, F; Haukap, C; Kameier, F
2000-07-10
The physical phenomena of rotary instabilities in industrial compressors and high-pressure aircraft compressors were investigated, which may be a cause of compressor blade fracture. The investigations were carried out by Duesseldorf Technical University on behalf of Rolls-Royce Deutschland GmbH at the new four-stage low-pressure compressor test stand of TU Dresden University. Extensive measurements were made both in the rotary and stationary system in the third compressor stage. Rotary instabilities could be detected by increasing the clearance between the blade tip and compressor wall. Modal analyses yielded a rate of about 30 for 63 blades, i.e. a characteristic wavelength of about twice the length of a blade. So far, an accurate description of the physical mechanism was impossible. Investigations using a Snubber model showed no significant influence on the rotary instabilities. [German] Im Turbotech II Forschungsvorhaben 1.244 wurden die physikalischen Vorgaenge der rotierenden Instabilitaet untersucht, die sowohl in industriellen Verdichtern als auch in Hochdruckverdichtern von Flugtriebwerken auftreten koennen. Diese Instabilitaeten stellen eine zusaetzliche Belastung fuer die Verdichterblaetter dar und koennen damit die Ursache fuer Blattbrueche sein. Im Auftrag von Rolls-Royce Deutschland wurden die Untersuchungen von der Faachhochschule Duesseldorf durchgefuehrt. Testobjekt war der neu aufgebaute vier stufige Niedergeschwindigkeitsverdichter der TU Dresden. In enger Kooperation mit den Vorhaben 1.243 und 1.246 wurden umfangreiche Messungen sowohl im rotierenden als auch im festen System an der dritten Stufe des Verdichters durchgefuehrt. Durch Vergroesserung des Spaltes zwischen Schaufelspitze und Verdichterwandung konnten rotierenden Instabilitaeten nachgewiesen werden. Modenanalysen ergaben Umfangsordnungen von ungefaehr 30 bei einer Blattzahl von 63, wodurch die charakteristische Wellenlaenge etwa zwei Schaufelwellenlaengen entspricht. Eine exakte
Directory of Open Access Journals (Sweden)
Bitzer J
2015-05-01
Full Text Available Johannes Bitzer,1 Maria Jesusa Banal-Silao,2 Hans-Joachim Ahrendt,3 Jaime Restrepo,4 Marion Hardtke,5 Ulrike Wissinger-Graefenhahn,6 Dietmar Trummer7 1Department of Obstetrics and Gynecology, University Hospital of Basel, Basel, Switzerland; 2University of the Philippines College of Medicine, Manila, Philippines; 3Praxis für Frauenheilkunde, Klinische Forschung und Weiterbildung (Clinical Research and Further Education, Magdeburg, Germany; 4Centro de Investigación Clínica, Clinica Medellin Poblado, Medellin, Colombia; 5Global Clinical Development Operations, Bayer Pharma AG, Berlin, Germany; 6Global Medical Affairs Women’s Healthcare, Bayer Pharma AG, Berlin, Germany; 7Clinical Statistics Europe, Bayer Pharma AG, Berlin, Germany Objective: To assess whether the combined oral contraceptive (COC ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4-day regimen (ie, 4-day hormone-free interval is more effective than an EE 20 µg/desogestrel (DSG 150 µg COC taken in a 21/7-day regimen (ie, 7-day hormone-free interval in reducing hormone withdrawal-associated symptoms (HWAS.Methods: This double-blind, randomized study (NLM identifier: NCT01076582 was conducted at 34 centers in 12 countries. Otherwise healthy women who experienced ≥2 HWAS of headache, pelvic pain, and/or bloating when using their current COCs in a 21/7-day regimen were recruited. Subjects rated the severity of their HWAS daily on a seven-point Likert scale during a baseline cycle and during four 28-day cycles with EE/drospirenone 24/4 (n=290 or EE/DSG 21/7 (n=304. The primary variable was the mean change from baseline to cycle 4 in the composite HWAS score (sum of scores for all three symptoms during cycle days 22–28.Results: In the EE/drospirenone 24/4 group, the mean (standard deviation composite HWAS score during cycle days 22–28 was reduced from 42.2 (24.8 at baseline to 12.8 (13.4 at cycle 4 (change from baseline: -30.3 [22.9]. In the EE/DSG 21/7 group, the
International Nuclear Information System (INIS)
Tahmasebi, Elham; Yamini, Yadollah
2012-01-01
Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe 3 O 4 -Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: ► A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. ► Silver was coated on Fe 3 O 4 nanoparticles (MNPs) by reduction of AgNO 3 with NaBH 4 . ► Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. ► Size, morphology, composition and properties of the nanoparticles were characterized. ► Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe 3 O 4 nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 °C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 μL of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05–100 μg L −1 (R 2 > 0.9980) and the LODs (S/N = 3) were obtained in the range of 0.02–0.10 μg L −1 . Relative standard deviations (RSDs) for intra- and inter-day precision were 2.6–4.2% and 3.6–8
DEFF Research Database (Denmark)
Duijkers, Ingrid J M; Heger-Mahn, Doris; Drouin, Dominique
2015-01-01
OBJECTIVES: Progestogen-only pills (POPs) are safer with respect to cardiovascular risks than contraceptives containing estrogens. Despite the increased contraceptive efficacy of a desogestrel-only pill compared with a traditional POP, POPs are still not widely used due to an unpredictable bleeding...... pattern. A new POP containing 4 mg drospirenone has been developed with a 24/4 intake regimen which may improve the bleeding pattern. The objectives of this study were to investigate ovulation inhibition with the new drospirenone-only pill in comparison with the desogestrel-only pill and, in addition......, to assess the effects on cervical mucus permeability and bleeding. METHODS: Sixty-four healthy volunteers with proven ovulatory cycles were randomised and treated with either the drospirenone-only or the desogestrel-only pill during two 28-day cycles. Follicular diameter, endometrial thickness, and serum...
2010-10-01
... Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND...,000 per violation may be assessed. Each day a violation continues shall constitute a separate offense...
2010-04-01
... applicable to the registrant. (b) GAAP. GAAP refers to generally accepted accounting principles in the United... prepared in accordance with non-U.S. generally accepted accounting principles, GAAP refers to the principles under which those primary financial statements are prepared; and (2) In the case of foreign...
Publications | Page 244 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
A new window on the world for women. Jertrudes is a vendor in a small municipal market just off the main street in Manhiça, Mozambique. The single mother of eight begins her day at 4:00 a.m. By 6:30, she is standing in her market stall, waiting for the first customer of.
2010-10-01
..., consistent with the safety of the ship. (xxx) The Navy shall abide by the letter of the “Stranding Response... video (if available). Based on the information provided, NMFS shall determine if, and advise the Navy.../are dead), location, time of first discovery, observed behaviors (if alive), and photo or video (if...
2010-10-01
... operations (e.g., changes in personnel, track, bridges, or communication or signal systems; or use or... deflator formula) from time to time. Corporate culture means the totality of the commitments, written and... an amalgamation of operations, or by a railroad or a corporate parent of a Class I railroad taking...
2010-01-01
... affirming that he or she is a national of the designated foreign state. A personal interview before an... nationality. During this interview, the applicant may present any secondary evidence that he or she feels... appear for a scheduled interview, without good cause, will be deemed an abandonment of the application...
Marr, Joachim; Huang, Zirong; Wang, Baoxi; Zhang, Hongyan; Roth, Katrin
2015-01-01
While combined oral contraceptives are a popular choice in developed Western countries, they are used by only 1% of women who are married or in a relationship in the People's Republic of China. The purpose of this review is to describe the efficacy and safety of the combined oral contraceptive containing ethinylestradiol (EE) 20 µg/drospirenone 3 mg taken in a 24/4 regimen (YAZ ® ; Bayer HealthCare Pharmaceuticals, Berlin, Germany) by Chinese women and to compare these results with those in women assessed in the international studies. Studies of EE 20 µg/drospirenone 3 mg in three different indications (contraception, acne, and premenstrual dysphoric disorder [PMDD]) have been conducted in Chinese women. The results of these three studies indicate that the EE 20 µg/drospirenone 3 mg combined oral contraceptive is a good long-term contraceptive option in Chinese women, providing 99% contraceptive protection over the observed 1-year treatment period, and additionally had a favorable effect on moderate acne vulgaris and relieved the symptoms of PMDD. The contraceptive efficacy, improvement in acne, and relief from PMDD symptoms observed in these studies did not differ from the effects observed in other international studies of EE 20 µg/drospirenone 3 mg, indicating that EE 20 µg/drospirenone 3 mg is as effective in Chinese women as in other ethnicities. Further, EE 20 µg/drospirenone 3 mg demonstrated a similar safety and tolerability profile in women enrolled in the Chinese and international trials, with no unexpected adverse events reported in any of the three Chinese trials. Overall, the efficacy, tolerability, and degree of non-contraceptive benefits with EE 20 µg/drospirenone 3 mg appear similar in Chinese women when compared with those reported in larger studies done at other international centers.
Energy Technology Data Exchange (ETDEWEB)
Kunz, S.; Schmitz, H.J.; Schrenk, D. [Kaiserslautern Univ. (Germany). Dept. of Food Chemistry and Environmental Toxicology; Buchmann, A.; Schwarz, M. [Tuebingen Univ. (Germany). Inst. of Toxicology; Schilling, B.; Paepke, O. [ERGO Research, Hamburg (Germany); Robertson, L.W.; Lehmler, H.J. [Iowa Univ, Iowa City, IA (United States). Dept. of Occupational and Environmental Health
2004-09-15
Polychlorinated biphenyls (PCBs) are potent persistent environmental pollutants exhibiting neurotoxic, teratogenic and tumor-promoting effects in experimental animal models. PCB congeners can be divided into 'dioxin-like' and 'non-dioxin-like' congeners on the basis of their ability to act as aryl hydrocarbon receptor (AhR) agonists. Like the most toxic dioxin congener 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) 'dioxin-like' PCBs bind to the AhR and show characteristic effects on the expression of AhR-regulated genes including the induction of cytochrome P450 (CYP) 1A1. On the other hand, 'non-dioxin-like' PCB congeners have a lower or no binding affinity to the AhR, but exhibit a 'phenobarbital-type' induction of CYP 2B1/2 activity. The tumor-promoting potency of several PCBs has been demonstrated in two-stage initiation-promotion experiments in rat liver. Preneoplastic cell clones, targets for tumor promotion, can be identified as phenotypically altered foci showing characteristic enzyme patterns including the decreased activity of adenosine triphosphatase (ATPase) or the increased expression of the placental form of gluthatione S-transferase (GSTP). In the present study, the effect of the 'non-dioxin-like' 2,4,4'-trichlorobiphenyl (PCB 28) and 2,2',4,5,5'-pentachlorobiphenyl (PCB 101) on the promotion of enzyme-altered hepatic foci was investigated in female Wistar rats after initiation with diethylnitrosamine (DEN).
Fuzzy Itand#244; Integral Driven by a Fuzzy Brownian Motion
Directory of Open Access Journals (Sweden)
Didier Kumwimba Seya
2015-11-01
Full Text Available In this paper we take into account the fuzzy stochastic integral driven by fuzzy Brownian motion. To define the metric between two fuzzy numbers and to take into account the limit of a sequence of fuzzy numbers, we invoke the Hausdorff metric. First this fuzzy stochastic integral is constructed for fuzzy simple stochastic functions, then the construction is done for fuzzy stochastic integrable functions.
Process for the recovery of curium-244 from nuclear waste
International Nuclear Information System (INIS)
Posey, J.C.
1980-10-01
A process has been designed for the recovery of curium from purex waste. Curium and americium are separated from the lanthanides by a TALSPEAK extraction process using differential extraction. Equations were derived for the estimation of the economically optimum conditions for the extraction using laboratory batch extraction data. The preparation of feed for the extraction involves the removal of nitric acid from the Purex waste by vaporization under reduced pressure, the leaching of soluble nitrates from the resulting cake, and the oxalate precipitation of a pure lanthanide-actinide fraction. Final separation of the curium from americium is done by ion-exchange. The steps of the process, except ion-exchange, were tested on a laboratory scale and workable conditions were determined
18 CFR 367.2440 - Account 244, Derivative instrument liabilities.
2010-04-01
..., Derivative instrument liabilities. This account must include the change in the fair value of all derivative instrument liabilities not designated as cash flow or fair value hedges. Account 426.5, Other deductions... the fair value of the derivative instrument. ...
48 CFR 52.244-6 - Subcontracts for Commercial Items.
2010-10-01
... clauses in subcontracts for commercial items: (i) 52.203-13, Contractor Code of Business Ethics and.... (e) To the maximum extent practicable, when the Contractor acts as a purchasing agent for the Government with respect to a purchase that exceeds the simplified acquisition threshold, the Contractor shall...
8 CFR 244.20 - Waiver of fees.
2010-01-01
... 103.7(b) which relate to applications to the district director or service center director for... expenditures, such as essential medical expenses, or expenses for clothing, laundry, and child care, to the... officer in support of a fee waiver request are subject to verification by the Service. (i) In requiring...
Indian Academy of Sciences (India)
x
what constitutes evidence of a new particle. Rita Bernabei of ... Women are poorly represented in physics, mak- ing up just 10% of ... at an experiment at one of America's highest- ... records to chart the careers of 57 postdoctoral ... nent northeastern public university, tried to ter- ... Schefer says that things will start to become.
Lifescience Database Archive (English)
Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(
Dark Galaxies and Lost Baryons (IAU S244)
Davies, Jonathan I.; Disney, Michael J.
2008-05-01
Preface; Conference prelims; The HI that barked in the night M. J. Disney; The detection of dark galaxies in blind HI surveys J. I. Davies; Red haloes of galaxies - reservoirs of baryonic dark matter? E. Zackrisson, N. Bergvall, C. Flynn, G. Ostlin, G. Micheva and B. Baldwell; Constraints on dark and visible mass in galaxies from strong gravitational lensing S. Dye and S. Warren; Lost baryons at low redshift S. Mathur, F. Nicastro and R. Williams; Observed properties of dark matter on small spatial scales R. Wyse and G. Gilmore; The mass distribution in spiral galaxies P. Salucci; Connecting lost baryons and dark galaxies via QSO absorption lines T. Tripp; ALFALFA: HI cosmology in the local universe R. Giovanelli; The ALFALFA search for (almost) dark galaxies across the HI mass function M. Haynes; HI clouds detected towards Virgo with the Arecibo Legacy Fast ALFA Survey B. Kent; Cosmic variance in the HI mass function S. Schneider; The Arecibo Galaxy Environments Survey - potential for finding dark galaxies and results so far R. Minchin et al.; Free-floating HI clouds in the M81 group E. Brinks, F. Walter and E. Skillman; Where are the stars in dark galaxies J. Rosenberg, J. Salzer and J. Cannon; The halo by halo missing baryon problem S. McGaugh; The local void is really empty R. Tully; Voids in the local volume: a limit on appearance of a galaxy in a dark matter halo A. Tikhonov and A. Klypin; Dim baryons in the cosmic web C. Impey; A census of baryons in galaxy clusters and groups A. Gonzalez, D. Zaritsky and A. Zabludo; Statistical properties of the intercluster light from SDSS image stacking S. Zibetti; QSO strong gravitational lensing and the detection of dark halos A. Maccio; Strong gravitational lensing: bright galaxies and lost dark-matter L. Koopmans; Mapping the distribution of luminous and dark matter in strong lensing galaxies I. Ferreras, P. Saha, L. Williams and S. Burles; Tidal debris posing as dark galaxies P. Duc, F. Bournaud and E. Brinks; Numerical simulation of the dwarf companions of giant galaxies A. Nelson and P. Williams; Delayed galaxies C. Struck, M. Hancock, B. Smith, P. Appleton, V. Charmandaris and M. Giroux; Probe of dark galaxies via disturbed/lopsided isolated galaxies I. Karachentsev, V. Karachentseva, W. Huchtmeier, D. Makarov and S. Kaisin; Star formation thresholds J. Schaye; Scaling relations of dwarf galaxies without supernova-driven winds K. Tassis, A. Kravtsov and N. Gnedin; Star formation in massive low surface brightness galaxies K. O'Neil; Linking clustering properties and the evolution of low surface brightness galaxies D. Bomans and S. Rosenbaum; Too small to form a galaxy: how the UV background determines the baryon fraction M. Hoeft, G. Yepes and S. Gottlober; Star formation in damped Lyman selected galaxies L. Christensen; Dark-matter content of early-type galaxies with planetary nebulae N. Napolitano et al.; Hunting for ghosts: low surface brightnesses from pixels R. Scaramella and S. Sabatini; Baryonic properties of the darkest galaxies E. Grebel; The dwarf low surface brightness population in different environments of the local universe S. Sabatini, J. Davies, S. Roberts and R. Scaramella; Mass modelling of dwarf spheroidal galaxies J. Klimentowski et al.; Evolution of dwarf galaxies in the Centaurus A Group L. Makarova and D. Makarov; A flat faint end of the Fornax cluster galaxy luminosity function S. Mieske, M. Hilker, L. Infante and C. Mendes de Oliveira; Can massive dark halos destroy the discs of dwarf galaxies? B. Fuchs and O. Esquivel; 'Dark galaxies' and local very metal-poor gas-rich galaxies: possible interrelations S. Pustilnik; Morphology and environment of dwarf galaxies in the local universe H. Ann; Arecibo survey of HI emission from disk galaxies at redshift z 0.2 B. Catinella, M. Haynes, J. Gardner, A. Connolly and R. Giovanelli; AGES observations of
Determination of 241Am and 244Cm in environmental samples
International Nuclear Information System (INIS)
Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.
1998-01-01
The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)
244-IJBCS-Article-Dr Obodai E A
African Journals Online (AJOL)
RHUMSIKI
differences among the biochemical compositions of the five fish species studied. Moisture content ranged .... grounds, fishing season, sex of the fish, feed intake and .... dry skim milk and calf's brain that are ... The Chemical Biology of. Fishes.
All projects related to | Page 244 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-02-07
Research aimed at policymakers in Ukraine, Russia, and Belarus will highlight how tobacco taxation policies can serve public health goals and reduce the burden of tobacco-related diseases and deaths. Start Date: February 7, 2012. End Date: March 12, 2013. Topic: TOBACCO, SMOKING, TAXATION, PUBLIC HEALTH.
29 CFR 1952.244 - Level of Federal enforcement.
2010-07-01
... OSHA authority to issue citations for violation of such standards under sections 5(a)(2) and 9 of the... proceedings in contested cases under section 10; to institute proceedings to correct imminent dangers under.... (b) In accordance with section 18(e), final approval relinquishes Federal OSHA authority only with...
Lifescience Database Archive (English)
Full Text Available vliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms... Frame A: vgkvliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms
Poweo 2006 consolidated revenue at euro 244 million, up 121%
International Nuclear Information System (INIS)
2007-01-01
POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007
Directory of Open Access Journals (Sweden)
Cristina Femoni
2016-10-01
Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.
Curry, B. B.
2014-12-01
Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-01-15
POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007.
Poly[bis(μ2-4,4′-bipyridinebis(3-nitrobenzoatocobalt(II
Directory of Open Access Journals (Sweden)
Pei-Hsuan Chiang
2009-11-01
Full Text Available The hydrothermal reaction of cobalt nitrate with 4,4′-bipyridine and 3-nitrobenzoic acid lead to the formation of the title complex, [Co(C7H4NO42(C10H8N22]n. In the crystal structure, the CoII atoms are coordinated by two terminal carboxylate anions and four 4,4′-bipyridine ligands within slightly distorted octahedra. The CoII atom and one of the two independent 4,4′-bipyridine ligands are located on a twofold rotation axis, while the second independent 4,4′-bipyridine molecule is located on a centre of inversion. One of the two rings of one 4,4′-bipyridine ligand is disordered over two orientations and was refined using a split model [occupancy ratio 0.68 (2:0.32 (2]. The CoII atoms are connected by the 4,4′-bipyridine ligands into layers, which are located parallel to the ab plane.
40 CFR 421.244 - Standards of performance for new sources.
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Nickel... all times. (c) Acid reclaim leaching belt filter backwash. NSPS for the Secondary Nickel Subcategory...
People and things. CERN Courier, May 1984, v. 24(4)
International Nuclear Information System (INIS)
Anon.
1984-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The peak energy collision energy in the PETRA electron-positron ring at the German DESY Laboratory continues to be nudged higher. One of the talking points at last summer's conferences was a new measurement of the mass of the F meson by the CLEO group at the CESR electron-positron ring at Cornell, USA. The CERN Accelerator School, the European Committee for Future Accelerators (ECFA) and the Italian INFN are organizing a workshop on the generation of high fields for particle acceleration to very high energies, to be held at Frascati from 25 September to 1 October. From 23 June to 13 July, a meeting is being organized at Snowmass (Colorado) for the US high energy physics community to help contribute towards the definition of the proposed Superconducting Super Collider (SSC)
2010-07-21
... application and case record and to report findings and recommendations to the Board. Public comment is invited...--Riverside County, CA; Application for Reorganization Under Alternative Site Framework An application has been submitted to the Foreign-Trade Zones (FTZ) Board (the Board) by the March Joint Powers Authority...
SU-F-T-244: Radiotherapy Risk Estimation Based On Expert Group Survey
Energy Technology Data Exchange (ETDEWEB)
Koo, J; Yoon, M [Korea University, Seoul (Korea, Republic of); Chung, W; Chung, M; Kim, D [Kyung Hee University Hospital at Gangdong, Gangdong-gu, Seoul (Korea, Republic of)
2016-06-15
Purpose: To evaluate the reliability of RPN (Risk Priority Number) decided by expert group and to provide preliminary data for adapting FMEA in Korea. Methods: 1163 Incidents reported in ROSIS for 11 years were used as a real data to be compared with, and were categorized into 146 items. The questionnaire was composed of the 146 items and respondents had to valuate ‘occurrence (O)’, ‘severity (S)’, ‘detectability (D)’ of each item on a scale from 1 to 10 according to the proposed AAPM TG-100 rating scales. 19 medical physicists from 19 different organizations in Korea had participated in the survey. Because the number of ROSIS items was not evenly spread enough to be classified into 10 grades, 1–5 scale was chosen instead of 1–10 and survey result was also fit to 5 grades to compare. Results: The average O,S,D were 1.77, 3.50, 2.13, respectively and the item which had the highest RPN(32) was ‘patient movement during treatment’ in the survey. When comparing items ranked in the top 10 of each survey(O) and ROSIS database, two items were duplicated and ‘Simulation’ and ’Treatment’ were the most frequently ranked RT process in top 10 of survey and ROSIS each. The Chronbach α of each RT process were ranged from 0.74 to 0.99 and p-value was <0.001. When comparing O*D, the average difference was 1.4. Conclusion: This work indicates the deviation between actual risk and expectation. Considering that the respondents were Korean and ROSIS is mainly composed of incidents happened in European countries and some of the top 10 items of ROSIS cannot be applied in radiotherapy procedure in Korea, the deviation could have been came from procedural difference. Moreover, if expert group was consisted of experts from various parts, expectation might have been more accurate. Therefore, further research on radiotherapy risk estimation is needed.
Phase I study of Carzelesin (U-80,244) given (4-weekly) by intravenous bolus schedule
Awada, A; Punt, C J A; Piccart, M J; Tellingen, O Van; Manen, L Van; Kerger, J; Groot, Y; Wanders, J; Verweij, J; Wagener, D J Th
1999-01-01
Carzelesin is a cyclopropylpyrroloindole analogue which acts as a DNA-sequence-specific alkylating agent. In this phase I study, Carzelesin was given as a 4-weekly 10 min IV infusion to 51 patients with advanced solid tumours. Patients received a median of two courses (range 1–5) at one of nine dose levels: 24, 48, 96, 130, 150, 170, 210, 250 and 300 μg m−2. According to NCI-CTC criteria, non-haematological toxicities (grade 1/2) included fever, nausea and vomiting, mucositis and anorexia, none of which was clearly dose related. The dose-limiting toxicity was haematological and consisted mainly of neutropenia and to a lesser extent thrombocytopenia. From the dose level 150 μg m−2, the haematological toxicity (particularly thrombocytopenia) was delayed in onset, prolonged and cumulative in some patients. In several courses, double WBC nadirs occurred. The maximum tolerated dose for a single course was 300 μg m−2. From the dose level 170 μg m−2, the intended dose intensity could not be delivered to most patients receiving > 2 courses owing to cumulative haematological toxicity. The dose level with the best dose intensity for multiple courses was 150 μg m−2. The pharmacokinetics of Carzelesin and its metabolites (U-76,073; U-76,074) have been established in 31 patients during the first course of treatment using a HPLC method. Carzelesin exhibited linear pharmacokinetics. The concentration of U-76,074 (active metabolite) extended above the lower limit of quantitation (1 ng ml−1) for short periods of time and only at the higher dose levels. There was no relationship between neutropenia and the AUC of the prodrug Carzelesin, but the presence of detectable plasma levels of the active metabolite U-76,074 was usually associated with a substantial decrease in ANC values. © 1999 Cancer Research Campaign PMID:10188890
SU-F-T-244: Radiotherapy Risk Estimation Based On Expert Group Survey
International Nuclear Information System (INIS)
Koo, J; Yoon, M; Chung, W; Chung, M; Kim, D
2016-01-01
Purpose: To evaluate the reliability of RPN (Risk Priority Number) decided by expert group and to provide preliminary data for adapting FMEA in Korea. Methods: 1163 Incidents reported in ROSIS for 11 years were used as a real data to be compared with, and were categorized into 146 items. The questionnaire was composed of the 146 items and respondents had to valuate ‘occurrence (O)’, ‘severity (S)’, ‘detectability (D)’ of each item on a scale from 1 to 10 according to the proposed AAPM TG-100 rating scales. 19 medical physicists from 19 different organizations in Korea had participated in the survey. Because the number of ROSIS items was not evenly spread enough to be classified into 10 grades, 1–5 scale was chosen instead of 1–10 and survey result was also fit to 5 grades to compare. Results: The average O,S,D were 1.77, 3.50, 2.13, respectively and the item which had the highest RPN(32) was ‘patient movement during treatment’ in the survey. When comparing items ranked in the top 10 of each survey(O) and ROSIS database, two items were duplicated and ‘Simulation’ and ’Treatment’ were the most frequently ranked RT process in top 10 of survey and ROSIS each. The Chronbach α of each RT process were ranged from 0.74 to 0.99 and p-value was <0.001. When comparing O*D, the average difference was 1.4. Conclusion: This work indicates the deviation between actual risk and expectation. Considering that the respondents were Korean and ROSIS is mainly composed of incidents happened in European countries and some of the top 10 items of ROSIS cannot be applied in radiotherapy procedure in Korea, the deviation could have been came from procedural difference. Moreover, if expert group was consisted of experts from various parts, expectation might have been more accurate. Therefore, further research on radiotherapy risk estimation is needed.
40 CFR 98.244 - Monitoring and QA/QC requirements.
2010-07-01
... NIST Handbook 44 (2009) (incorporated by reference, see § 98.7) or follow procedures specified by the... Natural Gas by Gas Chromatography (incorporated by reference, see § 98.7). (ii) ASTM D6060-96 (Reapproved..., Other Hydrocarbons, and Carbon Dioxide in High-Purity Ethylene by Gas Chromatography (incorporated by...
Milhaud, Olivier
2003-01-01
The deeply geographical nature of moral issues « Our choices are, in effect, guided by a map of moral alternatives, a map of which we are not aware. Through our everyday interactions, we trace the moral geography of our lives » Stephen Birdsall, 1996 “This book explores the interface between geography, ethics, and morality” and David Smith helps us to understand “how geographical context is significant to moral practice, and how ethical deliberation is incomplete without recognition of the ge...
People and things. CERN Courier, May 1984, v. 24(4)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1984-05-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The peak energy collision energy in the PETRA electron-positron ring at the German DESY Laboratory continues to be nudged higher. One of the talking points at last summer's conferences was a new measurement of the mass of the F meson by the CLEO group at the CESR electron-positron ring at Cornell, USA. The CERN Accelerator School, the European Committee for Future Accelerators (ECFA) and the Italian INFN are organizing a workshop on the generation of high fields for particle acceleration to very high energies, to be held at Frascati from 25 September to 1 October. From 23 June to 13 July, a meeting is being organized at Snowmass (Colorado) for the US high energy physics community to help contribute towards the definition of the proposed Superconducting Super Collider (SSC)
Consistent evaluation of neutron cross sections for the 242-244Cm isotopes
International Nuclear Information System (INIS)
Ignatyuk, A.V.; Maslov, V.M.
1989-01-01
The knowledge of neutron cross-sections for Curium isotopes is necessary for solving the problems of the external fuel cycle. Experimental information on the cross-sections is very meager and does not satisfy requirements and existing evaluations in different libraries differ substantially for fission and (n,2n) reaction cross-sections. This situation requires a critical review of the entire set of evaluations of the neutron cross-sections for Curium. 17 refs, 3 figs
Riding Bare-Back on unstructured meshes for 21. century criticality calculations - 244
International Nuclear Information System (INIS)
Kelley, K.C.; Martz, R.L.; Crane, D.L.
2010-01-01
MCNP has a new capability that permits tracking of neutrons and photons on an unstructured mesh which is embedded as a mesh universe within its legacy geometry capability. The mesh geometry is created through Abaqus/CAE using its solid modeling capabilities. Transport results are calculated for mesh elements through a path length estimator while element to element tracking is performed on the mesh. The results from MCNP can be exported to Abaqus/CAE for visualization or other-physics analysis. The simple Godiva criticality benchmark problem was tested with this new mesh capability. Computer run time is proportional to the number of mesh elements used. Both first and second order polyhedrons are used. Models that used second order polyhedrons produced slightly better results without significantly increasing computer run time. Models that used first order hexahedrons had shorter runtimes than models that used first order tetrahedrons. (authors)
Determination of Am-241, Cm-242 and Cm-244 in environmental samples
International Nuclear Information System (INIS)
Afsar, M.; Schuettelkopf, H.
1988-01-01
An analytical procedure for the determination of Am and Cm in environmental, liquid and gaseous effluent samples was developed. It is based on extraction chromatography with subsequent anion and cation exchange to remove matrix elements and to purify Am and Cm, which are then electrode posited from an oxalate/HCl medium. The mean value of the chemical yield is about 90%. A detection limit of 7 μBq/g is achieved. The decontamination factors for important α emitters are > 10 4 . Four analyses/week can be performed by one technician. (orig./RB) [de
U. S. Atlantic Fleet, Eighth Amphibious Force. Operation Plan Number 2-44
1944-01-01
distributed with this Operation Order. (c) Panoramic Bench Sketches No. P-l for Boach 259 and No. P~3 for Loach 26l (South) givo viator level...To indicate tank or ID targets. (g) Green Cluster, White Cluster - Lift Artillery fire. Page 32 of 33. ANNEX KENS . GTMFIRS SUPPORT PLAN. TABLE VI...AURORA . SFCP 5 AUX GROUND SPOT - LIVERMORS SFCP 6 AUX GROUND SPOT - LA GLOIRE SFCP 7 AUX GROUND -SPOT ~ TERM- ERIC SFCP 8 AUX GROUND SPOT - ORION-KEAR
2010-05-12
... Control Number 0704-0253) AGENCY: Defense Acquisition Regulations System, Department of Defense. ACTION... proposed information collection; (c) ways to enhance the quality, utility, and clarity of the information..., withhold, or withdraw purchasing system approval at the conclusion of a purchasing system review...
25 CFR 1000.244 - May the Secretary suspend construction activities under an AFA?
2010-04-01
... construction activities under an AFA? (a) The Secretary may require a Tribe/Consortium to suspend certain work under a construction portion of an AFA for up to 30 days only if: (1) Site conditions adversely affect health and safety; or (2) Work in progress or completed fails to substantially carry out the terms of the...
7 CFR 2.44 - Administrator, Risk Management Agency and Manager, Federal Crop Insurance Corporation.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Risk Management Agency and Manager... Secretary for Farm and Foreign Agricultural Services to the Administrator, Risk Management Agency, and... for the transaction of the business of the Federal Crop Insurance Corporation and the Risk Management...
SU-E-T-244: Designing Low-Z Targets To Enhance Surface Dose: A Monte Carlo Simulation
Energy Technology Data Exchange (ETDEWEB)
Kelly, R [Nova Scotia Cancer Centre, Halifax, NS (Canada); Robar, J [Capital District Health Authority, Halifax, NS (Canada); Parsons, D [Dalhousie University, Halifax, Nova Scotia (Canada)
2015-06-15
Purpose: Recent developments in The Varian Truebeam linac platform allows for the introduction of low-Z targets into the beam line for the imaging purposes. We have proposed using a low-Z target for radiation therapy purposes to enhance the surface dose during radiation treatment. The target arm of the Varian Truebeam accelerator consists of multiple targets with are linearly translated into the beam line. We have designed two Low-Z targets made of carbon: 1) a step target consisting of three steps of 15%, 30% and 60% CSDA range for 2.5 MeV electrons Figure 1a; 2) and a ramp target, an incline plane 2cm long with thicknesses ranging from 0% to 60% CSDA range, Figure 1b. The purpose of this work will determine the spectral characteristics of these target designs and determine if they have practical clinical applications for enhancing surface dose. Methods: To calculate the spectral characteristics of these targets, a standard Monte Carlo model of a Varian Clinac accelerator was used. Simulations were performed with a carbon step target, and a carbon ramp target, located at the same position as the electron foil in the rotating carousel. Simulations were carried out using a 2.5 MeV electron beam. Results: The step target design produced spectral characteristics which were similar to spectral model using a single disk target of the same thickness. The ramp target provides a means to have positional variation of the spectral components of the beam, however, the electron component as 60% CSDA us much broader than the step target. Conclusion: The carbon step-target provides a spectral distribution which is similar to a carbon disk of comparable thickness. The spectral distribution from the ramp-target can be modified as a function of position to provide a wide range of low energy electrons for surface dose enhancement.
Yu, Miao; Liu, Jiyan; Wang, Thanh; Sun, Jianteng; Liu, Runzeng; Jiang, Guibin
2013-01-01
There is currently limited knowledge on PBDE metabolism in plants although they could play an important role in the environmental transformation of these persistent organic pollutants. In this study, pumpkin (Cucurbita maxima × C. moschata) was chosen as the model to understand the fate of BDE-28 in plants. MeO-tri-BDEs, OH-tri-BDEs, and OH-tri-BDEs were found as metabolites in plant samples of both in vivo hydroponic and in vitro tissue culture exposure. Three MeO-tri-BDEs were further identified as para-substituted metabolites. MeO-BDEs and OH-BDEs, respectively, accounted for about 1.6% and 1.5% (recovery corrected) of initial amount of BDE-28 according to the semiquantitative results. Other PBDEs, especially less brominated PBDEs as impurities in the standard of BDE-28, were also detected. The impurities and evaporation of the standard must be considered when trace metabolites are studied in exposure experiments.
International Nuclear Information System (INIS)
Kuroda, P.K.; Myers, W.A.
1990-01-01
More than 550 mass-spectrometric analyses of xenon released from bulk samples and temperature fractions of the lunar fines, breccias and rocks have been carried out in various laboratories in the world including the Soviet Union, since Apollo 11 astronauts made the first successful landing on the moon on 20 July 1969. Re-examination of all the known xenon isotope data for the lunar samples reveals that the moon started to retain her xenon at about the same time as the carbonaceous chondrites, when the initial ratio of Pu to U within the solar system was about 1 to 10 (atom/atom) more than 4,800 million years ago
Investigation of the soil-to-plant transfer of Np-237, Pu-238, Am-241 and Cm-244
International Nuclear Information System (INIS)
Pimpl, M.
1988-08-01
Inside a greenhouse for radioecological studies the root uptake of Np, Pu, Am, and Cm from 5 different soils into 19 crop plants have been measured. The soils have been artificially contaminated with the 4 nuclides in range from 1-20 Bq/g dry soil. Within 7 vegetation periods about 380 transfer measurements have been performed. The obtained results show that the soil-to-plant transfer is mainly influenced by the following parameters: physical and chemical properties of the different radionuclides, plant species and variety, soil type, time of soil utilization and soil management. The transfer factors measured are compared with those data which are proposed for the calculation of the long term radiation burden of the population by ingestion of contaminated food inside the Federal Republic of Germany. The experiments have been performed from the beginning of 1983 to the end of 1986. The results summarized within this report have already been published in annual reports or as contributions to scientific meetings. (orig.) [de
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Subjects to be addressed in a Safety Integration... Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND...
Poly[[diaquabis(μ2-4,4′-bipyridinemanganese(II] bis[2-(2-carboxyphenyldisulfanylbenzoate
Directory of Open Access Journals (Sweden)
Shao-Ming Fang
2009-05-01
Full Text Available The title complex, {[Mn(C10H8N22(H2O2](C14H9O4S22}n, contains an octahedrally coordinated MnII cation and 2-(2-carboxyphenyldisulfanylbenzoate anions. The MnII center is situated on a crystallographic center of inversion and is coordinated by four 4,4′-bipyridine (4,4′-bipy ligands and two water molecules. The 4,4′-bipy ligands act as bridging ligands, producing a fishing-net-like two-dimensional framework. In the crystal structure, this positively charged framework is charge balanced by 2-(2-carboxyphenyldisulfanylbenzoate anions that form a separate anionic two-dimensional framework via intermolecular O—H...O hydrogen bonds and C—H...π stacking interactions. Additional intermolecular O—H...O hydrogen bonds link the cationic and anionic frameworks to form the three-dimensional crystal structure.
Fan texture of the compound Ba3Co2Fe244O41 pre-aligned in a magnetic field
Huijser-Gerits, E.M.C.; Rieck, G.D.; Vogel, D.L.
1970-01-01
Samples of the ferrimagnetic material Ba3Co2Fe24O41, pre-aligned in a magnetic field and sintered at various temps., have been examd. for preferred orientation. Schulz's reflection technique and the standardizing method of Holland were used to det. quant. pole figures of several lattice planes. The
Notice of construction work in tank farm waste transfer pit 244-TX double contained receiver-tank
International Nuclear Information System (INIS)
HILL, J.S.
1999-01-01
The following description and any attachments and references are provided to the Washington State Department of Health (WDOH), Division of Radiation Protection, Air Emissions and Defense Waste Section as a notice of construction (NOC) in accordance with Washington Administrative Code (WAC) 246-247, Radiation Protection - Air Emissions. WAC 246-247-060, ''Applications, registration, and licensing'', states ''This section describes the information requirements for approval to construct, modify, and operate an emission unit. Any NOC requires the submittal of information listed in Appendix A,'' Appendix A (WAC 246-247-1 10) lists the requirements that must be addressed. Additionally, the following description, attachments, and references are provided to the U.S. Environmental Protection Agency (EPA) as an NOC, in accordance with Title 40 Code of Federal Regulations (CFR), Part 61, ''National Emission Standards for Hazardous Air Pollutants.'' The information required for submittal to the EPA is specified in 40 CFR 61.07. The potential emissions from this activity are estimated to provide less than 0.1 millired year total effective dose equivalent to the hypothetical offsite maximally exposed individual, and commencement is needed within a short time. Therefore, this application also is intended to provide notification of the anticipated date of initial startup in accordance with the requirement listed in 40 CFR 61.09(a)(1), and it is requested that approval of this application also will constitute EPA acceptance of this initial startup notification. Written notification of the actual date of initial startup, in accordance with the requirement listed in 40 CFR 61.09(a)(2), will be provided later. The activities described in this NOC are estimated to provide a potential offsite (unabated) total effective dose equivalent (TEDE) to the hypothetical maximally exposed individual (MEI) of 2.36 E-02 millirem per year
International Nuclear Information System (INIS)
Frolova, L.M.; Frolov, A.A.; Vasil'ev, V.Ya.
1984-01-01
Radiation-chemical behaviour of neptunium ions in nitric acid solutions is studied under the action of intensive internal alpha-irradiation conditioned by curium nuclides. In 0.3-1.1 mol/l solutions of nitric acid radiation-chemical oxidation of neptunium (4) and reduction of neptunium (6) is obeyed to the first order law of reaction rate in respect to neptunium concentration. Effective constants of neptunium (4) oxidation rates and neptuniumi(6) reduction rates are not dependent on neptunium ion in1tial concentration and increase with a growth of a dose rate of alpha-irradiation of solution. In equilibrium only neptunium (5) and neptunium (6) are present in solutions with HNO 3 concentration less than 1 mol/l. In more concentrated solutions equilibrium between sexa-, penta- and tetravalent neptunium forms is established. Equilibrium concentrations of neptunium valent forms are not dependent on neptunium initial oxidation state under the same initial conditions (dose rate, neptunium concentration and acidity. It is shown form experimental data that under the action of alpha-irradiation neptunium (5) both is oxidated to neptunium (6) and is reduced to neptunium (4)
Prompt neutron emission from fragments in spontaneous fission of {sup 244,248}Cm and {sup 252}Cf
Energy Technology Data Exchange (ETDEWEB)
Vorobyev, A. S.; Shcherbakov, O. A. [Petersburg Nuclear Physics Institute, Gatchina, Leningrad district, 188300 (Russian Federation); Dushin, V. N.; Jakovlev, V. A.; Kalinin, V. A.; Petrov, B. F. [V.G. Khlopin Radium Institute, St. Petersburg, 194021 (Russian Federation); Hambsch, F.J [EC-JRC-Institute for Reference Materials and Measurements Retieseweg 111, B-2440 Geel (Belgium); Laptev, A. B. [Petersburg Nuclear Physics Institute, Gatchina, Leningrad district, 188300 (Russian Federation); Japan Nuclear Cycle Development Institute, Tokai-mura, Naka-gun, Ibaraki 319-1194 (Japan)
2005-07-01
Neutrons emitted in fission were measured separately for each complementary fragment in correlation with fission fragment energies. Two high efficiency Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pin-hole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background and pile-up. The dependencies of these distributions on fragment mass and energy for different energy and mass bins, as well as the mass and energy distribution of the fission fragments are presented and discussed. (authors)
2010-10-01
... transaction: (a) Corporate culture. Each applicant shall: (1) Identify and describe differences for each safety-related area between the corporate cultures of the railroads involved in the transaction; (2... step-by-step measures, the integration of these corporate cultures and the manner in which it will...
DEFF Research Database (Denmark)
Jensen, Jesper Bo; Varming, Poul; Liu, B.
2001-01-01
Diode pumped continuous-wave UV lasers offer an interesting alternative to frequency doubled argon-ion lasers. We report the first photosensitivity comparison using these lasers on deuterium loaded standard telecommunication fibers and unloaded experimental fibers....
2010-04-01
... taxes. (c) Content of application and supporting documents. (1) An importer must state his estimate of the largest amount of taxes to be deferred in any semimonthly period based on the largest amount of... accordance with 26 U.S.C. 6621(b). (g) Restrictions on deferring tax deposits. An importer may not on one...
Poly[[diaqua-μ2-4,4′-bipyridyl-μ2-o-phthalato-nickel(II] dihydrate
Directory of Open Access Journals (Sweden)
Bing Li
2008-02-01
Full Text Available In the title layer complex, {[Ni(C8H4O4(C10H8N2(H2O2]·2H2O}n, the Ni atom has a distorted octahedral environment, defined by the phthalate and 4,4′-bipyridyl ligands which link the Ni atoms, forming a square lattice in the bc plane. This extends into a three-dimensional supramolecular network through O—H...O hydrogen-bonding interactions. The Ni atom lies on, and both ligands are bisected by, a crystallographic twofold axis.
Critical Masses for Unreflected Metal Spheres
International Nuclear Information System (INIS)
Westfall, Robert Michael; Wright, Richard Q.
2009-01-01
Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.
Energy Technology Data Exchange (ETDEWEB)
Yudintsev, Sergey V.; Lizin, Andrey A.; Livshits, Tatiana S.; Stefanovsky, Sergey V.; Tomilin, Sergey V.; Ewing, Rodney C.
2015-02-16
VizieR Online Data Catalog: CoRoT observation log (N2-4.4) (CoRoT, 2009-2016)
COROT Team
2014-03-01
CoRoT is a space astronomy mission devoted to the study of the variability with time of stars brightness, with an extremely high accuracy (100 times better than from the ground), on very long durations (up to 150 days) and a very high duty cycle (more than 90%). The mission was led by CNES in association with four french laboratories, and 7 participating countries and agencies (Austria, Belgium, Brazil, Germany, Spain, and the ESA Science Programme). The satellite is composed of a PROTEUS platform (the 3rd in the serie), and a unique instrument: a stellar photometer. It has been launched on December 27th 2006 by a Soyuz Rocket, from Baikonour. The mission has lasted almost 6 years (the nominal 3 years duration and a 3 years extension) and has observed more than 160 000 stars. It stopped to send data suddenly on November 2nd 2012. CoRoT is performing Ultra High Precision Photomery of Stars to detect and characterise the variability of their luminosity with two main directions: - variability of the object itself: oscillations, rotation, magnetic activity - variability due to external causes as bodies in orbit around the star: planets and stars The original scientific objectives were focussed on the study of stellar pulsations (asteroseismology) to probe the internal structure of stars, and the detection of small exoplanets through their "transit in front of their host star, and the measurement of their size. This lead to introduce two modes of observations, working simultaneously: - The bright star mode dedicated to very precise seismology of a small sample of bright and closeby stars (data presented in file momentarily named "astero.dat", but should change in the near future to to "bright star.dat") - The faint star mode, observing a very large number of stars at the same time, to detect transits, which are rare events, as they imply the alignment of the star, the planet and the observer (data presented in momentarily named "exo.dat" but should change in the near future to "faint star.dat"). The large amount of data gathered in this mode mode turned out to be extremely fruitful for many topics of stellar physics. Due to project constraints, two regions of the sky were accessible (circles of 10 degrees centered on the equator around alpha=06:50 and alpha=18:50). They are called the CoRoT eyes: the fisrt one is called the "anticenter" eye, whereas the second one is called the "center eye". Each pointing covers 1.4x2.8 square degrees The CoRoT project is still processing the data, aiming at at removing instrumental artifacts and defects. Therefore the format and content of the catalog is still somehow evolving. More details on the data can be found in the "CoRoTN2versions_30sept2014.pdf" document available on the vizier ftp as well as project websites listed in the "See also" field below. (3 data files).
National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...
Energy Technology Data Exchange (ETDEWEB)
Liu, Z; Kennedy, A [Sarah Cannon, Nashville, TN (United States); Larsen, E; Hayes, C; Grow, A [North Florida Cancer Center, Gainesville, FL (United States); Bahamondes, S.; Zheng, Y; Wu, X [JFK Comprehensive Cancer Institute, Lake Worth, FL (United States); Choi, M; Pai, S [Good Samaritan Hospital, Los Gatos, CA (United States); Li, J [Doctors Hospital of Augusta, Augusta, GA (United States); Cranford, K [Trident Medical Center, Charleston, SC (United States)
2015-06-15
Purpose: The study aims to develop and validate a knowledge based planning (KBP) model for external beam radiation therapy of locally advanced non-small cell lung cancer (LA-NSCLC). Methods: RapidPlan™ technology was used to develop a lung KBP model. Plans from 65 patients with LA-NSCLC were used to train the model. 25 patients were treated with VMAT, and the other patients were treated with IMRT. Organs-at-risk (OARs) included right lung, left lung, heart, esophagus, and spinal cord. DVH and geometric distribution DVH were extracted from the treated plans. The model was trained using principal component analysis and step-wise multiple regression. Box plot and regression plot tools were used to identify geometric outliers and dosimetry outliers and help fine-tune the model. The validation was performed by (a) comparing predicted DVH boundaries to actual DVHs of 63 patients and (b) using an independent set of treatment planning data. Results: 63 out of 65 plans were included in the final KBP model with PTV volume ranging from 102.5cc to 1450.2cc. Total treatment dose prescription varied from 50Gy to 70Gy based on institutional guidelines. One patient was excluded due to geometric outlier where 2.18cc of spinal cord was included in PTV. The other patient was excluded due to dosimetric outlier where the dose sparing to spinal cord was heavily enforced in the clinical plan. Target volume, OAR volume, OAR overlap volume percentage to target, and OAR out-of-field volume were included in the trained model. Lungs and heart had two principal component scores of GEDVH, whereas spinal cord and esophagus had three in the final model. Predicted DVH band (mean ±1 standard deviation) represented 66.2±3.6% of all DVHs. Conclusion: A KBP model was developed and validated for radiotherapy of LA-NSCLC in a commercial treatment planning system. The clinical implementation may improve the consistency of IMRT/VMAT planning.
Nugent, P.
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Nugent, P.
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
International Nuclear Information System (INIS)
Schenkel, R.
1977-03-01
The temperature dependence of the electrical resistivity of thin films of bulk 241 Am metal were measured between 300 and 4.5 K. The room temperature resistivity was found to be 68.90μΩcm. At room temperature the electrical resistivity of americium increases with pressure (3% up to 13 kbar). The application of 13 kbar pressure did not change the low temperature power law in the electrical resistivity. The resistivity vs temperature curve can be explained by assuming s-d scattering of conduction electrons. The localized 5f electrons are considered to be about 5eV below the Fermi level. Americium therefore should be the first lanthanide-like element in the actinide series. The defect production due to self-irradiation damage was studied by measuring the increase of the resistivity at 4.2 K over a period of 738 h. A saturation resistivity of 16.036 μΩcm was found corresponding to a defect concentration of about 0.22 a/o. After isochronal annealing two recovery stages were observed at about 65 and 145 K. The two stages shift with increasing initial defect concentration to lower temperatures. Estimates of the activation energies and the reaction order were made and possible defect reactions suggested. The magnetic contribution to the electrical resistivity of curium, which shows an antiferromagnetic transition at 52.5 k, was obtained by subtracting the resistivity of americium (to be considered as phonon part). Comparison with theoretical models were made. At low temperatures the measurements are strongly affected by self-irradiation damage [drho/dt(t=0)=9.8μΩcm/h
International Nuclear Information System (INIS)
1982-05-01
The Systematic Evaluation Program was initiated in February 1978 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the R.E. Ginna Nuclear Power Plant (located in Wayne County near Rochester, NY), one of ten plants reviewed under Phase II of this program, and indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license
2010-01-01
... IMMIGRATION REGULATIONS PROCEEDINGS TO DETERMINE REMOVABILITY OF ALIENS IN THE UNITED STATES Cancellation of... admissible to the United States in accordance with section 202(a)(1)(B) of NACARA, and has continuously resided in the United States from December 1, 1995, through the date of appearance before the Service...
DEFF Research Database (Denmark)
Monrad, Nina; Ganestam, Ann; Kallemose, Thomas
2018-01-01
PURPOSE AND HYPOTHESIS: Shoulder lesions are common and a challenge to diagnose. They often result in significant disability for the patient and are an economic burden to society. From recent studies, an increasing incidence has been reported. The purpose of this study was to investigate and map ...
Energy Technology Data Exchange (ETDEWEB)
Whicker, F.W. (Colorado State Univ., Fort Collins, CO (USA)); Pinder, J.E. III; Bowling, J.W. (Savannah River Ecology Lab., Aiken, SC (USA)); Alberts, J.J. (Georgia Univ., Sapelo Island, GA (USA). Marine Inst.); Brisbin, I.L. Jr. (Savannah River Ecology Lab., Aiken, SC (USA))
1989-05-01
The gradual senescence of present-day operating nuclear facilities, and resultant contamination of aquatic and terrestrial ecosystems, emphasize the importance of understanding the behavior of radionuclides in the environment. Observations and deductions concerning mechanisms of radionuclide transport can contribute significantly to knowledge of fundamental ecological processes. This study emphasized the ecosystem-level distribution of several long-lived radionuclides in an abandoned reactor cooling impoundment after a twenty year period of chemical and biological equilibration. 90 refs., 14 figs., 5 tabs.
2010-10-01
... 105J500I Chloropicrin 105J500I112J500I Chlorosulfonic acid 105J500I112J500I Dimethyl sulfate 105J500I112J500I Ethyl chloroformate 105J500I112J500I Hexachlorocyclopentadiene 105J500I112J500I Hydrocyanic acid... trichloride 105J500I112J500I Sulfur trioxide, stabilized 105J500I112J500I Sulfuric acid, fuming...
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Thermal behaviour of pure and binary Fe(NO3)3.9H2O and (NH4)6Mo7O24.4H2O systems
International Nuclear Information System (INIS)
Shaheen, W.M.
2007-01-01
Thermal behaviour of pure ferric nitrate, ammonium molybdate and their mixtures in different ratios were investigated by means of thermal analysis (TG, DTG and DTA) techniques. Relative thermal analysis (RTA) graphical treatment of derivatographic curves of the components in the pure and binary system has been carried out as well. A series of Fe 2 O 3 -MoO 3 systems were prepared from pure and binary salts by heating at 350, 550, 750 and 1000 deg. C. The X-ray diffraction (XRD) analysis was used to characterize the phases produced from thermal treatment of investigated solids. The results revealed that pure ferric nitrate decomposed to Fe 2 O 3 at 250, while pure ammonium molybdate decomposed into MoO 3 and 340 deg. C and then melted at 790 deg. C. For the binary components, crystalline ferric or molybdenum oxides were detected beside ferric molybdate Fe 2 (MoO 4 ) 3 phase starting from 350 deg. C. Fe 2 (MoO 4 ) 3 phase was formed as a result of solid-solid interactions between the produced oxides. The thermal stability of the formed compound was significantly affected by the composition of the mixture and treatment temperature. The presence of two-component solids in the binary systems affected the thermal decomposition of their individual salt and affected their physical and chemical behaviour. The catalytic activity of the obtained pure and mixed oxides was measured using the decomposition of hydrogen peroxide reaction as a model reaction at 20-50 deg. C. It was found that the mixed oxide solids had catalytic activity higher than single oxides thermally treated at 350 and 550 deg. C. This is attributed to the increase in the concentration of active sites via creation of new ion pairs in case of binary systems. The rise in calcination temperature up to 750 and 1000 deg. C brought about drastic decrease in the activity of all solids because of changing catalyst composition and/or sintering process. The activation energies of H 2 O 2 decomposition were determined for pure and mixed solids. The results obtained were discussed in light of induced changes in chemical composition and treatment temperature
Directory of Open Access Journals (Sweden)
Yangmei Liu
2012-08-01
Full Text Available In the title compound, {[Cd(C9H5BrO4(C10H8N2(H2O]·H2O}n, the CdII atom has a distorted octahedral coordination geometry. Two N atoms from two 4,4′-bipyridine (bipy ligands occupy the axial positions, while the equatorial positions are furnished by three carboxylate O atoms from three 3-bromo-2-(carboxylatomethylbenzoate (bcb ligands and one O atom from a water molecule. The bipy and bcb ligands link the CdII atoms into a three-dimensional network. O—H...O hydrogen bonds and π–π interactions between the pyridine and benzene rings [centroid–centroid distance = 3.736 (4 Å] are present in the crystal.
Directory of Open Access Journals (Sweden)
Lucelene Lopes
2009-04-01
Full Text Available In this article we demonstrate the use of the tool OntoLP in the ontology construction process in an experiment in the health care area. Specifically, terms based on a corpus in the pediatrics area are extracted. We compare the result obtained by the tool with the reference results of a list of terms obtained manually. In this comparison, bigrams and trigrams obtained through different methods are analyzed. We conclude the work by observing the advantages of processing by including complex linguistic information such as syntactical and semantic analysis.
Energy Technology Data Exchange (ETDEWEB)
Rankine, L; Klein, E [Washington University, Saint Louis, MO (United States); Grantham, K [University of Missouri, Columbia, MO (United States); Goddu, S [Washington University, St. Louis, MO (United States); Cessac, R [Mevion Medical Systems, Littleton, MA (United States); Baker, K [Barne-Jewish Hospital, St. Louis, MO (United States); Santanam, L [Washington University School of Medicine, St.louis, MO (United States)
2014-06-01
Purpose: The Mevion S250 proton therapy unit is equipped with a 6D-robotic couch and IGRT system (Verity). The patient alignment process allows corrections in six degrees of freedom: translation (x,y,z), pitch, roll, and yaw (θ,ϑ,ψ). Geometric accuracy of couch corrections and imaging vs. radiation isocenter coincidence were quantified before clinical implementation. Methods: A commercial phantom with sixteen 2mm tungsten BBs was rigidly couch-mounted and imaged with CT. Seventeen rigid translations/rotations of known magnitude were digitally applied to the original CT image using commercial software, validated with Varian OBI system. For each altered image, phantom was mounted on robotic couch in original position, then Verity 2D:2D match (PA-LLAT) was performed using DRRs from altered images. Corrections were recorded and applied, phantom was imaged a second time and residual corrections recorded. Physical measurements verified that applied couch corrections coincided with both physical couch shifts/rotations and known CT image translations/rotations. Additionally, image vs. radiation isocenter coicidence was quantified over couch treatment angles (±90° from setup position) using radiochromic film and an image-guided couch star-shot. Posterior-anterior and left-lateral kV radiographs were taken before each beam was delivered to verify imaging/radiation isocentricity. Results: Verity suggested couch corrections and known CT shifts/rotations agreed within ±1mm (average: Δ lat=0.5mm; Δ vert=0.4mm; Δ long=0.3mm) and ± 0.4° (average: Δ pitch=0.24° Δ roll=0.01°; Δ yaw=0.10°). Physical couch measurements and Verity applied corrections agreed within ± 1mm (average: Δlat=0.5mm; Δvert=0.4mm; Δlong=0.2mm) and ±0.2° (average: Δpitch=0.03°; Δ roll=0.04°; Δ yaw=0.04°). The directionality of all translations and rotations were qualitatively verified. The image vs. radiation isocenter coincidence was <1mm and radiation-isocenter precision was <1mm over the 180° of couch motion, as indicated by film analysis. Conclusion: The Verity IGRT software and 6D-couch combination on the Mevion S250 was verified as accurate within 1mm and 0.5°. This complies with the TG-142 standards for a stereotactic radiotherapy IGRT system. Rob Cessac is employed as Product Manager for Mevion Medical Systems.
International Nuclear Information System (INIS)
Akhter, Nasima; Shiba, Kazuhiro; Ogawa, Kazuma; Tsuji, Shiro; Kinuya, Seigo; Nakajima, Kenichi; Mori, Hirofumi
2008-01-01
The radioiodinated (+)-p-iodovesamicol [(+)-pIV], which shows a high binding affinity for sigma-1 (σ-1) receptors, is prepared by an exchange reaction. The specific activity (SA) is fairly low and therefore is insufficient for clinical use. In this study, we prepared (+)-[ 125 I]pIV with a high SA from tributylstannyl precursor and compared the in vivo characteristics between high and low SA by imaging σ-1 receptors in the central nervous system. In the biodistribution study, a difference in brain accumulation was observed between the two methods. At 30 min postinjection, the brain accumulation (1.58%ID/g) of low SA [0.6-1.1 TBq/mmol (16-30 Ci/mmol)] (+)-[ 125 I]pIV was higher than that (1.34%ID/g) of high SA [>88.8 TBq/mmol (>2400 Ci/mmol)] (+)-[ 125 I]pIV. In the blocking study, the brain uptake of high SA (+)-[ 125 I]pIV was reduced more significantly by the coadministration of sigma ligands such as pentazocine, haloperidol or SA4503 than that of low SA (+)-[ 125 I]pIV. These results showed that nonspecific binding of high SA (+)-[ 125 I]pIV in the brain was lower than that of low SA (+)-[ 125 I]pIV, and high SA (+)-[ 125 I]pIV bound more specifically to σ-1 receptors in the brain than low SA (+)-[ 125 I]pIV. In contrast, in the blood-binding study, high SA (+)-[ 125 I]pIV (58.4%) bound to blood cells with higher affinity than low SA (+)-[ 125 I]pIV (46.0%). In metabolite studies, blood metabolites of high SA (+)-[ 125 I]pIV (57.3±3.5%) were higher than those of low SA (+)-[ 125 I]pIV (45.5±4.1%) at 30 min postinjection. Higher SA may be apt to bind to blood cells with higher affinity and to be metabolized faster
Directory of Open Access Journals (Sweden)
Giovanni de Araujo Gomes
2010-07-01
Full Text Available O ambiente de negócios tem apresentado constantes desafios aos dirigentes de empresas. Nesse contexto, a permanente vigilância, reflexo da competitividade e busca de produtividade, faz com as atenções estejam voltadas aos fatores antecedentes e, consequentemente, para a dimensão Responsabilidade Socioambiental Corporativa (RSAC. O trabalho analisa e estima a intensidade das relações entre os fatores valor da marca, reputação da empresa, satisfação dos interessados (stakeholders e riscos de externalidades, como satélites explicativos da RSAC. E, além dos testes de aderência no modelo relacional, propõe e testa uma equação para dimensionar o grau de Maturidade em Responsabilidade Socioambiental Corporativa Setorial (RSAC, procurando analisar e identificar, em que estágio a RSAC afeta os construtos finais enquanto retorno estratégico para as organizações. Esta pesquisa foi realizada no setor da construção civil de Minas Gerais, representado por seus gestores, e os dados coletados por meio de um survey usando um questionário com questões estruturadas com variação likert. Os dados foram avaliados mediante análise de equações estruturais usando o LVPLS. Para a mensuração das ações em Responsabilidade Socioambiental, utilizaram-se os modelos conhecidos nas organizações e academia, tais como o Índice de Sustentabilidade Empresarial, os Dow Jones Indexes, o indicador do Instituto Ethos e a representação teórica de Hopkins (1997.
International Nuclear Information System (INIS)
Courteau, Roland
2012-01-01
In a first part of this report, the author recalls the history of the creation of the Pacific experiment centre and the test campaign which took place without a real consultation of local populations. He comments the end of nuclear tests while giving an overview of site dismantling and of radioactive materials which have been left there. Then, he addresses the environmental consequences of the nuclear tests in French Polynesia: follow-up system, follow-up of radiological consequences, risks related to subsoil steadiness, necessity of better information of local populations and acknowledgement of test effects. He presents the bill project concerning the return of both atolls within the authority of French Polynesia. The discussion of the bill project articles is reported
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Cold fusion reactions with 48Ca
International Nuclear Information System (INIS)
Gaeggeler, H.W.; Jost, D.T.; Tuerler, A.
1989-04-01
Cold fusion reactions with 48 Ca on the targets 208 Pb, 209 Bi, 197 Au, 184 W, 180 Hf are reported. The experiments were performed at the velocity filter SHIP of GSI. The maximum cross sections show a steep descent by about four orders of magnitude when going from 224 Th to 228 U as compound nuclei. Between uranium and einsteinium the cross sections stay rather low and increase by about two orders of magnitude for nobelium. For lawrencium the cross section decrease again. 7 figs., 1 tab., 38 refs
ORF Alignment: NC_002935 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available QETYLKHLKGAVPRSLEGITVVVDC 180 ... Query: 244 XXXXRCLAVDAEGNVVDGDQIMAILALAMKENGELHKSTLVATVMSNLGLRLAMKEAGIE 303 ... ... ... RCLAVDAEGNVVDGDQIMAILALAMKENGELHKSTLVATVMSNLGLRLAMKEAGIE Sbjct: 241 GDADRCLAVDAEGNVVDGDQIMAILA
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available THASGASHRLASNERLEFLGDSVLGLTVCEWLFNEYPE 60 ... Query: 185 YIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLI...RETGPD 244 ... YIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPD Sbjct: 121 YIDGGPEIVRDRLKLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPD 180 ...
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 75 ... Query: 185 FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 244 ... ... FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP Sbjct: 1 ... FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 60 ...
ORF Alignment: NC_004917 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EAITQFADKYLMHGGTIEEVKEKIA 180 ... Query: 244 LDVEVSKYDYSVSNRGLRSNLVGTAKQVAQRIKAYEEAGLNLLIVQCAPMKEELERIAKE 303 ... ... ... LDVEVSKYDYSVSNRGLRSNLVGTAKQVAQRIKAYEEAGLNLLIVQCAPMKEELERIAKE Sbjct: 241 LDVEVSKYDYSVSNRGLRSNLVGTAKQVAQRIKAYEEAGLNLLIVQCAPMKEELERIAKE 300 ...
Arnoldussen, Stijn
2017-01-01
Borders, in the sense of modern geopolitical boundaries, have no bearing on prehistoric realities, yet they do affect archaeology as a discipline―particularly when one is committed to thinking, working, and writing on regions that transcend administrative limits, whether regional or national. While
Directory of Open Access Journals (Sweden)
Hadi Kargar
2012-07-01
Full Text Available The asymmetric unit of the title coordination polymer consists of a dinuclear neutral complex molecule of formula [Cu2(C18H14Br4N2O22]n. One of the CuII ions is coordinated in a distorted square-planar geometry, whereas the other is coordinated in a distorted square-pyramidal geometry, the long apical Cu—O bond [2.885 (4 Å] of the square-pyramidal coordination being provided by a symmetry-related O atom creating a one-dimensional polymer along [010]. π–π stacking interactions [centroid–centroid distance = 3.783 (4 Å] and short interchain Br...Br interactions [3.6142 (12–3.6797 (12 Å] are observed.
International Nuclear Information System (INIS)
Ouerfelli, N.
2014-01-01
Ionic self-diffusion coefficients (D) for trivalent radiotracers, lanthanide and actinide ions have been determined in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol L -1 at 298.15 K and pH 2.50 by the open-end capillary method. The data obtained in large range of concentrations, allow to derive the limiting value D deg, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. An empirical equation is suggested for predicting ionic hydration number with a good precision. (author)
International Nuclear Information System (INIS)
Ouerfelli, N.; Latrous, H.; Ammar, M.; Das, D.; Oliver, J.
2013-01-01
The open-end capillary method is used for the determination of ionic self-diffusion coefficients (D) for trivalent radiotracer, lanthanide and actinide ions are reported in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol.L -1 at 298.15 K and pH 2.50. The data obtained in large range of concentrations, allow deriving the limiting value D°, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. (author)
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
ORF Alignment: NC_002570 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available VIPEALDGQNLIVHSQTGTGKTLAYLLPMLTK 60 ... Query: 124 VAVGTPGRILELMEMKKLKVPHVKMIVVDEADRMMEETSAWNAFENVAKRIGNEAQYLFV... 183 ... VAVGTPGRILELMEMKKLKVPHVKMIVVDEADRMMEETSAWNAFENVAKRIGNEAQYLFV Sbjc...t: 121 VAVGTPGRILELMEMKKLKVPHVKMIVVDEADRMMEETSAWNAFENVAKRIGNEAQYLFV 180 ... Query: 244 GIVFVNRLEHVAETTAKLQFKGIK
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS 297 ... VWGTKDVVVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS Sbjct: 241 VWGTKDVVVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS 294 ...A Sbjct: 121 YQFPHLVERLILVGAGGVTKDVNFVLRWASLPLGSEAIALLRLPLVLPAVQLMGRVLGTA 180 ... Query: 244 VWGTKDVVVPVRHAWMAH
ORF Alignment: NC_006177 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SRDPGKARGRVPDGVEVRAGDVTDGATLGPAL 60 ... Query: 124 QTKPWFRAKLMAEKAIRESGIPYTIFRPSWVYGPEDRSLNKFATFARLLPFVPVIGSGRT... 183 ... QTKPWFRAKLMAEKAIRESGIPYTIFRPSWVYGPEDRSLNKFATFARLLPFVPVIGSGRT Sbjc...t: 121 QTKPWFRAKLMAEKAIRESGIPYTIFRPSWVYGPEDRSLNKFATFARLLPFVPVIGSGRT 180 ... Query: 244 WLMKAAAWPLQFLPTPPLSPGAVD
Late effects of inhaled 253Es(NO3)3 in rats
International Nuclear Information System (INIS)
Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.
1979-01-01
Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Bibliographic index to photonuclear reaction data
International Nuclear Information System (INIS)
Asami, Tetsuo; Nakagawa, Tsuneo.
1993-10-01
This report contains the bibliographic index data on photonuclear reactions and on their inverse ones, in the format similar to CINDA for neutron nuclear data. As photonuclear reactions the electron-induced reaction data are also included. As the inverse reactions considered are those induced by neutron, proton, deuteron, triton, helion and alpha particles. The index covers major journals on nuclear data published in 1995 to 1992, for all nuclides through hydrogen (H) to einsteinium (Es). The bibliographic index contains information on target nucleus, incident beam, type of reaction and quantity, energy range of incident beam, laboratory, type of work, reference citations, first author's name, and short comment. The index also contains the indication for information on cross-section data. All the index data are listed in the order of target element, target, mass and incident particle, and in the chronological order of reference data. Also a brief description is given on the data format, the abbreviations used and the journals surveyed. (author)
Dosimetry of the gastrointestinal tract
International Nuclear Information System (INIS)
Sullivan, M.F.; Cross, F.T.; Dagle, G.E.
1987-01-01
In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
International Nuclear Information System (INIS)
Timofeev, G.A.; Kalygin, V.V.; Privalova, P.A.
1986-01-01
By molar ratios of 243 Cm mixture with 244 Cm and Pu nuclides formed as a result of Cm nuclides α-decay the 243 Cm half-life T α243 is determined. The 244 Cm half-life is measured earlier with high accuracy. The 243 Cm/ 244 Cm ratio measured by means of a mass spectrometer equals 0.989+-0.004. The obtained value T α243 =29.20+-0.14 years
ORF Alignment: NC_002947 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TIMTDPAM 60 ... Query: 124 ... DTIDKAEDRSRFDKAMKDIGLECPRSGIAHSMEEANAVLEKLGFPCIIRPSFTMGGTGGG 183 ... DTIDKA...EDRSRFDKAMKDIGLECPRSGIAHSMEEANAVLEKLGFPCIIRPSFTMGGTGGG Sbjct: 121 ... DTIDKAEDRSRFDK...AMKDIGLECPRSGIAHSMEEANAVLEKLGFPCIIRPSFTMGGTGGG 180 ... Query: 244 ... GVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVETGGSNV
ORF Alignment: NC_004342 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available interrogans serovar Copenhageni str. ... Fiocruz L1-130] ... Length = 63 ... Query: 185 IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC 244 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC Sbjct: 1 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISHHTLEDGSEEIPDTYGWLVGCDICQDVC 60 ...
ORF Alignment: NC_005823 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available interrogans serovar Copenhageni str. ... Fiocruz L1-130] ... Length = 63 ... Query: 185 IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC 244 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC Sbjct: 1 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISHHTLEDGSEEIPDTYGWLVGCDICQDVC 60 ...
ORF Alignment: NC_004317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... falciparum 3D7] ... Length = 244 ... Query: 116 NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTY...EGNWIDNKMN 175 ... NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTYEGNWI...DNKMN Sbjct: 1 ... NKFIGNWINDKRNGLGFNIDIYKNIYYGYYENNLKNGWGYYKWSRKGSTYEGNWIDNKMN 60 ... Query: 236 ILPFNFIKINFKNIA
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Homi Bhabha Centre for Science Education: Admission to PhD Programme in Science Education - 2018 · More Details Abstract Fulltext PDF. pp 244-244 Information and Announcements. Physics Training and Talent Search · More Details Abstract Fulltext PDF. pp 245-245 Flowering Trees. Gymnosporia montana Benth.
African Journals Online (AJOL)
Items 201 - 244 of 244 ... ... The incidence of external male genital defects in Enugu State of Nigeria: an estimate based on the prevalence among secondary school students, Abstract. Oyiogu FN Ozoemena, Anthony U Mbah. Vol 23, No 1-4 (2011), The mind is sick, the body cries out: a review of childhood conversion disorder ...
Indian Academy of Sciences (India)
Plant Pathology
Supplementary data: Table 1. Identification of various virulence factors in R. solanacearum: Rs-09-161, Rs-10-244, GMI1000. Gene name Rs-09-161 locus tag*. Accession no. Rs-10-244 locus tag*. Accesion no. GMI1000 locus tag. Location. Gene description. Exopolysacharide. epsA. RALSO161_m00209880 KY661391 ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Physics Training and Talent Search. Information and Announcements Volume 23 Issue 2 February 2018 pp 244-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/023/02/0244-0244. Abstract ...
Applications of Text Analysis Tools for Spoken Response Grading
Crossley, Scott; McNamara, Danielle
2013-01-01
This study explores the potential for automated indices related to speech delivery, language use, and topic development to model human judgments of TOEFL speaking proficiency in second language (L2) speech samples. For this study, 244 transcribed TOEFL speech samples taken from 244 L2 learners were analyzed using automated indices taken from…
DEFF Research Database (Denmark)
Christiansen, Christian O.; Cockburn, Patrick Joseph
2014-01-01
Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk).......Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk)....
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
Liao, Hua-Xin; Tomaras, Georgia D.; Bonsignori, Mattia; Tsao, Chun-Yen; Hwang, Kwan-Ki; Chen, Haiyan; Lloyd, Krissey E.; Bowman, Cindy; Sutherland, Laura; Jeffries, Thomas L.; Kozink, Daniel M.; Stewart, Shelley; Anasti, Kara; Jaeger, Frederick H.; Parks, Robert; Yates, Nicole L.; Overman, R. Glenn; Sinangil, Faruk; Berman, Phillip W.; Pitisuttithum, Punnee; Kaewkungwal, Jaranit; Nitayaphan, Sorachai; Karasavva, Nicos; Rerks-Ngarm, Supachai; Kim, Jerome H.; Michael, Nelson L.; Zolla-Pazner, Susan; Santra, Sampa; Letvin, Norman L.; Harrison, Stephen C.
2013-01-01
An immune correlates analysis of the RV144 HIV-1 vaccine trial revealed that antibody responses to the gp120 V1/V2 region correlated inversely with infection risk. The RV144 protein immunogens (A244-rp120 and MN-rgp120) were modified by an N-terminal 11-amino-acid deletion (Δ11) and addition of a herpes simplex virus (HSV) gD protein-derived tag (gD). We investigated the effects of these modifications on gp120 expression, antigenicity, and immunogenicity by comparing unmodified A244 gp120 with both Δ11 deletion and gD tag and with Δ11 only. Analysis of A244 gp120, with or without Δ11 or gD, demonstrated that the Δ11 deletion, without the addition of gD, was sufficient for enhanced antigenicity to gp120 C1 region, conformational V2, and V1/V2 gp120 conformational epitopes. RV144 vaccinee serum IgGs bound more avidly to A244 gp120 Δ11 than to the unmodified gp120, and their binding was blocked by C1, V2, and V1/V2 antibodies. Rhesus macaques immunized with the three different forms of A244 gp120 proteins gave similar levels of gp120 antibody titers, although higher antibody titers developed earlier in A244 Δ11 gp120-immunized animals. Conformational V1/V2 monoclonal antibodies (MAbs) gave significantly higher levels of blocking of plasma IgG from A244 Δ11 gp120-immunized animals than IgG from animals immunized with unmodified A244 gp120, thus indicating a qualitative difference in the V1/V2 antibodies induced by A244 Δ11 gp120. These results demonstrate that deletion of N-terminal residues in the RV144 A244 gp120 immunogen improves both envelope antigenicity and immunogenicity. PMID:23175357
Cross Sections for Inner-Shell Ionization by Electron Impact
Energy Technology Data Exchange (ETDEWEB)
Llovet, Xavier, E-mail: xavier@ccit.ub.edu [Centres Científics i Tecnològics, Universitat de Barcelona, Lluís Solé i Sabarís 1-3, 08028 Barcelona (Spain); Powell, Cedric J. [Materials Measurement Science Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8370 (United States); Salvat, Francesc [Facultat de Física (ECM and ICC), Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Jablonski, Aleksander [Institute of Physical Chemistry, Polish Academy of Sciences, ul. Kasprzaka 44/52, 01-224 Warsaw (Poland)
2014-03-15
An analysis is presented of measured and calculated cross sections for inner-shell ionization by electron impact. We describe the essentials of classical and semiclassical models and of quantum approximations for computing ionization cross sections. The emphasis is on the recent formulation of the distorted-wave Born approximation by Bote and Salvat [Phys. Rev. A 77, 042701 (2008)] that has been used to generate an extensive database of cross sections for the ionization of the K shell and the L and M subshells of all elements from hydrogen to einsteinium (Z = 1 to Z = 99) by electrons and positrons with kinetic energies up to 1 GeV. We describe a systematic method for evaluating cross sections for emission of x rays and Auger electrons based on atomic transition probabilities from the Evaluated Atomic Data Library of Perkins et al. [Lawrence Livermore National Laboratory, UCRL-ID-50400, 1991]. We made an extensive comparison of measured K-shell, L-subshell, and M-subshell ionization cross sections and of Lα x-ray production cross sections with the corresponding calculated cross sections. We identified elements for which there were at least three (for K shells) or two (for L and M subshells) mutually consistent sets of cross-section measurements and for which the cross sections varied with energy as expected by theory. The overall average root-mean-square deviation between the measured and calculated cross sections was 10.9% and the overall average deviation was −2.5%. This degree of agreement between measured and calculated ionization and x-ray production cross sections was considered to be very satisfactory given the difficulties of these measurements.
Physical--chemical studies of transuranium elements. Progress report, April 1, 1977--March 31, 1978
International Nuclear Information System (INIS)
Peterson, J.R.
1978-01-01
Major advances in our continuing program to determine, interpret, and correlate the basic chemical and physical properties of the transuranium elements are summarized for the period April 1, 1977, through March 31, 1978. CfCl 2 , EsCl 2 , EsBr 2 , and EsI 2 were synthesized and characterized spectrophotometrically, as were several mixed-valence lanthanide-actinide halides (e.g., GdCf 4 Cl 11 ) and CmF 4 , CfF 4 , and EsF 3 . All samples not containing einsteinium were also examined by X rays. Studies of the chemical consequences of the radioactive decay series 253 Es alpha decaying to 249 Bk beta decaying to 249 Cf have continued and expanded. Elemental Cm-248 has been prepared on the one-half milligram scale and used to synthesize CmP and CmSb. Single crystals of AmTe 2 and AmSe 2 have been grown from a Te melt and by iodine transport, respectively. Our SQUID magnetometer was tested successfully in a preliminary configuration, and the expected sensitivity of the device was confirmed. A new design for the flux sensing coils was incorporated prior to an apparatus calibration experiment with lead. A porous vitreous carbon material was found to make a useful optically transparent electrode for simultaneous electrochemical and absorption spectroscopic investigations. Cyclic voltammograms of UO 2 2+ were obtained prior to a spectroelectrochemical study of the radiation of UO 2 2+ . The major obstacle in our solution microcalorimetry program was overcome by the realization of a leak-free sample container. Calorimeter performance now warrants experiments with transuranium element samples. The electrochemical reductions of Cf(III) and Es(III) have been studied by polarography and/or cyclic voltammetry. The results suggest that both are reduced to the divalent state before being reduced to the amalgam
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1981-08-01
During this period, transuranium elements were obtained from 26 irradiated HFIT targets. The products included 86 mg of 249 Bk, 686 mg of 252 Cf, 3.1 mg of 253 Es, and an estimated 1.4 pg of 257 Fm. In addition, about 326 mg of high-purity 248 Cm was separated from previously purified 252 Cf. One hundred seven product shipments were made from TRU; recipients and the amounts of nuclides shipped are listed in a table. Forty-two standard and two special HFIR targets were fabricated. During the next 18 months, production totals of 110 mg of 249 Bk, 1200 mg of 252 Cf, 5.5 mg of 253 Es, and 2 pg of 257 Fm are anticipated. Also, a total of 225 mg of 248 Cm is expected to be made available. During this report period, a charcoal adsorber system for radioiodine removal was installed, tested, and placed in service. This system serves as a backup to the Hopcalite-charcoal system for adsorption of 131 I from the VOG stream. Seven 252 Cf neutron sources were fabricated during this report period. A total of 100 neutron sources have been fabricated previously at TRU. The original and current contents ( 252 Cf and 248 Cm) of the existing sources and the individuals to whom the sources are currently loaned are listed in a table. In addition to neutron sources, nine fission sources were prepared by electroplating 252 Cf onto platinum disks or foils.Special projects during this report period included (1) purification of two batches of isotopically pure 240 Pu, (2) fabrication of two special HFIR targets, (3) repurification of the residues of the einsteinium product from Campaign 56, (4) production of approx. 235 μg of 250 Cf by irradiation of 249 Bk, (5) radiography of 28 irradiated, stainless steel alloy, fracture-strain specimens, and (6) preparations for the production of 40 μg of 245 Es by irradiation of 253 Es
Human Diversity in a Cell Surface Receptor that Inhibits Autophagy.
Chaudhary, Anu; Leite, Mara; Kulasekara, Bridget R; Altura, Melissa A; Ogahara, Cassandra; Weiss, Eli; Fu, Wenqing; Blanc, Marie-Pierre; O'Keeffe, Michael; Terhorst, Cox; Akey, Joshua M; Miller, Samuel I
2016-07-25
Mutations in genes encoding autophagy proteins have been associated with human autoimmune diseases, suggesting that diversity in autophagy responses could be associated with disease susceptibility or severity. A cellular genome-wide association study (GWAS) screen was performed to explore normal human diversity in responses to rapamycin, a microbial product that induces autophagy. Cells from several human populations demonstrated variability in expression of a cell surface receptor, CD244 (SlamF4, 2B4), that correlated with changes in rapamycin-induced autophagy. High expression of CD244 and receptor activation with its endogenous ligand CD48 inhibited starvation- and rapamycin-induced autophagy by promoting association of CD244 with the autophagy complex proteins Vps34 and Beclin-1. The association of CD244 with this complex reduced Vps34 lipid kinase activity. Lack of CD244 is associated with auto-antibody production in mice, and lower expression of human CD244 has previously been implicated in severity of human rheumatoid arthritis and systemic lupus erythematosus, indicating that increased autophagy as a result of low levels of CD244 may alter disease outcomes. Copyright © 2016 Elsevier Ltd. All rights reserved.
Structural studies of f-element complexes with soft donor extractants
International Nuclear Information System (INIS)
Jensen, Mark P.; Bond, Andrew H.; Nash, Kenneth L.
2000-01-01
To better understand the unique features and structural implications of An-soft donor interactions, we used solvent extraction, extended x-ray absorption fine structure (Exafs), and optical spectroscopy to study both the lanthanide and actinide complexes of a series of dialkylphosphinic acid extractants, bis(2,4,4-trimethylpentyl)phosphinic acid, bis(2,4,4-trimethylpentyl)monothiophosphinic acid, and bis(2,4,4- trimethylpentyl)dithiophosphinic acid, which are the primary components of the commercial extractants Cyanex 272, Cyanex 302, and Cyanex 301
Sudan Journal of Medical Sciences - Vol 9, No 4 (2014)
African Journals Online (AJOL)
Hysteroscopy in Libyan women with Recurrent Pregnancy Loss · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AM Elbareg, FM Essadi, MO Elmehashi, KI Anwar, I Adam, 239-244 ...
Clinical Investigation Program Annual Progress Report
1989-09-30
of Stuttering and Maintenance of Fluency by Means of Airflow, Tension Reduction, and Discriminative Stimulus Control Procedures. J Fluency Disorders...244 body fat .............................. 331 bone cement ...................... 36 density ............................. 121,152
Německý Mácha, Óda na radost a krize evropské vize
Czech Academy of Sciences Publication Activity Database
Pokorný, Martin Z.
2013-01-01
Roč. 31, 97-98 (2013), s. 244-251 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion
Czech Academy of Sciences Publication Activity Database
Krejčová, Iva
2014-01-01
Roč. 22, 1/2 (2014), s. 225-244 ISSN 1803-456X Institutional support: RVO:68378068 Keywords : national identity * Jungmann, Josef * Czech literature Subject RIV: AJ - Letters, Mass-media, Audiovision
Stanislav Markus. Property, Predation, and Protection: Piranha Capitalism in Russia and Ukraine
Directory of Open Access Journals (Sweden)
Paul Babie
2016-09-01
Full Text Available Stanislav Markus. Property, Predation, and Protection: Piranha Capitalism in Russia and Ukraine. Cambridge: Cambridge UP, 2015. xii, 244 pp. Illustrations. Tables. Bibliography. Index. $95.00, cloth.
African Journals Online (AJOL)
Items 51 - 100 of 244 ... ... Cost effectiveness of fine needle aspiration cytology for breast masses, Abstract ... for breast cancer in patients with palpable breast lump in a middle ... children with sickle cell anaemia in Enugu, Nigeria, Abstract PDF.
75 FR 10793 - FY2010 Supplemental Funding for Brownfields Revolving Loan Fund (RLF) Grantees
2010-03-09
... (213) 244- 1850. EPA Region 10, Susan Morales, AK, ID, OR, WA 1200 Sixth Avenue, Suite Morales.Susan...: March 2, 2010. David R. Lloyd, Director, Office of Brownfields and Land Revitalization, Office of Solid...
Czech Academy of Sciences Publication Activity Database
Adkins, Irena; Köberle, M.; Gröbner, S.; Bohn, E.; Autenrieth, I. B.; Borgmann, S.
2007-01-01
Roč. 297, - (2007), s. 235-244 ISSN 1438-4221 Institutional research plan: CEZ:AV0Z50200510 Keywords : yersinia * yops * dendritic cell s Subject RIV: EC - Immunology Impact factor: 2.524, year: 2007
Indian Academy of Sciences (India)
Jadavpur), FNASc, FRCP (London). Date of birth: 2 November 1960. Specialization: Pharmacology, Immunology, Parasitology Address: Department of Pharmacology, Institute of PG Medical Education & Research, 244-B, Acharya JC Bose Road, ...
Czech Academy of Sciences Publication Activity Database
Hnídková, Vendula
2017-01-01
Roč. 96, č. 4 (2017), s. 242-244 ISSN 0042-4544 Institutional support: RVO:68378033 Keywords : modern architecture * Josep Lluis Sert * Fondation Maeght Subject RIV: AL - Art, Architecture , Cultural Heritage
Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)
Czech Academy of Sciences Publication Activity Database
Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk
2013-01-01
Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013
Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk
Olesk, Arko, 1981-
2004-01-01
Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest
Czech Academy of Sciences Publication Activity Database
Číp, Ondřej
2017-01-01
Roč. 62, č. 10 (2017), s. 243-244 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : CAS ISI * optics Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)
African Journals Online (AJOL)
USER
2016-04-08
Apr 8, 2016 ... Ethiopian Journal of Environmental Studies & Management 9 (2): 235 – 244, 2016. ISSN:1998- ... the hotel industry to be socially responsible concept ... on ethical values and respect for .... major common practical areas of.
K pojmu psychospirituální krize
Czech Academy of Sciences Publication Activity Database
Říčan, Pavel
2012-01-01
Roč. 56, č. 2 (2012), s. 194-196 ISSN 0009-062X Institutional support: RVO:68081740 Keywords : psychospiritual crisis * spirituality * transpersonal psychology Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Body measurement characteristics of the West African Dwarf (WAD ...
African Journals Online (AJOL)
STORAGESEVER
2008-07-18
Jul 18, 2008 ... 1Faculty of Agricultural Sciences, Department of Animal Production and Health ... Two hundred and forty four (244) West African Dwarf (WAD) Goats ..... SAS Institute Inc. SAS Campus Drive. Carry. North. Carolina, U.S.A..
Morphological and molecular characterisation of Geosmithia species on European elms
Czech Academy of Sciences Publication Activity Database
Pepori, A.L.; Kolařík, Miroslav; Bettini, P.P.; Vettraino, A.M.; Santini, A.
2015-01-01
Roč. 119, č. 11 (2015), s. 1063-1074 ISSN 1878-6146 Institutional support: RVO:61388971 Keywords : Geosmithia spp. * Geosmithia omnicola * Geosmithia ulmacea Subject RIV: EE - Microbiology, Virology Impact factor: 2.244, year: 2015
Synthesis, Structure, and Fluorescence of a Novel Cadmium Compound
Yao, Zhong-Liang; Chen, Wen-Tong
2017-12-01
A novel cadmium compound, [(CdI3)2(μ2-I)]2(Me2-4,4'-H2bipy)3 (1) (Me = methyl; 4,4'-bipy = 4,4'-bipyridine) with the Me2-4,4'-H2bipy moiety generated in situ, has been prepared through a solvothermal reaction and structurally characterized by X-ray single crystal diffraction analysis. Compound 1 is characterized by an isolated structural motif, consisting of [(CdI3)2(μ2-I)]3- anions and Me2-4,4'-H2bipy2+ cations. The [(CdI3)2(μ2-I)]3- anions and Me2-4,4'-H2bipy2+ cations interconnect together via C-H···I hydrogen-bonding interactions to complete a three-dimensional (3D) supramolecular network. Solid state fluorescent spectrum reveals an emission band in the violet region.
African Journals Online (AJOL)
MASTERPLUS
Products (Tax Stamps) Regulations (GN No. 244). Dar es ... Professor of Drama, Theatre & Development Communication ... changing World: The implications for Africa in the 21st ..... Promote arts and culture as veritable economic business.
Protein (Cyanobacteria): 517207156 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 27:244 ... 7-cyano-7-deazaguanine reductase filamentous cyanobacterium ESFC-1 MNSMSSETEVAQTPEVKYGERAIADCELITF... WP_018395974.1 NZ_KB904821 1117:4682 ... 1150:39727 1301283:59529 44887:1731 ... 11284
Species diversity in the Antrodia crassa group (Polyporales, Basidiomycota)
Czech Academy of Sciences Publication Activity Database
Spirin, V.; Runnel, K.; Vlasák, Josef; Miettinen, O.; Pöldmaa, K.
2015-01-01
Roč. 119, č. 12 (2015), s. 1291-1310 ISSN 1878-6146 Institutional support: RVO:60077344 Keywords : Host specificity * Wood-inhabiting fungi * Taxonomy Subject RIV: EF - Botanics Impact factor: 2.244, year: 2015
Narva Elektrijaamade renoveerimine - projekti ettevalmistus, teostus ja tulemused / Mati Uus
Uus, Mati
2005-01-01
2001. a. sõlmis AS Narva Elektrijaamad tarnelepingu Soome firmaga Foster Wheeler Energia OY kahe energiaploki kompleksseks renoveerimiseks. Lepingu maksumus oli 244 miljonit eurot ning ühe ploki ehitusaeg 30 kuud
2010-01-12
... DEPARTMENT OF TRANSPORTATION Research and Innovative Technology Administration University..., Office of Research, Development and Technology, RDT-30, Research and Innovative Technology Administration... amended by Pub. L. 110-244) requires the Research and Innovative Technology Administration (RITA) of the U...
Fractional M-band dual tree complex wavelet transform for digital ...
Indian Academy of Sciences (India)
image fusion for copy protection or water marking robust tagging applications. They considered ..... to enhance the performance and security of the images. Most of the SVD .... J. Network Computer Applications 24(4): 167–173. Dong Zheng ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino
Radioactivity studies. Progress report. Volume II
International Nuclear Information System (INIS)
Cohen, N.
1981-09-01
The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures
Very Small Satellite Design for Space Sensor Networks
2008-06-01
Literature Review 25 Clyde Space Power Pumpkin Computer Microhard Comm SSTL GPS User Payload Pumpkin Structure Figure 2-10. CUTE-I CubeSat [69...Structure Pumpkin [244] Skeletonized 155 $1,350* $810* EPS Clyde Space [245] CubeSat EPS 310 $25,240* $19,252* DH Pumpkin [244] FM430 90 $1,200* $720...satellite miniaturisation since 1993 and probably before. Furthermore, the term itself has been diluted from the pure literal form, eventually
Dietary Supplements and Young Teens: Misinformation and Access Provided by Retailers.
Herriman, Maguire; Fletcher, Laura; Tchaconas, Alexis; Adesman, Andrew; Milanaik, Ruth
2017-02-01
Despite the American Academy of Pediatrics' recommendations against pediatric use of creatine and testosterone boosters, research suggests that many young teenagers take these dietary supplements. Our objective was to determine to what extent health food stores would recommend and/or sell creatine and testosterone boosters to a 15-year-old boy customer. Research personnel posing as 15-year-old high school athletes seeking to increase muscle strength contacted 244 health food stores in the United States via telephone. Researchers asked the sales attendant what supplements he/she would recommend. If a sales attendant did not mention creatine or testosterone boosters initially, each of these supplements was then specifically asked about. Supplement recommendations were recorded. Sales attendants were also asked if a 15-year-old could purchase these products on his own in the store. A total of 67.2% (164/244) of sales attendants recommended creatine: 38.5% (94/244) recommended creatine without prompting, and an additional 28.7% (70/244) recommended creatine after being asked specifically about it. A total of 9.8% (24/244) of sales attendants recommended a testosterone booster. Regarding availability for sale, 74.2% (181/244) of sales attendants stated a 15-year-old was allowed to purchase creatine, whereas 41.4% (101/244) stated one could purchase a testosterone booster. Health food store employees frequently recommend creatine and testosterone boosters for boy high school athletes. In response to these findings, pediatricians should inform their teenage patients, especially athletes, about safe, healthy methods to improve athletic performance and discourage them from using creatine or testosterone boosters. Retailers and state legislatures should also consider banning the sale of these products to minors. Copyright © 2017 by the American Academy of Pediatrics.
Lortz, S; Lenzen, S; Mehmeti, I
2015-03-01
Disulfide bond formation during protein folding of nascent proteins is associated with the generation of H2O2 in the endoplasmic reticulum (ER). Approaches to quantifying H2O2 directly within the ER failed because of the oxidative environment in the ER lumen, and ER-specific catalase expression to detoxify high H2O2 concentrations resulted in an inactive protein owing to N-glycosylation. Therefore, the N-glycosylation motifs at asparagine-244 and -439 of the human catalase protein were deleted by site-directed mutagenesis. The ER-targeted expression of these variants revealed that the deletion of the N-glycosylation motif only at asparagine-244 (N244) was associated with the maintenance of full enzymatic activity in the ER. Expression of catalase N244 in the ER (ER-Catalase N244) was ER-specific and protected the cells significantly against exogenously added H2O2. With the expression of ER-Catalase N244, a highly effective H2O2 inactivation within the ER was achieved for the first time. Catalase has a high H2O2-inactivation capacity without the need of reducing cofactors, which might interfere with the ER redox homeostasis, and is not involved in protein folding. With these characteristics ER-Catalase N244 is an ideal tool to explore the impact of ER-generated H2O2 on the generation of disulfide bonds or to study the induction of ER-stress pathways through protein folding overload and accumulation of H2O2. Copyright © 2014 Elsevier Inc. All rights reserved.
Jin, Huo-Xi; OuYang, Xiao-Kun; Hu, Zhong-Ce
2017-05-01
An effective epoxide hydrolase (EH) production strain was mutagenized using 60 Co gamma and UV irradiation. Among positive mutant strains, the EH activity of C2-44 reached 33.7 U/g, which was 267% as much as that of the original Aspergillus niger ZJB-09103. Compared with the wild type, there were significant changes in morphology for C2-44, including the color of mycelia on the slants and the shape of conidial head. In addition, glucose and soybean cake were the optimal carbon and nitrogen source in terms of EH activity for the mutant C2-44 instead of soluble starch and peptone for the wild-type strain. The reaction time required to reach 99% enantiomeric excesses of (S)-epichlorohydrin from racemic substrate was shortened significantly by the mutant C2-44. This phenomenon was probably explained by the higher V max for hydrolysis of racemic epichlorohydrin by C2-44 compared with Aspergillus niger ZJB-09103. © 2016 International Union of Biochemistry and Molecular Biology, Inc.
International Nuclear Information System (INIS)
Paul, M.; Valenta, A.; Ahman, I.
2005-01-01
Short-lived radionuclides with halflives of a few 10 7 years, now-extinct in the solar system, are expected to be present in the interstellar medium (ISM) as freshly synthesized matter in supermovae. Grains of ISM origin recently discovered in the inner solar system and at Earth orbit may accrete onto Earth after ablation in the atmosphere. As pointed out by one of the authors (K.S.) in 1974, a favorable matrix of detection of such extraterrestrial material is deep-sea sediments with very low sedimentation rates of ∼1 mm.ky -1 . We report here a search for the 'live' Pu-244 in a 1 kg-deep-sea dry sediment collected in 1992 in the North Pacific. After a 546 day a-counting of a Pu fraction chemically separated from the alkaline-fused sediment sample at Kanazawa Univ. AMS analysis was performed at Hebrew Univ. and Weizmann Institute. Only one count of Pu-244 with no background ions was detected, indicating no excess over the expected stratospheric man-made fallout. A limit of 0.2 Pu-244 atoms cm -2 .y -1 for extra terrestrial deposition was set under reasonable assumptions and it was then concluded from this result and the available data on ISM that the abundance of Pu-244 in the ISM is less than 2 X 10 -11 g-Pu-244 (g ISM) -1 . Implications of the present result will be discussed.
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-420. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance. This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
Liu, Mei; Luo, Tao; Yang, Chongguang; Liu, Qingyun; Gao, Qian
2015-10-01
To identify a variable number of tandem repeats (VNTR) typing method that is suitable for molecular epidemiological study of tuberculosis in China. We systematically evaluated the commonly used VNTR typing methods, including 4 methods (MIRU-12, VNTR-15/VNTR-24 and VNTR "24+4") proposed by foreign colleagues and 2 methods (VNTR-L15 and VNTR"9+3") developed by domestic researchers using population-based collection of 891 clinical isolates from 5 provinces across the country. The order (from high to low) of discriminatory power for the 6 VNTR typing methods was VNTR"24+4", VNTR"9+3", VNTR-24, VNTR-15, VNTR-L15 and MIRU-12. The discriminatory power of VNTR"9+3" was comparable with VNTR"24+4" and higher than that of VNTR-15/24. The concordance for defining clustered and unique genotypes between VNTR"9+3" and VNTR"24+4" was 96.59%. Our results suggest that VNTR"9+3" is a suitable method for molecular typing of M. tuberculosis in China by considering its high discriminatory power, high consistency with VNTR"24+4" and relative small number of VNTR locus.
Morgan, P. E. D.; Ratto, J. J.; Housley, R. M.; Porter, J. R.
1988-01-01
EDXS performed on isolated particles of the Bi-Ca-Sr-Cu-O high-temperature ceramic superconductor has verified the presence of significant elemental exchange between the Ca and Sr, and, to a lesser extent, between Cu and Bi. Two primary preparations, identified as primarily 24.4 A and 30.6 A, respectively, are identified. The Cu:Bi ratio in the 30.6 A material is approximately 1:1 for most particles, although only a few particles of the nominally 24.4 A material have the expected 1:2 ratio. No unequivocal assignment of atomic composition to the predominantly 24.4 A or 30.6 A appears possible, if major syntactic problems are present.
Report to the DOE Nuclear Data Committee, 1983
International Nuclear Information System (INIS)
Haight, R.C.; Struble, G.L.
1983-02-01
Measurements for nuclear data applicactions are described including branching ratio in 7 Be decay, kerma factor for carbon, photoneutron cross sections, neutron differential scattering cross sections, half-life of 77 Kr, stellar neutron capture rates for 86 87 88 Sr, neutron total cross sections, 142 143 144 Nd neutron capture nucleo-synthesis, half-life of 163 Ho, thermal neutron fission of 236 Np, revised branching ratios in 237 U and 238 Pu decays, and levels of 244 Cm populated by the beta decay of 10-hour 244 Am and 26-minute /sup 244m/Am. Calculations discussed include systematic test of microscopic optical models for nucleon scattering in the range 7 to 60 MeV, Lanczos method shell-model calculations of GamowTeller strength functions, explosive nucleosynthesis and direct radiative capture rates, and calculation of fission cross sections. Evaluated data libraries are briefly discussed
Golden Eagle mortality at a utility-scale wind energy facility near Palm Springs, California
Lovich, Jeffrey E.
2015-01-01
Golden Eagle (Aquila chrysaetos) mortality associated with wind energy turbines and infrastructure is under-reported and weakly substantiated in the published literature. I report two cases of mortality at a utility-scale renewable energy facility near Palm Springs, California. The facility has been in operation since 1984 and included 460 65KW turbines mounted on 24.4 m or 42.7 m lattice-style towers with 8 m rotor diameters. One mortality event involved a juvenile eagle that was struck and killed by a spinning turbine blade on 31 August, 1995. The tower was 24.4 m high. The other involved an immature female that was struck by a spinning blade on another 24.4 m tower on 17 April, 1997 and was later euthanized due to the extent of internal injuries. Other raptor mortalities incidentally observed at the site, and likely attributable to turbines, included three Red-tailed Hawks (Buteo jamaicensis) found near turbines.
Syntactic intergrowth problems with BCSCO and fabrication difficulties therefrom
International Nuclear Information System (INIS)
Morgan, P.E.D.; Ratto, J.J.; Housley, R.M.; Porter, J.R.
1988-01-01
EDXS performed on isolated particles of the Bi-Ca-Sr-Cu-O high-temperature ceramic superconductor has verified the presence of significant elemental exchange between the Ca and Sr, and, to a lesser extent, between Cu and Bi. Two primary preparations, identified as primarily 24.4 A and 30.6 A, respectively, are identified. The Cu:Bi ratio in the 30.6 A material is approximately 1:1 for most particles, although only a few particles of the nominally 24.4 A material have the expected 1:2 ratio. No unequivocal assignment of atomic composition to the predominantly 24.4 A or 30.6 A appears possible, if major syntactic problems are present. 22 references
Properties of the transitions populating and depopulating the 279 keV level in /sup 75/As
Energy Technology Data Exchange (ETDEWEB)
Puri, V S; Khurana, C S; Sahota, H S [Punjabi Univ., Patiala (India). Nuclear Science Labs.
1977-09-01
The low-energy gamma-ray spectrum of /sup 75/As from /sup 75/Sc has been investigated using a 6 mm x 6 mm Si(Li) spectrometer. The intensity of the 24.4 keV transition has been found to be 0.07 +- 0.01. No evidence has been found for the presence of a 14.9 keV transition. From directional correlation measurements involving the 24.4 keV transition detected in the Si(Li) detector, the multipolarity of this transition has been found to be delta(E3/M2)sub(24.4) =0.18 +- 0.02. The internal conversion process of the 279 keV transition seems to be normal. No effect of the chemical environment has been observed on the (121 ..gamma..-279..gamma..) directional correlation coefficients.
The biokinetics and radiotoxicology of curium: A comparison with americium
Energy Technology Data Exchange (ETDEWEB)
Menetrier, F. [CEA, Fontenay-aux-Roses (France); Taylor, D.M. [School of Chemistry, Cardiff University, Cardiff CF10 3AT (United Kingdom)], E-mail: davtay@btinternet.com; Comte, A. [CEA, Fontenay-aux-Roses (France)
2008-05-15
The human and animal data on the biokinetics of {sup 242}Cm and {sup 244}Cm are reviewed and shown to be very similar to those for {sup 241}Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with {sup 241}Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited {sup 244}Cm. The use of chelating agents for the treatment of accidental contamination of the human body with {sup 242,244}Cm is also discussed.
Erwinia teleogrylli sp. nov., a Bacterial Isolate Associated with a Chinese Cricket.
Directory of Open Access Journals (Sweden)
Bo Liu
Full Text Available A bacterial isolate (SCU-B244T was obtained in China from crickets (Teleogryllus occipitalis living in cropland deserted for approximately 10 years. The isolated bacteria were Gram-negative, facultatively anaerobic, oxidase-negative rods. A preliminary analysis of the 16S rRNA gene sequence indicated that the strain belongs to either the genus Erwinia or Pantoea. Analysis of multilocus sequence typing based on concatenated partial atpD, gyrB and infB gene sequences and physiological and biochemical characteristics indicated that the strain belonged to the genus Erwinia, as member of a new species as it was distinct from other known Erwinia species. Further analysis of the 16S rRNA gene showed SCU-B244T to have 94.71% identity to the closest species of that genus, Erwinia oleae (DSM 23398T, which is below the threshold of 97% used to discriminate bacterial species. DNA-DNA hybridization results (5.78±2.52% between SCU-B244T and Erwinia oleae (DSM 23398T confirmed that SCU-B244T and Erwinia oleae (DSM 23398T represent different species combined with average nucleotide identity values which range from 72.42% to 74.41. The DNA G+C content of SCU-B244T was 55.32 mol%, which also differs from that of Erwinia oleae (54.7 to 54.9 mol%. The polyphasic taxonomic approach used here confirmed that the strain belongs to the Erwinia group and represents a novel species. The name Erwinia teleogrylli sp. nov. is proposed for this novel taxon, for which the type strain is SCU-B244T (= CGMCC 1.12772T = DSM 28222T = KCTC 42022T.
Directory of Open Access Journals (Sweden)
Nigel J Dimmock
Full Text Available Influenza A viruses are a major cause of morbidity and mortality in the human population, causing epidemics in the winter, and occasional worldwide pandemics. In addition there are periodic outbreaks in domestic poultry, horses, pigs, dogs, and cats. Infections of domestic birds can be fatal for the birds and their human contacts. Control in man operates through vaccines and antivirals, but both have their limitations. In the search for an alternative treatment we have focussed on defective interfering (DI influenza A virus. Such a DI virus is superficially indistinguishable from a normal virus but has a large deletion in one of the eight RNAs that make up the viral genome. Antiviral activity resides in the deleted RNA. We have cloned one such highly active DI RNA derived from segment 1 (244 DI virus and shown earlier that intranasal administration protects mice from lethal disease caused by a number of different influenza A viruses. A more cogent model of human influenza is the ferret. Here we found that intranasal treatment with a single dose of 2 or 0.2 µg 244 RNA delivered as A/PR/8/34 virus particles protected ferrets from disease caused by pandemic virus A/California/04/09 (A/Cal; H1N1. Specifically, 244 DI virus significantly reduced fever, weight loss, respiratory symptoms, and infectious load. 244 DI RNA, the active principle, was amplified in nasal washes following infection with A/Cal, consistent with its amelioration of clinical disease. Animals that were treated with 244 DI RNA cleared infectious and DI viruses without delay. Despite the attenuation of infection and disease by DI virus, ferrets formed high levels of A/Cal-specific serum haemagglutination-inhibiting antibodies and were solidly immune to rechallenge with A/Cal. Together with earlier data from mouse studies, we conclude that 244 DI virus is a highly effective antiviral with activity potentially against all influenza A subtypes.
Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force
Energy Technology Data Exchange (ETDEWEB)
Girod, M.; Delaroche, J.P.; Romain, P. [CEA/DIF, DPTA/SPN, Boite Postale 12, 91680 Bruyeres-le-Chatel (France); Libert, J. [Institut de Physique Nucleaire Centre National de la Recherche Scientifique-IN2P3, F-91406 Orsay (France)
2002-10-01
The structure properties of the even-even nuclei {sup 226,} {sup 228,} {sup 230,} {sup 232,} {sup 234}Th, {sup 230,} {sup 232,} {sup 234,} {sup 236,} {sup 238,} {sup 240}U, {sup 240,} {sup 242,} {sup 244,} {sup 246}Pu, and {sup 242,} {sup 244,} {sup 246,} {sup 248}Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)
Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force
International Nuclear Information System (INIS)
Girod, M.; Delaroche, J.P.; Romain, P.; Libert, J.
2002-01-01
The structure properties of the even-even nuclei 226, 228, 230, 232, 234 Th, 230, 232, 234, 236, 238, 240 U, 240, 242, 244, 246 Pu, and 242, 244, 246, 248 Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)
Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser
DEFF Research Database (Denmark)
Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm
2003-01-01
Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....
Lesure, Frank G.
1981-01-01
Traces of gold and molybdenum are widely disseminated in an area approximately 35 km long and 10 km wide in northwestern Moore County, N.C. At least 2540 oz. of gold were recovered from 16 or more mines and prospects between 1880 and 1910. One hundred and ninety rock samples out of 244 collected from old gold mines, pyrophyllite deposits and along roads contain gold quantities ranging from 0.02 to 2.4 parts per million. In addition, 43 samples out of the 244 taken contain molybdenum in amounts ranging from 4 to 500 parts per million.
Comparison of fission and capture cross sections of minor actinides
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Iwamoto, Osamu
2003-01-01
The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)
Allen, Tim
Citations in this bibliography are intended to be a substantial resource for recent investigations (January 1990-January 1995) on animal welfare policy and were obtained from a search of the National Agriculture Library's AGRICOLA database. A representation of the search strategy is included. The 244 citations range in topic and include animal…
Resonance journal of science education
Indian Academy of Sciences (India)
IAS Admin
232. Mahlburg's Work on Crank Functions. Ramanujan's Partitions Revisited. Nagesh Juluru and Arni S R Srinivasa Rao. REFLECTIONS. 268. The Scientific Enterprise. Science in the Modern Indian Context. V V Raman. R. R. R4. 2. 1. C r. L. R3+ rL. H. A. C. D. B. E. 244. 223. Transverse section of the ring porous wood ...
DEFF Research Database (Denmark)
Kløverpris, Henrik N; McGregor, Reuben; McLaren, James E
2014-01-01
of differentiation on HIV-1-specific CD8+ T-cell populations(n = 128) spanning 11 different epitope targets. RESULTS: Expression levels of PD-1, but not CD244 or LAG-3, varied substantially across epitope specificities both within and between individuals. Differential expression of PD-1 on T-cell receptor (TCR...
TropJrnal Vol 28 No1&2 4Intnet publicatn
African Journals Online (AJOL)
Administrator
Misoprostol is used for cervical ripening and control of post partum haemorrhage among 24.4% and 50% of the .... What do you use for IOL in your institution? Misoprostol. 8. 19.0. Oxytocin. 4. 9.5. Both. 30. 71.5. Misoprostol used with previous caesarean section. Yes. 8 .... for the control of postpartum haemorrhage, while.
Attentional Bias for Emotional Stimuli in Borderline Personality Disorder : A Meta-Analysis
Kaiser, D.; Jacob, G.A.; Domes, G.; Arntz, A.
2016-01-01
Background: In borderline personality disorder (BPD), attentional bias (AB) to emotional stimuli may be a core component in disorder pathogenesis and maintenance. Sampling: 11 emotional Stroop task (EST) studies with 244 BPD patients, 255 nonpatients (NPs) and 95 clinical controls and 4 visual
The occurrence of PPV in cherry trees in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Navrátil, M.; Šafářová, D.; Fanigliulo, A.; Comes, S.; Petrzik, Karel; Karešová, R.
2004-01-01
Roč. 657, - (2004), 237-244 ISSN 0567-7572 R&D Projects: GA MZe(CZ) NAZV QD1407 Institutional research plan: CEZ:AV0Z5051902 Keywords : Plum pox virus * Prunus avium * sweet cherry cultivars * ELISA * RT-PCR Subject RIV: EE - Microbiology, Virology
African Journals Online (AJOL)
USER
One hundred poultry were collected using simple random sampling from 114 commercial, backyard and free range flocks affected by HPAI in different parts of. Nigeria. A total of 244,992 poultry were in. INTRODUCTION. Highly pathogenic avian influenza (HPAI) is a viral disease affecting almost all domestic and wild birds.
Pilot scale, alpha disassembly and decontamination facility at the Savannah River Laboratory
International Nuclear Information System (INIS)
Cadieux, J.R.; Becker, G.W. Jr.; Richardson, G.W.; Coogler, A.L.
1982-01-01
An alpha-contained pilot facility is being built at the Savannah River Laboratory (SRL) for research into the disassembly and dcontamination of noncombustible, Transuranic (TRU) waste. The design and program objectives for the facility are presented along with the initial test results from laboratory scale decontamination experiments with Pu-238 and Cm-244
2013-05-16
... clause at FAR 52.244-2, Subcontracts. (1) Unallowability of costs of rework and corrective action. A new... cost of rework or corrective action that may be required to remedy the use or inclusion of such parts... such products and for any rework or corrective action that may be required to remedy the use or...
Diverzita či odlišné chování? Sociální distance od Romů, gayů, lidí s AIDS a dalších menšin
Czech Academy of Sciences Publication Activity Database
Klicperová-Baker, Martina; Košťál, J.
2012-01-01
Roč. 56, č. 4 (2012), s. 297-314 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : diversity * minorities * social distance Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
The Effect of Designated Pollutants on Plants
1979-12-01
aberration and mitotic inhibition induced by sodium fluoride and diethyl amine in root-tip cells of Allium cepa, A. sativum and Vicia faba, Egypt J...induced by sodium fluoride in Allium cepa root tip chromosomes, Can. J. Genet. Cytol. 8:241-244. Mohamed, A. H., J. D. Smith, and H. G. Applegate
Does Sex Influence the Diagnostic Evaluation of Autism Spectrum Disorder in Adults?
Wilson, C. Ellie; Murphy, Clodagh M.; McAlonan, Grainne; Robertson, Dene M.; Spain, Debbie; Hayward, Hannah; Woodhouse, Emma; Deeley, P. Quinton; Gillan, Nicola; Ohlsen, J. Chris; Zinkstok, Janneke; Stoencheva, Vladimira; Faulkner, Jessica; Yildiran, Hatice; Bell, Vaughan; Hammond, Neil; Craig, Michael C.; Murphy, Declan G. M.
2016-01-01
It is unknown whether sex influences the diagnostic evaluation of autism spectrum disorder, or whether male and female adults within the spectrum have different symptom profiles. This study reports sex differences in clinical outcomes for 1,244 adults (935 males and 309 females) referred for autism spectrum disorder assessment. Significantly, more…
The African Students Association of America and Canada, 1941 ...
African Journals Online (AJOL)
(p.244) Though the work of the West African Students Union (WASU) in London has been chronicled, there is still no full write-up of the African Students Association of America and Canada (ASA) formed in 1942 by these students. In fact, Coleman minimizes the numbers of Africans then studying in the USA during the ...
Morphogical effects of sodium azide on tomato ( Lycopersicon ...
African Journals Online (AJOL)
Dry seeds of tomato (Lycopersicon esculentun Mill), varieties T106, T244 and T420 obtained from the Institute of Agriculture Research, Ahmadu Bello University Zaria, Nigeria were treated with sodium azide at concentrations of 1.0, 2.0 and 4.0 mM aimed at determining the effects of the mutagen on the morphological ...
Indian Academy of Sciences (India)
Hydantoins (2) 124 (GA). Hymenoptera (5) 459 (RN). Imhotep (6) 498 (SA). Immortalization (6) 539 (GA). Indo–Arabic numerals (12) 1062 (SA). Inductance measurement (3) 244 (CR). Inertial navigation system (INS) (4) 302 (SA). Information flow (7) 605 (GA). Instantons (2) 104 (GA). Instrument landing system (ILS) (4) 302 ...
Influence of gender preference and sex composition of surviving ...
African Journals Online (AJOL)
Women who have GP and same LCSC were 1.35 and 2.4 times significantly more likely to have intention to bear more children than those who have no GP and different sexes composition respectively. These odd ratios changed to 1.38 for GP and 2.44 for LCSC after adjusting for other socio-demographic variables.
1990-12-01
HTST ) at Mach 7 from September 1970 through May 1971 (ref. 6). The AIM was a water-cooled, hydrogen-fueled, boilerplate model which was used to verify...fraction required to accelerate to velocity. Figure 3.- The lIRE on the X-15. Figure 4.- HRE SAM in Langley’s 2.44-n HTST . FUEL ANJECTION SMRTS (a
In this section of Resonance, we invite readers to pose questions ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 3. Optimization of the Anderson Bridge Experiment. P Arun Kuldeep Kumar Mamta. Classroom Volume 15 Issue 3 March 2010 pp 244-256. Fulltext. Click here to view fulltext PDF. Permanent link:
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Mamta. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 244-256 Classroom. Optimization of the Anderson Bridge Experiment · P Arun Kuldeep Kumar Mamta · More Details Fulltext PDF ...
Lifescience Database Archive (English)
Full Text Available D04103 Drug Etoformin hydrochloride (USAN) ... C8H19N5. HCl D04103.gif ... Antidiabetic... agent ... DG01685 ... Insulin sensitizer ... DG01684 ... Biguanide antidiabetic Unclassified ... DG02044 ... Hypoglycemics ... ... DG01684 ... Biguanide antidiabetic ... Biganides ... CAS: 53597-26-5 PubChem: 47206055 ChEMBL: CHEMBL2106592 LigandBox: D04103 NIKKAJI: J244.891B ...
2011-01-24
....'' FOR FURTHER INFORMATION CONTACT: Mr. Charles Pelizza; telephone: 772/ 562-3909, extension 244; e-mail... managed by the U.S. Avon Park Air Force Range, State of Florida, The Nature Conservancy, Archbold...; (2) lack of baseline information on resources; (3) lack of an effective approach to apply fire...
Yeo, Ronald A.; Ryman, Sephira G.; Thompson, Melissa E.; van den Heuvel, Martijn P.; de Reus, Marcel A.; Pommy, Jessica; Seaman, Brandi; Jung, Rex E.
2016-01-01
An important dimension of individual differences, independent of general cognitive ability (GCA), is specialization for verbal or spatial ability. In this study we investigated neuroanatomic, network, and personality features associated with verbal vs. spatial ability. Healthy young adults (N = 244)
Czech Academy of Sciences Publication Activity Database
Silva, S. R.; Gibson, R.; Adamec, Lubomír; Domínguez, Y.; Miranda, V.F.O.
2018-01-01
Roč. 118, Jan2018 (2018), s. 244-264 ISSN 1055-7903 Institutional support: RVO:67985939 Keywords : bladderworts * DNA sequencing * carnivorous plants Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.419, year: 2016
A Cross-Cultural Exploration of Parental Involvement and Child-Rearing Beliefs in Asian Cultures
Frewen, A. R.; Chew, E.; Carter, M.; Chunn, J.; Jotanovic, D.
2015-01-01
Parental involvement (PI) and child-rearing beliefs were examined amongst parents whose children attended state-run kindergartens across Singapore. A total of 244 parents completed an online survey consisting of a Child-Rearing Beliefs Scale, a PI Scale, and demographic details. Results indicated respondents were generally low-income earners with…
Projectile deformation effects in the breakup of 37Mg
Directory of Open Access Journals (Sweden)
Shubhchintak
2016-01-01
Full Text Available We study the breakup of 37Mg on Pb at 244MeV/u with the recently developed extended theory of Coulomb breakup within the postform finite range distorted wave Born approximation that includes deformation of the projectile. Comparing our calculated cross section with the available Coulomb breakup data we determine the possible ground state configuration of 37Mg.
Tribological and mechanical properties of nanocrystalline-TiC/a-C nanocomposite thin films
Czech Academy of Sciences Publication Activity Database
Musil, Jindřich; Novák, P.; Čerstvý, R.; Soukup, Z.
2010-01-01
Roč. 28, č. 2 (2010), s. 244-248 ISSN 0734-2101 R&D Projects: GA AV ČR(CZ) KAN400480701 Institutional research plan: CEZ:AV0Z10100522 Keywords : nc-TiC/a-C nanocomposite * friction * mechanical properties * magnetron sputtering * wear Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.291, year: 2010
Predictors and Outcomes of Parental Involvement with High School Students in Science
Shumow, Lee; Lyutykh, Elena; Schmidt, Jennifer A.
2011-01-01
Demographic and psychological predictors of parent involvement with their children's science education both at home and at school were examined during high school. Associations between both types of parent involvement and numerous academic outcomes were tested. Data were collected from 244 high school students in 12 different science classrooms…
Oral health knowledge, perceptions and behaviour among nursing ...
African Journals Online (AJOL)
Aim: The purpose of the study was to investigate oral health knowledge, perceptions and behaviour amongst nursing students in a Nigerian tertiary hospital. Materials and methods: The study was conducted at University of Nigeria Teaching Hospital on 244 respondents aged 17 to 40 years, using self administered ...
Czech Academy of Sciences Publication Activity Database
Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.
2010-01-01
Roč. 122, č. 2 (2010), e244 ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardioloy * myocardial infarction * in-hospital mortality Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery
Short-term flow induced crystallization in isotactic polypropylene : how short is short?
Ma, Z.; Balzano, L.; Portale, G.; Peters, G.W.M.
2013-01-01
The so-called "short-term flow" protocol is widely applied in experimental flow-induced crystallization studies on polymers in order to separate the nucleation and subsequent growth processes [Liedauer et al. Int. Polym. Proc. 1993, 8, 236–244]. The basis of this protocol is the assumption that
Impact of project funding on the implementation of LEEMP ...
African Journals Online (AJOL)
The implementation process could make a project succeed, fail or even abandoned midstream. Information gathered from LEEMP in Imo State indicates that out of the 258 development projects embarked upon by LEEMP, only 24.4% have been completed while 75.6% are at their various completion stages after committing ...
Inteligence a agresivita pachatelů majetkové trestné činnosti
Czech Academy of Sciences Publication Activity Database
Polišenská, Veronika; Koubalíková, S.; Borovanská, M.
2012-01-01
Roč. 56, č. 6 (2012), s. 574-583 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/0706 Institutional research plan: CEZ:AV0Z70250504 Keywords : property crime offenders * intelligence * aggression * Raven progressive matrices * Hand test Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Mechanism of streaming current generation by concentration gradients in packed-particle columns
Czech Academy of Sciences Publication Activity Database
Vespalec, Radim; van Leeuwen, H. P.
2001-01-01
Roč. 244, č. 1 (2001), s. 66-73 ISSN 0021-9797 R&D Projects: GA AV ČR IAA4031703; GA ČR GA203/99/0044 Institutional research plan: CEZ:AV0Z4031919 Keywords : electrokinetics * electric double layer * electrochromatography Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.530, year: 2001
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Wallace and Natural Selection, 1858. Sahotra Sarkar. General Article Volume 13 Issue 3 March 2008 pp 236-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/03/0236-0244. Keywords.
Cano, Miguel Angel; Castillo, Linda G.; Davis, Matthew J.; Lopez-Arenas, Araceli; Vaquero, Juana; Thompson, Keisha V.; Saldivar, Isaac M.
2012-01-01
This study investigated the influence of psychocultural variables (e.g., acculturation, enculturation, ethnic identity) and personality characteristics in relation to educational expectations among 345 Latino middle school students in the U.S. Results from a path model indicate that 24.4% of the variance of educational expectations was accounted…
African Journals Online (AJOL)
abp
2013-06-09
Jun 9, 2013 ... Health Officer, Nurses, Midwives and Laboratory students, and health ... though 244(80%) of the HCWs had motivation or interest to be tested by themselves. ..... travel to distant places for VCT as they feel that VCT at their own.
Can voltammetry distinguish glycan isomers?
Czech Academy of Sciences Publication Activity Database
Trefulka, Mojmír; Paleček, Emil
2015-01-01
Roč. 69, č. 1 (2015), s. 241-244 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GAP301/11/2055 Institutional support: RVO:68081707 Keywords : oligosaccharide isomers * Os(VI) complexes * chemical modification Subject RIV: BO - Biophysics Impact factor: 1.326, year: 2015
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. TRUPTI ASOLKAR. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 55-66 RESEARCH ARTICLE. Identification of virulence factors and type III effectors of phylotype I, Indian Ralstonia solanacearum strains Rs-09-161 and Rs-10-244 · TRUPTI ASOLKAR ...
A capacitive level shifter for high voltage (2.5kV)
DEFF Research Database (Denmark)
Andersen, Thomas; Andersen, Michael A. E.; Thomsen, Ole Cornelius
2012-01-01
with focus on low power consumption as well as low capacitive load between the floating half-bridge node and ground (output capacitance). The operation of the level-shifter is tested and verified by measurements on a prototype half-bridge gate driver. Results conclude stabile operation at 2.44kV, 50k...
International Nuclear Information System (INIS)
Anon.
1975-01-01
Heat capacity, standard entropy, standard enthalpy, and standard Gibbs energy of 242 PuF 4 from 10 to 350 0 K, of 244 PuO 2 from 4 to 25 0 K, of Li 3 N from 5 to 350 0 K, and of Cs 2 UO 4 from 5 to 350 0 K are reported. (U.S.)
Fate map of the dental mesenchyme: Dynamic development of the dental papilla and follicle
Czech Academy of Sciences Publication Activity Database
Rothová, Michaela; Peterková, Renata; Tucker, A. S.
2012-01-01
Roč. 366, č. 2 (2012), s. 244-254 ISSN 0012-1606 R&D Projects: GA ČR GA304/07/0223 Institutional research plan: CEZ:AV0Z50390703; CEZ:AV0Z50390512 Keywords : tooth * mouse * mesenchyme Subject RIV: EA - Cell Biology Impact factor: 3.868, year: 2012
Contracting Data Analysis: Assessment of Government-Wide Trends
2017-03-01
CONTRACTING DATA ANALYSIS Assessment of Government -wide Trends Report to Congressional Addressees March 2017...Office Highlights of GAO-17-244SP, a report to congressional addressees March 2017 CONTRACTING DATA ANALYSIS Assessment of Government -wide...Trends What GAO Found GAO’s analysis of government -wide contracting data found that while defense obligations to buy products and services
Gclust Server: 68961 [Gclust Server
Lifescience Database Archive (English)
Full Text Available ace protein required for swimming motility 1 1.00e-06 0.0 0.0 4.0 0.0 0.0 0.0 Show 68961 Cluster ID 68961 Se...quences(244) Sequence length 835 Representative annotation SwmA-cell surface protein required for swimming
Terrestrial xenon isotope constraints on the early history of the earth
International Nuclear Information System (INIS)
Ozima, M.; Igarashi, G.; Podosek, F.A.
1985-01-01
Comparison between 129 I-radiogenic 129 Xe and 244 Pu-fissiogenic 136 Xe components in terrestrial xenon suggests that the Earth's inner region accreted a few tens of millions of years earlier than the outer region from which the atmosphere evolved. The results also indicate that there has been no substantial mixing of the two regions since the Earth's accretion. (author)
Chiral separations in capillary electrophoresis
Czech Academy of Sciences Publication Activity Database
Vespalec, Radim; Boček, Petr
2000-01-01
Roč. 100, č. 10 (2000), s. 3715-3753 ISSN 0009-2665 R&D Projects: GA AV ČR IAA4031703; GA ČR GA203/99/0044; GA MŠk VS96021; GA MŠk VS97014 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 21.244, year: 1999
Carter, Margaret Anne; Frewen, Amie; Chunn, Jennifer
2014-01-01
This study reports the importance 244 parents of six-year-old children living in Singapore placed on cognitive (problem-solving and creativity) and non-cognitive (practical school skills and conforming) behaviours. Our research team hypothesised that, as the age of the parent increased, the importance placed on each covariant skill (problem…
Prevalence of obesity among diabetics seen in a tertiary health care ...
African Journals Online (AJOL)
Background: Obesity is a leading determinant for diabetes mellitus. The objective of this study was to assess the prevalence of overweight/obesity among diabetic patients seen at a tertiary hospital in South-South Nigeria. Methods: A retrospective study of 244 diabetic patients seen between January 2010 and June 2012.
2013-03-11
... for an MSP because OPM can treat a church plan as equivalent to an issuer under the Church Parity and Entanglement Protections Act, Public Law 106-244 (``Parity Act''). The commenter recommended that OPM could..., national origin, disability, age, sex, gender identity, or sexual orientation. We sought comment on any...
DEFF Research Database (Denmark)
Ostrowski, S R; Ullum, H; Pedersen, Bente Klarlund
2005-01-01
Human immunodeficiency virus (HIV)-1 infection influences natural killer (NK) cell expression of inhibitory NK receptors and activating natural cytotoxicity receptors. It is unknown whether expression of the co-stimulatory NK cell receptor 2B4 (CD244) on NK cells and CD3+ CD8+ cells are affected ...
Examining Gender DIF on a Multiple-Choice Test of Mathematics: A Confirmatory Approach.
Ryan, Katherine E.; Fan, Meichu
1996-01-01
Results for 3,244 female and 3,033 male junior high school students from the Second International Mathematics Study show that applied items in algebra, geometry, and computation were easier for males but arithmetic items were differentially easier for females. Implications of these findings for assessment and instruction are discussed. (SLD)
Life-history characteristics of an age-validated established invasive ...
African Journals Online (AJOL)
By counting post-fluorescent mark increments on otoliths from 21 chemically tagged wild fish recaptured 244–537 days later, the deposition of growth zones, comprising alternating opaque and translucent bands, was validated as annual. Examination of sectioned otoliths from 175 fish revealed that the oldest fish, two males ...
EST Table: FS869999 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS869999 E_FL_fner_41G01_R_0 10/09/28 90 %/258 aa ref|NP_001037132.1| ribosomal pro...6-PB 10/08/29 38 %/244 aa R151.3#CE00744#WBGene00004417#locus:rpl-6#Ribosomal protein ML16#status:Confirmed#UniProt:P4799
Czech Academy of Sciences Publication Activity Database
Pospíšil, Miloslav; Vannucci, L.; Horváth, Ondřej; Fišerová, Anna; Krausová, Kateřina; Bezouška, Karel
1999-01-01
Roč. 4, Suppl 1 (1999), s. 244 ISSN 1107-3756. [World Congress on Advances in Oncology /4./. 07.10.1999-09.10.1999, Athens] R&D Projects: GA ČR GV312/98/K034 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EC - Immunology
Performance-vested stock options and interest alignment
Kuang, Y.; Qin, B.
2009-01-01
This paper investigates the effects of performance-vested stock options (PVSOs) in aligning management interests and shareholder wealth. Using 4238 executive-level observations for 1383 executive directors from the largest 244 UK non-financial firms over the 1999-2004 period, we find that the use of
Performance-vested stock options and interest alignment
Kuang, Y.; Qin, B.
2009-01-01
This paper investigates the effects of performance-vested stock options (PVSOs) in aligning management interests and shareholder wealth. Using 4238 executive-level observations for 1383 executive directors from the largest 244 UK non-financial firms over the 1999–2004 period, we find that the use of
Behaviour Profile of Hungarian Adolescent Outpatients with a Dual Diagnosis
Dinya, Elek; Csorba, Janos; Suli, Agota; Grosz, Zsofia
2012-01-01
The behaviour dimensions of 244 Hungarian adolescent psychiatric outpatients with a dual diagnosis (intellectual disability and psychiatric diagnosis) were examined by means of the adapted version of the Behaviour Problem Inventory (BPI, Rojahn, Matson, Lott, Esbensen, & Smalls, 2001). Four IQ subgroups were created: borderline, mild, moderate…
See No Evil: Sexual Abuse of Children by Teachers.
Shoop, Robert J.
1999-01-01
Sexual abuse of students by teachers is a serious problem. A 1998 "Education Week" nationwide study identified 244 cases of inappropriate sexual behavior during one six-month period. Overly affectionate behavior, inappropriate noneducation-related contact, and harassing behaviors are warning signs. Administrators should craft policies, pay…
Pseekos, A. Chantelle; Bullock-Yowell, Emily; Dahlen, Eric R.
2011-01-01
The researchers examined the impact of person-environment (P-E) fit, as defined by Holland's (1997) theory, on interpersonal conflict at work (ICAW) and workplace aggression. In addition, previous relationships found in the job satisfaction literature were examined in the present sample of 244 United States employees. Internet-based surveys were…
76 FR 44337 - Comments and Information Relevant to Mid Decade Review of NORA
2011-07-25
... NIOSH-244] Comments and Information Relevant to Mid Decade Review of NORA AGENCY: Department of Health...) is conducting a review of the processes of the National Occupational Research Agenda (NORA). In 2006, NORA entered its second decade with an industry sector-based structure. In 2011, as NORA reaches the...
Phytochemicals and in vitro antioxidant potentials of defatted ...
African Journals Online (AJOL)
ONOS
2010-01-18
Jan 18, 2010 ... 1Department of Biochemistry, Ladoke Akintola University of Technology, Ogbomoso, Nigeria. Accepted 21 September ... exhibited scavenging activity with IC50 of 12.63, 1,377.00 and 244.00 µg/ml for DPPH, hydroxyl radical and nitric oxide radical ..... maritimum essential oils. Planta. Med. 66: 687-693.
Finance middle managers and financial statement fraud
Linke, Kristina Gisela Babette
2012-01-01
Verslaggevingsfraude is het manipuleren van de boekhouding om betere cijfers te laten zien. Kristina Linke onderzocht deze vorm van fraude, waarbij zij vooral keek naar de rol van de controller. Dat gebeurde aan de hand van 244 aanklachten in de periode 2000-2006 in de Verenigde Staten. Uit het
Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3
International Nuclear Information System (INIS)
McVey, C.B.
1994-01-01
This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Prajval Shastri. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 3 March 2017 pp 237-244 General Article. Black Holes in Our Universe: Do They Inch Up the Mass Ladder? Prajval Shastri · More Details Abstract Fulltext PDF.
Low, Sabina; Snyder, James; Shortt, Joann Wu
2012-01-01
Prospective associations of mothers' parenting processes, youth disclosure, and youth problem behavior were examined in a longitudinal design following 244 adolescent sibling dyads over a 3-year period. For both siblings, authoritative parenting was positively associated with youth disclosure and was negatively related to problem behavior, and…
Czech Academy of Sciences Publication Activity Database
Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.
2015-01-01
Roč. 112, č. 2 (2015), s. 235-244 ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM
DEFF Research Database (Denmark)
Gårdsvoll, Henrik; Gilquin, Bernard; Le Du, Marie Hélène
2006-01-01
a comprehensive alanine scanning mutagenesis of uPAR combined with low resolution distance constraints defined within the complex using chemical cross-linkers as molecular rulers. The kinetic rate constants for the interaction between pro-uPA and 244 purified uPAR mutants with single-site replacements were...
Fuel selection for radioisotope thermoelectric generators
International Nuclear Information System (INIS)
Menezes, A.
1988-06-01
The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author) [pt
Blake, D. F.; Sarrazin, P.; Thompson, Kathleen
2017-01-01
The MapX imaging X-ray spectrometer is described and Monte Carlo modeling is used to show the efficacy of 244-Cm radioisotope sources in detecting and quantifying the biogenic elements in ices on Ocean Worlds such as Europa.
2006-06-01
elites are not particularly threatened by democraticization” since the institutions required to run the democracy “are already well established before... Philanthropy website, http://www.covekoljublje.org/proj_completed.htm (accessed 18 May 2006). 244 “More Ethnic Fighting in Kosovo Leaves Thousands
The Assessment of Bulimic Symptoms and Personality Correlates in Female College Students.
Nagelberg, Daniel B.; And Others
1984-01-01
Classified college women (N=244) into three groups according to bulimic symptoms: (1) binge eating; (2) purging; and (3) controls. Results indicated purging may represent the critical behavior in bulimia assessment. Purgers showed lower self-esteem, lowered will control, and less regard for social demands, suggesting significant differences…
It should not hurt to be a child : prevalence of child maltreatment across the globe
Stoltenborgh, Marije
2012-01-01
In this thesis we describe, combine and compare results of a series of meta-analyses on the prevalence of child sexual, physical, and emotional abuse and of physical and emotional neglect, including 244 publications and 577 prevalence rates for the various types of maltreatment. Child maltreatment
Czech Academy of Sciences Publication Activity Database
Hlaváčková, V.; Krchňák, P.; Nauš, J.; Novák, Ondřej; Špundová, M.; Strnad, Miroslav
2006-01-01
Roč. 225, č. 1 (2006), s. 235-244 ISSN 0032-0935 R&D Projects: GA ČR GA206/05/0894 Institutional research plan: CEZ:AV0Z50380511 Keywords : Abscisic acid * Electrical signals * Gas exchange Subject RIV: CE - Biochemistry Impact factor: 2.963, year: 2006
SAH Gene Variants Revisited in the European Project on Genes in Hypertension
Czech Academy of Sciences Publication Activity Database
Tikhonoff, V.; Staessen, J.A.; Kuznetsova, T.; Thijs, L.; Hasenkamp, S.; Stolarz, K.; Seidlerová, J.; Filipovský, J.; Nikitin, Y.; Peleška, Jan; Kawecka-Jaszcz, K.; Casiglia, E.; Brand-Herrmann, S.M.; Brand, E.
2008-01-01
Roč. 26, č. 2 (2008), s. 244-250 ISSN 0263-6352 Institutional research plan: CEZ:AV0Z10300504 Keywords : body mass index * hypertension * population study * SAH gene * serum lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 5.132, year: 2008
Ammonia release from heated "street" cannabis leaf and its potential toxic effects on cannabis users
Czech Academy of Sciences Publication Activity Database
Bloor, R.; Wang, T. S.; Španěl, Patrik; Smith, D.
2008-01-01
Roč. 103, č. 10 (2008), s. 1671-1677 ISSN 0965-2140 Institutional research plan: CEZ:AV0Z40400503 Keywords : ammonia * cannabis * respiratory Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.244, year: 2008
Evolutionary relationships within a subgroup of HERV-K-related human endogenous retroviruses
Zsíros, J.; Jebbink, M. F.; Lukashov, V. V.; Voûte, P. A.; Berkhout, B.
1998-01-01
The prototype endogenous retrovirus HERV-K10 was identified in the human genome by its homology to the exogenous mouse mammary tumour virus. By analysis of a short 244 bp segment of the reverse transcriptase (RT) gene of other HERV-K10-like sequences, it has become clear that these elements
Analysis procedure for americium in environmental samples
International Nuclear Information System (INIS)
Holloway, R.W.; Hayes, D.W.
1982-01-01
Several methods for the analysis of 241 Am in environmental samples were evaluated and a preferred method was selected. This method was modified and used to determine the 241 Am content in sediments, biota, and water. The advantages and limitations of the method are discussed. The method is also suitable for 244 Cm analysis
Rösel, Ch.; Hänscheid, H.; Hartfiel, J.; Mutius, von R.; Achard van Enschut, d' J.F.M.; David, P; Janszen, H.; Johansson, T.; Konijn, J.; Krogulski, T.; Laat, de C.T.A.M.; Paganetti, H.; Petitjean, C.; Polikanov, S.M.; Reist, H.W.; Risse, F.; Schaller, L.A.; Schrieder, W.; Sinha, A.K.; Taal, A.; Theobald, J.P.; Tibell, G.; Trautmann, N.
1993-01-01
The ratios of prompt to delayed fission yields for the isotopes U-233, U-234, U-235, U-236, U-238, Np-237, Pu-242, and Pu-244 and the fission probabilities relative to each other have been investigated experimentally. Using the value of the total fission probability for Np-237 the absolute
Wright, Michelle F.; Li, Yan; Shi, Junqi
2014-01-01
This study examined two social status goals in relation to aggressive and prosocial behaviors as well as attributions for relational aggression among 477 (244 girls) Chinese early adolescents. Findings indicate that, after controlling for each other, the social preference goal was negatively related to self-reported overt aggression, and…
Nové termoresponsivní polymery pro kombinovanou lokální chemoradioterapii
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Kučka, Jan; Kozempel, Ján; Lebeda, Ondřej; Koňák, Čestmír; Ulbrich, Karel
2007-01-01
Roč. 61, č. 1 (2007), s. 243-244 ISSN 1336-7242. [Zjazd chemikov /59./. 02.09.2007-06.09.2007, Tatranské Matliare] R&D Projects: GA AV ČR IAA400480616 Institutional research plan: CEZ:AV0Z40500505 Keywords : thermoresponsive * local * radiotherapy Subject RIV: CD - Macromolecular Chemistry
The Shared Traumatic and Professional Posttraumatic Growth Inventory
Tosone, Carol; Bauwens, Jennifer; Glassman, Marc
2016-01-01
Purpose: While there are established instruments offering psychometrically sound measurement of primary or secondary trauma, none capture the essence of dual exposure for mental health professionals living and working in traumatological environments. Methods: This study examined the experience of 244 mental health workers who lived and worked in…
Egyptian Journal of Biomedical Sciences - Vol 23 (2007)
African Journals Online (AJOL)
Effect Of Green Leaves And Germination And Boiling Treatments Of Fenugreek And Lupin Seeds On Chemical Composition, Serum Glucose, Lipid Profile And Hepatic Enzymes Of Rats · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT ... DOWNLOAD FULL TEXT. S A El-Adawy, A A Ramadan, 244-256.
The effect of pulmonary tuberculosis on neurocognitive function in ...
African Journals Online (AJOL)
To examine group differences in neurocognitive status, we used Wilcoxon ranked sum tests to compare the performance between groups on neuropsychological test battery. Results: Out of 324, only 244 were studied. Results indicated significant neurocognitive impairment in PTB+/HIV+ group than PTB-/HIV+ in the GDS, ...
Use and Perception of Electronic Cigarettes among College Students
Trumbo, Craig W.; Harper, Raquel
2013-01-01
Objective: This study provides insight into how electronic cigarettes (e-cigarettes) may affect the social normative environment for tobacco use among college students. Participants: Participants were 244 freshman and sophomore students. Methods: Students completed an online self-report survey in April 2011. Results: There is a higher acceptance…
Contact Problem of Disk on Shaft Fixed by Induction Shrink Fit
Czech Academy of Sciences Publication Activity Database
Ulrych, B.; Kotlan, V.; Doležel, Ivo
2012-01-01
Roč. 88, 12B (2012), s. 32-34 ISSN 0033-2097 Institutional research plan: CEZ:AV0Z20760514 Keywords : induction shrink fit * contact problem * transfer of torque Subject RIV: BA - General Mathematics Impact factor: 0.244, year: 2011
Influence of Day Length and Physical Activity on Sleep Patterns in Older Icelandic Men and Women
DEFF Research Database (Denmark)
Brychta, Robert J; Arnardóttir, Nanna Ýr; Jóhannsson, Erlingur
2016-01-01
Study Objectives: To identify cross-sectional and seasonal patterns of sleep and physical activity (PA) in community-dwelling, older Icelandic adults using accelerometers. Methods: A seven-day free-living protocol of 244 (110 female) adults aged 79.7 +/- 4.9 years was conducted as part of a larger...
Tributyltin disrupts feeding and energy metabolism in the goldfish (Carassius auratus).
Zhang, Jiliang; Sun, Ping; Yang, Fan; Kong, Tao; Zhang, Ruichen
2016-06-01
Tributyltin (TBT) can induce obesogen response. However, little is known about the adverse effects of TBT on food intake and energy metabolism. The present study was designed to investigate the effects of TBT, at environmental concentrations of 2.44 and 24.4 ng/L (1 and 10 ng/L as Sn), on feeding and energy metabolism in goldfish (Carassius auratus). After exposure for 54 d, TBT increased the weight gain and food intake in fish. The patterns of brain neuropeptide genes expression were in line with potential orexigenic effects, with increased expression of neuropeptide Y and apelin, and decreased expression of pro-opiomelanocortin, ghrelin, cocaine and amphetamine-regulated transcript, and corticotropin-releasing factor. Interestingly, the energy metabolism indicators (oxygen consumption, ammonia exertion and swimming activity) and the serum thyroid hormones were all significantly increased at the 2.44 ng/L TBT group in fish. However, no changes of energy metabolism indicators or a decrease of thyroid hormones was found at the 24.4 ng/L TBT group, which indicated a complex disrupting effect on metabolism of TBT. In short, TBT can alter feeding and energy metabolism in fish, which might promote the obesogenic responses. Copyright © 2016 Elsevier Ltd. All rights reserved.
Sequence-characterized markers from Begonia x tuberhybrida Voss..
Czech Academy of Sciences Publication Activity Database
Wiesner, Ivo; Wiesnerová, Dana
2008-01-01
Roč. 73, č. 6 (2008), s. 244-247 ISSN 1611-4426 R&D Projects: GA AV ČR 1QS500510566 Institutional research plan: CEZ:AV0Z50510513 Keywords : Begonia * genetic markers Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.300, year: 2008
Dairy Products, Dietary Calcium, and Risk of Inflammatory Bowel Disease
DEFF Research Database (Denmark)
Opstelten, Jorrit L; Leenders, Max; Dik, Vincent K
2016-01-01
, yogurt, and cheese) and dietary calcium was measured using validated food frequency questionnaires. Cases developing incident CD (n = 110) or UC (n = 244) during follow-up were matched with 4 controls. Conditional logistic regression analyses were used to calculate odds ratios (ORs) with 95% confidence...
Posttraumatický stres a posttraumatický rozvoj v dětské onkologii
Czech Academy of Sciences Publication Activity Database
Slezáčková, Alena; Loučka, M.; Bartošová, K.
2012-01-01
Roč. 56, č. 2 (2012), s. 132-147 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/11/2421 Institutional research plan: CEZ:AV0Z70250504 Keywords : postttraumatic stress * posttraumatic growth * childhood cancer Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
HIV self-testing practices among Health Care Workers: feasibility ...
African Journals Online (AJOL)
HIV self-testing practices among Health Care Workers: feasibility and options for ... is required to increase the rate of HIV testing and expand treatment services. ... 244(80%) of the HCWs had motivation or interest to be tested by themselves.
Dicty_cDB: Contig-U10415-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ormation vector pOKE104, com... 243 9e-63 EF106972_17( EF106972 |pid:none) Uncultur...ecName: Full=3-methyl-2-oxobutanoate hydroxymethyltran... 244 4e-63 FJ599664_2( FJ599664 |pid:none) Transf
Concussion Education for High School Football Players: A Pilot Study
Manasse-Cohick, Nancy J.; Shapley, Kathy L.
2014-01-01
This survey study compared high school football players' knowledge and attitudes about concussion before and after receiving concussion education. There were no significant changes in the Concussion Attitude Index. Results revealed a statistically significant difference in the athletes' scores for the Concussion Knowledge Index, "t"(244)…
Physical characteristics of Comet Nucleus C/2001 OG108 (LONEOS)
Czech Academy of Sciences Publication Activity Database
Abell, P.A.; Fernandéz, Y.R.; Pravec, Petr; French, L.M.; Farnham, T.L.; Gaffey, M.J.; Hardersen, P.S.
2005-01-01
Roč. 179, č. 1 (2005), s. 174-194 ISSN 0019-1035 R&D Projects: GA AV ČR IAA3003204; GA ČR GA205/99/0255 Institutional research plan: CEZ:AV0Z10030501 Keywords : comet s * composition * infrared observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.244, year: 2005
On the Increasing Fragility of Human Teeth with Age: ADeep-Ultraviolet Resonance Raman Study
Energy Technology Data Exchange (ETDEWEB)
Ager III, J.W.; Nalla, R.K.; Balooch, G.; Kim, G.; Pugach, M.; Habelitz, S.; Marshall, G.W.; Kinney, J.H.; Ritchie, R.O.
2006-07-14
Ultraviolet resonance Raman spectroscopy (UVRRS) using 244nm excitation was used to investigate the impact of aging on humandentin. The intensity of a spectroscopic feature from the peptide bondsin the collagen increases with tissue age, similar to a finding reportedpreviously for human cortical bone.
African Journals Online (AJOL)
USER
2016-12-13
Dec 13, 2016 ... processors produced 10kg shea butter each from 50kg shea nuts in a week. Hence, the technical ... a substitute for cocoa butter in the chocolate and ..... America. Journal of Humanities and Social. Science. 1(4);244-250. Doi:.
Cetinkaya, Turan; Kirtepe, Abdurrahman; Ugurlu, Fatih Mehmet
2018-01-01
The aim of this research is to determine the attitudes of the students who are studying in the physical education and sports departments towards the teaching profession. 244 students attending Ahi Evran University School of Physical Education and Sports and Firat University Sports Sciences Faculty Physical Education and Sport Teacher Training,…
DEFF Research Database (Denmark)
Illemann, Martin; Laerum, Ole Didrik; Hasselby, Jane Preuss
2014-01-01
Patients were identified from a population-based prospective study of 4990 individuals with symptoms associated with colorectal cancer (CRC). A total of 244 CRC tissue samples were available for immunohistochemical staining of uPAR, semiquantitatively scored at the invasive front, and in the tumo...
Acoustic analysis of warp potential of green ponderosa pine lumber
Xiping Wang; William T. Simpson
2005-01-01
This study evaluated the potential of acoustic analysis as presorting criteria to identify warp-prone boards before kiln drying. Dimension lumber, 38 by 89 mm (nominal 2 by 4 in.) and 2.44 m (8 ft) long, sawn from open-grown small-diameter ponderosa pine trees, was acoustically tested lengthwise at green condition. Three acoustic properties (acoustic speed, rate of...
1999-01-01
Maine: Ecotoxicology and Environmental Safety, v. 25, no. 2, p. 244-252. 43 Gleich, J.G., 1972, Terrestrial gastropods from central Maine... macrophytes for our evaluation; because birds are not a focus of NAWQA activities, studies exclusively concerning waterfowl were not presented in this
E-Learning Adoption: The Role of Relative Advantages, Trialability and Academic Specialisation
Hsbollah, Hafizah Mohamad; Idris, Kamil Md.
2009-01-01
Purpose: The purpose of this paper is to investigate Universiti Utara Malaysia UUM lecturers' perception of the decision regarding adopting e-learning as a teaching tool. Design/methodology/approach: Data were collected from 244 lecturers in Universiti Utara Malaysia. Internal consistency using Cronbach alpha and exploratory factor analysis with…
New Opportunities for Quantitative Tracking of Polycrystal Responses in Three Dimensions (Postprint)
2014-12-09
properties (e.g. strength, stiffness, electri cal conductivity, etc.) stemming from the atomic compositions and structure along with crystal defects...2015) 235- 244 473MP a a p r e - creep 4pMP a pos - creep d 650 600 . . . 550 .. . . . .- .. O"eff ...... ·~·· A Cll .t ·* •• • D. ~~ · ~ 500
2011-10-05
... posted by the subject firm in Malaysia at the same time as the domestic layoffs. Additionally, the... imports of these articles from Malaysia. In a letter submitted to the Department on June 13, 2011, the... facilities overseas. AR 152, 212-218, 228-231, 244, 245-246, 271-279. After the design and development of the...
78 FR 23245 - FY2013 Supplemental Funding for Brownfields Revolving Loan Fund (RLF) Grantees
2013-04-18
[email protected] . 94105, Phone (213) 244-1821 Fax (415) 972-3364. EPA Region 10, Susan Morales, AK, ID, OR, WA......... 1200 Sixth Avenue, Suite 900, Mailstop: ECL-112 Morales[email protected] . Seattle, WA 98101, Phone (206) 553-7299 Fax (206) 553-0124. Dated: April 11, 2013. David R. Lloyd, Director...
Basic properties of full-size st ructural flakeboards fabricated with flakes on a shaping lathe
Eddie W. Prie
1977-01-01
Structural exterior flakeboards manufactured in 4 by 8 ft (1.22 by 2.44 m ) size with phenolic resin and flakes produced on a shaping-lathe headrig were evaluated for plate shear modulus, internal bond, bending properties, and 24-hour water soak stability. Both mixed and single species flakeboards were produced. Panels with mixed flakes had 20% by weight of hickory,...
South African Medical Journal - Vol 79, No 3 (1991)
African Journals Online (AJOL)
Under-reporting in hepatitis B notifications · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S.S. Abdool Karim, Q Abdool Karim, 242-244 ... Non-cirrhotic portal hypertension entity in South Africa? A report of 6 cases · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Mizan Law Review - Vol 10, No 1 (2016)
African Journals Online (AJOL)
Notes: Public Consultation toward Ethiopia's Family Law Reform and the Revised Code's Response · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mandefrot Belay, 244-264. http://dx.doi.org/10.4314/mlr.v10i1.8 ...
75 FR 3871 - Promoting Diversification of Ownership in Broadcast Services; Suspension of Filing Date
2010-01-25
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [MB Docket Nos. 07-294, 06-121, 02-277, 04-228; MM Docket Nos. 01-235, 01-317, 00-244; DA 09-2618] Promoting Diversification of Ownership in...); Promoting Diversification in the Broadcasting Services, Order, DA 09-2165 (rel. Oct. 2, 2009). See also...
Czech Academy of Sciences Publication Activity Database
Eichlerová, Ivana; Homolka, Ladislav; Tomšovský, M.; Lisá, Ludmila
2015-01-01
Roč. 119, č. 12 (2015), s. 1345-1353 ISSN 1878-6146 R&D Projects: GA ČR GAP504/12/0709 Institutional support: RVO:61388971 Keywords : Basidiomycetes * Cryopreservant * Liquid nitrogen Subject RIV: EE - Microbiology, Virology Impact factor: 2.244, year: 2015
Neurovascular Compression in Essential Hypertension: Cause, Consequence or Unrelated Finding?
Czech Academy of Sciences Publication Activity Database
Ceral, J.; Žižka, J.; Eliáš, P.; Solař, M.; Klzo, L.; Reissigová, Jindra
2007-01-01
Roč. 21, č. 2 (2007), s. 179-181 ISSN 0950-9240 R&D Projects: GA MZd NA6169 Institutional research plan: CEZ:AV0Z10300504 Keywords : neurovascular compression * rostral ventrolateral medulla oblongata * hypertension Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.244, year: 2007
An FMRI Study of Olfactory Cues to Perception of Conspecific Stress
2010-04-01
Petrovic P, Ingvar M, Stone-Elander S, Petersson KM, Hansson P (1999) A PET activation study of dynamic mechanical allodynia in patients with...state on olfactory sensitivity suggest odor specificity. Biol Psychol 71: 244-247. 67. Mair RG, Bouffard JA, Engen T, Morton TH (1978) Olfactory
Prevalence and causes of blindness in a tropical African population ...
African Journals Online (AJOL)
It has a population of about 2, 654, 244 using the population growth rate of 3.0 percent per year. Egbedore LGA has a population of 49,555 being the projected estimate of the local census done in 1991. Study design: The study was in accordance with World Health Organisation recommendations. 3204 rural dwellers were ...
Modeling of Embedded Human Systems
2013-07-01
ISAT study [7] for DARPA in 20051 concretized the notion of an embedded human, who is a necessary component of the system. The proposed work integrates...Technology, IEEE Transactions on, vol. 16, no. 2, pp. 229–244, March 2008. [7] C. J. Tomlin and S. S. Sastry, “Embedded humans,” tech. rep., DARPA ISAT
Heavy Metals and Physicochemical Properties of Soils in Kano ...
African Journals Online (AJOL)
and such soil properties as organic carbon, available P, total N and basic cations on the other. Keywords: ..... addition through fertilizers and agro-chemicals, their ..... Analysis of Fish Tissue for Trace Metals. Afon ... Nutrition 7(2): 244-248.
Burnout Levels of Handball Players with Respect to Age, Gender and Experience
Toros, Turhan
2018-01-01
The aim of this study was to investigate burnout levels of handball players in terms of age, gender and experience. In this study, 116 female and 128 male, totally 244 handball players with the mean age 22.39 ± 1.98 year participated voluntarily. Maslach Burnout Inventory that originally developed by Maslach and Jackson (1981) and adapted to…
African Journals Online (AJOL)
USER
2016-04-08
Apr 8, 2016 ... Ethiopian Journal of Environmental Studies & Management 9 (2): 235 – 244, 2016. ISSN:1998-0507 ... impact of tourism and hospitality industry, taking responsibility towards the silent ... environment related with the concept of ... strategy and daily practice is imperative .... Nigeria case study achieved high.
Konishi, Chiaki; Miyazaki, Yasuo; Hymel, Shelley; Waterhouse, Terry
2017-01-01
This study examined how student reports of bullying were related to different dimensions of school climate, at both the school and the student levels, using a contextual effects model in a two-level multilevel modeling framework. Participants included 48,874 secondary students (grades 8 to 12; 24,244 girls) from 76 schools in Western Canada.…
Do I Know Its Wrong: Children's and Adults' Use of Unconventional Grammar in Text Messaging
Kemp, Nenagh; Wood, Clare; Waldron, Sam
2014-01-01
There is concern that the violations of conventional grammar (both accidental and deliberate) often seen in text messages (e.g., "hi [smiley face emoticon] how is ya?!!") could lead to difficulty in learning or remembering formal grammatical conventions. We examined whether the grammatical violations made by 244 British children,…
Czech Academy of Sciences Publication Activity Database
Votrubová, J.; Dohnal, M.; Vogel, T.; Tesař, Miroslav; Jelínková, V.; Cislerova, M.
2017-01-01
Roč. 65, č. 3 (2017), s. 244-253 ISSN 0042-790X R&D Projects: GA ČR GA16-05665S Institutional support: RVO:67985874 Keywords : soil infiltrability * infiltration instability * infiltration modes * burrowing animals * preferential flow Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 1.654, year: 2016
Natural durability of heartwoods from European and tropical Africa ...
African Journals Online (AJOL)
STORAGESEVER
2009-09-15
Sep 15, 2009 ... 4426 Afr. J. Biotechnol. Table 1. Water salinity, average temperatures and coordinates of the test areas. City. ID. Test areas. Geographical latitude (North). Geographical longitude (East). Saltiness ratio (%). Average temperatures low and high (yearly) (0C). 61. Trabzon. 41°06'. 39°25'. 0.18. 7.9 - 24.4. 67.
Aerospace Medicine and Biology. A continuing bibliography with indexes
1982-01-01
This bibliography lists 244 reports, articles, and other documents introduced into the NASA scientific and technical information system in February 1981. Aerospace medicine and aerobiology topics are included. Listings for physiological factors, astronaut performance, control theory, artificial intelligence, and cybernetics are included.
Rate Control for Network-Coded Multipath Relaying with Time-Varying Connectivity
2010-12-10
Armen Babikyan, Nathaniel M. Jones, Thomas H. Shake, and Andrew P. Worthen MIT Lincoln Laboratory 244 Wood Street Lexington, MA 02420 DDRE, 1777...delay U U U U SAR 11 Zach Sweet 781-981-5997 1 Rate Control for Network-Coded Multipath Relaying with Time-Varying Connectivity Brooke Shrader, Armen
2015-03-01
officer to befriend the broke, depressed , unemployed, and mentally unbalanced Ferhani and “tricked and coaxed him into a scheme that was completely...Strategic Counterterrorism Communications’ latest YouTube satire of the “Welcome to the ‘Islamic State’ land (ISIS/ISIL).”244 The State Department
Peklaj, Cirila; Podlesek, Anja; Pecjak, Sonja
2015-01-01
The aim of the study was to examine the relationships between gender, previous knowledge, different personality traits, subject-specific motivational dimensions and students' math grade in secondary school. A total of 386 first-year students (142 boys and 244 girls) from secondary schools in Slovenia (mean age was 15.7 years) participated in the…
Magnetohydrodynamic pumps for molten salts in cooling loops of high-temperature nuclear reactors
Czech Academy of Sciences Publication Activity Database
Doležel, Ivo; Kotlan, V.; Ulrych, B.
2011-01-01
Roč. 87, č. 5 (2011), s. 28-33 ISSN 0033-2097 Grant - others:GA MŠk(CZ) MEB051041 Institutional research plan: CEZ:AV0Z20570509 Keywords : magnetohydrodynamic pump * molten salt * electric field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.244, year: 2011 http://pe.org.pl/
Variants of clinicoroentgenological manifestations of sarcoidosis of respiratory organs
International Nuclear Information System (INIS)
Borisova, N.K.; Daurov, B.I.
1988-01-01
The paper is concerned with clinicoroentgenological characterization of 275 patients with different stages of intrathoracic sarcoidosis. Different X-ray types of sarcoidosis of the respiratory organs were detected in 67 (24.4%) of them. The number of patients with different types of sarcoidosis increased with progression of disease
Teplitzky, Samantha; Phillips, Margaret
2016-01-01
The Berkeley Research Impact Initiative (BRII) was one of the first campus-based open access (OA) funds to be established in North America and one of the most active, distributing more than $244,000 to support University of California (UC) Berkeley authors. In April 2015, we conducted a qualitative study of 138 individuals who had received BRII…
Analýza motivace na základě použití TAT u dvou skupin adolescentů
Czech Academy of Sciences Publication Activity Database
Urbánek, Tomáš; Czekóová, Kristína; Čermák, Ivo; Fikarová, Táňa; Pokorná, Zuzana
2012-01-01
Roč. 56, č. 5 (2012), s. 393-408 ISSN 0009-062X R&D Projects: GA ČR GA406/09/2089 Institutional research plan: CEZ:AV0Z70250504 Keywords : thematic apperception test * thematic content analysis * motivation * adolescents Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
2147-IJBCS-Article-Abdoulaye Kone
African Journals Online (AJOL)
hp
2011. Age and growth of the smooth hammerhead shark, Sphyrna zygaena, in the Eastern Equatorial Atlantic. Ocean, using vertebral sections. Aqu. Liv. Res., 24(4): 351-357. Compagno LJV. 1984a. FAO species catalogue, Sharks of the world: an annotated and illustrated catalogue of shark species known to date. Part 1:.
STD care in the South African private health sector | Schneider ...
African Journals Online (AJOL)
Objectives. To establish the accessibility and quality of sexually transmitted disease (SID) care provided by private general practitioners (GPs) and workplace health services in South Africa. Design. Structured telephone interviews were conducted with a random national sample of 120 GPs and 244 occupational health ...
Evaluating U.S. and Chinese Cyber Security Strategies Within a Cultural Framework
2016-04-01
analysis of Chinese culture in warfare studies. They find that Chinese convention “respects inaction”28 and the teachings of Sun Tzu , thus favoring the...15 Bibliography ...AY16 16 Bibliography Ehsan Ahrari. “Transformation of America’s Military and Asymmetric War.” Comparative Strategy 29, no. 3 (2010): 223-244
Oil-Impregnated Oxide Nanostructures for Aluminum Corrosion Prevention
2017-12-18
Surfaces Based on Inverse Colloidal Monolayers. Nat. Commun. 2013, 4, 10. 25. Rykaczewski, K.; Anand, S.; Subramanyam, S. B.; Varanasi, K. K...conditions. Part II: Electrochemical responses. Surf. Coat. Technol. 2002,153 (2-3), 235-244. 44. Mansfeld, F., Simultaneous Determination of
Czech Academy of Sciences Publication Activity Database
Pravec, Petr; Harris, A. W.; Scheirich, Peter; Kušnirák, Peter; Kotková, Lenka; Hergenrother, C.; Mottola, S.; Hicks, M. D.; Masi, G.; Krugly, Yu. N.; Shevchenko, V. G.; Nolan, M. C.; Howell, E. S.; Kaasalainen, M.; Galád, Adrián; Brown, P.; DeGraff, D. R.; Lambert, J.V.; Cooney, W.R.; Foglia, S.
2005-01-01
Roč. 1, č. 173 (2005), s. 108-131 ISSN 0019-1035 R&D Projects: GA AV ČR IAA3003204 Keywords : near-Earth objects * fast-rotating asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.244, year: 2005
Eesõigustatud merevõlad ja priviligeeritud nõuded Eesti Vabariigi seadusandluses / Indra Kaunis
Kaunis, Indra, 1966-
1995-01-01
1926. a. rahvusvahelise konventsiooni (Eesõigustatud merevõlgade ja merehüpoteekide kohta käivate määruste ühtlustamise rahvusvaheline konventsioon, RT 1928, 42, 244) ja Eesti Kaubandusliku Meresõidu Koodeksi (RT 1991, 46-48, 577) vastuoludest
African Journals Online (AJOL)
HP4510s
place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.
COMPOSITION AND DISTRIBUTION OF ECONOMIC TREE ...
African Journals Online (AJOL)
user
The inventory of economic trees in Nagi Natural Forest Reserve, Benue state was carried out to determine ..... state government decision to put them under .... 4.5. 2.44. 20.45. 11.89. Maranathes polyandra. 5. 5.95. 12.5. 2.5. 0.71. 5.95. 4.80.
The Role of Moral Emotions in the Development of Children's Sharing Behavior
Ongley, Sophia F.; Malti, Tina
2014-01-01
This study investigated the role of moral emotions in the development of children's sharing behavior (N = 244 4-, 8-, and 12-year-old children). Children's sympathy was measured with both self- and primary caregiver-reports, and participants anticipated their negatively and positively valenced moral emotions (i.e., feeling guilty, sad, or bad; and…
Kombinace dvojlomných materiálů pro achromatické fázové destičky
Czech Academy of Sciences Publication Activity Database
Melich, Radek
2011-01-01
Roč. 56, č. 9 (2011), s. 242-244 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) ED2.1.00/03.0079 Institutional research plan: CEZ:AV0Z20430508 Keywords : Phasic wafers * achromatic wafers * birefringent materials Subject RIV: BH - Optics, Masers, Lasers
Duque, Diana L.
The Computer-Based Junior High/Intermediate School Program of Transitional Bilingual Education was a federally funded program in its third year of operation in one intermediate school and two junior high schools in Manhattan (New York) in 1992-93. During this period, it served 244 native Spanish-speaking, limited-English-proficient (LEP) students…
Variation in Raven's Progressive Matrices Scores across Time and Place
Brouwers, Symen A.; Van de Vijver, Fons J. R.; Van Hemert, Dianne A.
2009-01-01
The paper describes a cross-cultural and historical meta-analysis of Raven's Progressive Matrices. Data were analyzed of 798 samples from 45 countries (N = 244,316), which were published between 1944 and 2003. Country-level indicators of educational permeation (which involves a broad set of interrelated educational input and output factors that…
Mathematical Fuzzy Logic - State of Art 2001
Czech Academy of Sciences Publication Activity Database
Hájek, Petr
2003-01-01
Roč. 24, - (2003), s. 71-89 ISSN 0103-9059. [WOLLIC'2001. Brasília, 31.07.2001-03.08.2001] R&D Projects: GA MŠk LN00A056 Keywords : fuzzy logic * many valued logic * basic fuzzy logic BL Subject RIV: BA - General Mathematics http://www.mat.unb.br/~matcont/24_4.pdf
Children's Moral Self-Concept: The Role of Aggression and Parent-Child Relationships
Sengsavang, Sonia; Krettenauer, Tobias
2015-01-01
This study examined the role of aggressiveness and parenting in the development of children's moral self-concept. Participants were 198 elementary school children and their parents (M = 8.65 years, SD = 2.44). Participants completed a structured moral self puppet interview and a questionnaire about their relationship to parents. Parents completed…
an ecophysiological study of the meiofauna of the swartkops estuary ...
African Journals Online (AJOL)
75% and 24,4%. It is concluded that meiofauna in these exposed sand and mud flat areas is not quantitatively important, but the qualitative importance may be .... which occurred in very low numbers, the expression is: '02 = 2,9784 X 10-2 N' I ...
Dynamic Protocol Reverse Engineering: A Grammatical Inference Approach
2008-03-01
domain-specific languages”. OOPSLA ’05: Companion to the 20th annual ACM SIGPLAN conference on Object-oriented programming, systems, languages, and...Representation to k-TSS Lan- guage Models”. Computación y Sistemas , 3(4):273–244, 2000. ISSN 1405-5546. 256. Trakhtenbrot, B.A. and Y.M. Barzdin. Finite
Episodic memory for human-like agents and human-like agents for episodic memory
Czech Academy of Sciences Publication Activity Database
Brom, C.; Lukavský, Jiří; Kadlec, R.
2010-01-01
Roč. 2, č. 2 (2010), s. 227-244 ISSN 1793-8473 Institutional research plan: CEZ:AV0Z70250504 Keywords : episodic memory * virtual agent * modelling Subject RIV: AN - Psychology http://www.worldscinet.com/ijmc/02/0202/S1793843010000461.html
Czech Academy of Sciences Publication Activity Database
Opluštil, S.; Šimůnek, Z.; Pšenička, J.; Bek, Jiří; Libertín, M.
2017-01-01
Roč. 244, SEP 2017 (2017), s. 241-307 ISSN 0034-6667 R&D Projects: GA ČR GAP210/12/2053 Institutional support: RVO:67985831 Keywords : Early Permian * floral zonation * Intra-Sudetic Basin * Pennsylvanian * plant diversity * plant taphonomy * vegetation patterns Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.817, year: 2016
Influence of behaviour and risk factors on motor performance in preterm infants at age 2 to 3 years.
Janssen, A.J.M.; Nijhuis-Van der Sanden, M.W.G.; Akkermans, R.P.; Oostendorp, R.A.B.; Kollee, L.A.A.
2008-01-01
The aim of this cross-sectional study was to determine the influence of test-taking behaviour and risk factors for delayed motor performance in 437 preterm infants (244 males, 193 females; < or = 32 weeks of gestation) at the corrected age of 2 to 3 years (mean 29mo [SD 3.3]). Other mean (SD) sample
effect of the whistle watch device on bronchodilator use in children ...
African Journals Online (AJOL)
The patients acted as their own controls, switching over to the other ... relatively expensive (present cost approximately R90 - R200),' and are not ... failed to comply with the study instructions after two attempts ... standard deviation (SD) ± 2.44).
Czech Academy of Sciences Publication Activity Database
Charifi, Z.; Baaziz, H.; Reshak, Ali H
2007-01-01
Roč. 244, č. 9 (2007), s. 3154-3167 ISSN 0370-1972 Institutional research plan: CEZ:AV0Z60870520 Keywords : TRANSITION-METAL DICHALCOGENIDES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.071, year: 2007
Influence of the morphology of organic heterojunction on the photovoltaic cell performance
Czech Academy of Sciences Publication Activity Database
Podhájecká, Klára; Pfleger, Jiří
2006-01-01
Roč. 36, č. 3 (2006), s. 241-244 ISSN 1286-0042 R&D Projects: GA ČR GP203/06/P226; GA AV ČR IAA4050406 Institutional research plan: CEZ:AV0Z40500505 Keywords : photovoltaic cell * heterojunction * morphology Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.938, year: 2006
Improving index mutual fund risk perception : Increase financial literacy or communicate better?
de Goeij, Peter; Van Campenhout, Geert; Subotic, Marjana
2017-01-01
We investigate the effect of financial literacy and index mutual fund risk disclosure format on investors’ risk perception by examining the risk disclosure part in the Key Investor Information Document (KIID) for UCITS funds in Europe. Using an experimental survey administered to 244 university
Facial Symmetry in Robust Anthropometrics
Czech Academy of Sciences Publication Activity Database
Kalina, Jan
2012-01-01
Roč. 57, č. 3 (2012), s. 691-698 ISSN 0022-1198 R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : forensic science * anthropology * robust image analysis * correlation analysis * multivariate data * classification Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.244, year: 2012
Lipschitz images of Haar null sets
Czech Academy of Sciences Publication Activity Database
Matoušková, Eva
2000-01-01
Roč. 32, č. 2 (2000), s. 235-244 ISSN 0024-6093 R&D Projects: GA AV ČR IAA1019705 Institutional research plan: CEZ:AV0Z1019905; CEZ:A05/98:Z1-019-9ii Subject RIV: BA - General Mathematics Impact factor: 0.403, year: 2000
Conducting swift heavy ion track networks
Czech Academy of Sciences Publication Activity Database
Fink, Dietmar; Kiv, A.; Fuks, D.; Vacík, Jiří; Hnatowicz, Vladimír; Chandra, A.; Saad, A.
2010-01-01
Roč. 165, č. 3 (2010), s. 227-244 ISSN 1042-0150 R&D Projects: GA AV ČR(CZ) KAN400480701 Institutional research plan: CEZ:AV0Z10480505 Keywords : ion tracks * negative differential resistance * neural networks Subject RIV: JJ - Other Materials Impact factor: 0.660, year: 2010
Tuberculosis and HIV/AIDS dual infection: A Case study for ...
African Journals Online (AJOL)
A total of 479 (99%) cases had their HIV test results recorded. The HIV positive cases were 244 (51%). Dual infection: The proportion of TB cases also having HIV/AIDS infection was 51%. The cure rate of smear positive, HIV positive cases was 71%; the cure rate of smear positive, HIV negative case was 85%.The mortality ...
Czech Academy of Sciences Publication Activity Database
Tarkowská, Danuše; Strnad, Miroslav
2016-01-01
Roč. 244, č. 3 (2016), s. 545-555 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Phytoecdysteroids * Ecdysteroids * 20-Hydroxyecdysone Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.361, year: 2016
Kassam, H; Tzortziou Brown, V; O'Halloran, P; Wheeler, P; Fairclough, J; Maffulli, N; Morrissey, D
2014-12-01
Sport and exercise medicine (SEM) aims to manage sporting injuries and promote physical activity. This study explores general practitioners' (GPs) awareness, understanding and utilisation of their local SEM services. A questionnaire survey, including patient case scenarios, was administered between February and May 2011. 693 GPs working in Cardiff and Vale, Leicester and Tower Hamlets were invited to participate. 244 GPs responded to the questionnaire (35.2% response rate). Less than half (46%; 112/244) were aware of their nearest SEM service and only 38% (92/244) had a clear understanding on referral indications. The majority (82%; 199/244) felt confident advising less active patients about exercise. There were divergent management opinions about the case scenarios of patients who were SEM referral candidates. Overall, GPs were significantly more likely to refer younger patients and patients with sport-related problems rather than patients who would benefit from increasing their activity levels in order to prevent or manage chronic conditions (pHealth Service which may be resulting in suboptimal utilisation especially for patients who could benefit from increasing their activity levels. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Air & Space Power Journal. Volume 27, Number 1, January-February 2013
2013-02-01
aspects of daily life.” This was to be achieved by utilizing contemporary media, including newspapers, journals, radio, television and films .25 Given...Washington, DC 20036-3011, 2009, 244 pages, $16.00 (softcover), ISBN 978-1-60127-033-7. A particular genre of military guides related to low intensity
High velocity missile injuries of the liver | Ogwang | East and Central ...
African Journals Online (AJOL)
Fourteen patients sustained gun shot wounds while one was injured by a bomb blast fragment. Ages ranged from 2 to 33 years (mean 24.4 years). Two patients sustained liver injury alone while the rest had other associated visceral injuries as well. Grade I, II and III liver injuries were seen in 7, 5 and 2 patients respectively.
The effect of single and repeated UVB
Czech Academy of Sciences Publication Activity Database
Fris, M.; Tessem, M. B.; Čejková, Jitka; Midelfart, A.
2006-01-01
Roč. 244, - (2006), s. 1680-1687 ISSN 0721-832X R&D Projects: GA ČR GA304/03/0419 Institutional research plan: CEZ:AV0Z50390512 Keywords : Cataracts * Nuclear magnetic resonance * Lens opacity Subject RIV: FF - HEENT, Dentistry Impact factor: 1.609, year: 2006
photodegradation and hydrol photodegradation and hydroly
African Journals Online (AJOL)
eobe
Hazardous Materials 244–245 (0), 111-120 (2013). [3] S. M. Chernyak, C. P. Rice and L. L.. Mcconnell,"Evidence of Currently-Used Pesticides in Air, Ice, Fog, Seawater and Surface Microlayer in the Bering and Chukchi Seas": Marine Pollution. Bulletin 32 (5), 410-419 (1996). [4] M. H. Hermanson, E. H. Isaksson, C. Teixeira ...
Czech Academy of Sciences Publication Activity Database
Hřebíčková, Martina; Kouřilová, Sylvie
2012-01-01
Roč. 56, č. 1 (2012), s. 1-17 ISSN 0009-062X R&D Projects: GA ČR GAP407/10/2394 Institutional research plan: CEZ:AV0Z70250504 Keywords : national auto - and heterostereotypes * accuracy of national stereotypes * five-factor model of personality Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti
Czech Academy of Sciences Publication Activity Database
Ďurďovič, Martin
2014-01-01
Roč. 36, č. 3 (2014), s. 259-281 ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281
Hierarchy of Needs; Building a Path to Peace
2010-03-01
observations of man’s cruelty and viciousness during multiple, devastating wars, yet still focuses on the healthy individual. Self interest, whether it is...8,27,31,35-36. 26 Ibid., 35-36, 191. 27 Ibid., 39-40. 23 28 Ibid., 244-245. 29Robert Wright, The Moral Animal ; The New Science of Evolutionary
First ever production of a transactinide element in Switzerland
Energy Technology Data Exchange (ETDEWEB)
Jost, D.T.; Dressler, R.; Eichler, B.; Piguet, D.; Tuerler, A.; Gaeggeler, H.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Thoerle, P.; Trautmann, N.; Zauner, S. [Mainz Univ. (Germany)
1997-09-01
The transactinide element {sup 261}Rf was produced for the first time at the PSI Phillips cyclotron in the reaction {sup 244}Pu({sup 22}Ne,5n). At bombarding energy of 116 MeV the production cross section was 3 nb. (author) 2 figs., 1 tab., 1 ref.
1999-04-01
as the only moving parts and no environmentally unfriendly gases . Thermoelectric generators can also improve fuel efficiency by using the heat lost...Facolta di Chimica Industriale di Bologna, 24[4] (1966) 113-132. 11 — i at £ 73 U « ■ 2-Theta (deg) Figure 1. Calibration plot for SRM1976
49 CFR 173.476 - Approval of special form Class 7 (radioactive) materials.
2010-10-01
... (radioactive) materials must maintain on file for at least one year after the latest shipment, and provide to... evidence based on calculative methods to show that the material is able to pass the tests; or other... shipping papers as “Radioactive Material, Special Form, n.o.s.” [Amdt. 173-244, 60 FR 50307, Sept. 28, 1995...
African Journals Online (AJOL)
African Journals Online (AJOL)
AJOL is a Non-Profit Organisation based in South Africa. More about AJOL and the challenges we work to address. AJOL hosts 521 Journals, including 244 Open Access Journals; The site has 13 071 Issues containing 154 212 Abstracts. There are 148 378 Full Text Articles for download, of which 91 631 are Open Access ...
Czech Academy of Sciences Publication Activity Database
Hiiesalu, Inga; Pärtel, M.; Davison, J.; Gerhold, P.; Metsis, M.; Moora, M.; Öpik, M.; Vasar, M.; Zobel, M.; Wilson, S. D.
2014-01-01
Roč. 203, č. 1 (2014), s. 233-244 ISSN 1469-8137 R&D Projects: GA MŠk EE2.3.30.0048 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : belowground plant richness * diversity * productivity Subject RIV: EH - Ecology, Behaviour Impact factor: 6.545, year: 2013
DEFF Research Database (Denmark)
Jensen, Jesper K; Bak, Søren; Flemming Høilund-Carlsen, Poul
2008-01-01
We evaluated characteristics and prevalence of ST-segment depression and/or T-wave inversion in the resting electrocardiogram of 244 consecutive patients with acute ischemic stroke, but without ischemic heart disease. The prevalence of ST-T changes ranged from 13% to 16% and this is what to expect...
The Development of Fundamental Movement Skills by Children Aged Six to Nine
Lin, Shu-Jung; Yang, Shu-Chu
2015-01-01
The main purpose of the present study is to elucidate any differences which may exist in the FMSs of children between the ages of six and nine. Purposive sampling was used to recruit a total of 485 participants (244 boys and 241 girls) in Chiayi City and Chiayi County. All of the participants were between the ages of six and nine and had no…
The South India Precambrian crust and shallow lithospheric mantle ...
Indian Academy of Sciences (India)
Regional geothermal-barometry in the granulite facies terrane of South India; Contrib. Mineral. Petrol. 73. 221–244. Raith M, Karmakar S and Brown M 1997 Ultra high temparature metamorphism and multi-stage decom- pressional of saphirrine granulite from the Palni-. Hill ranges, southern India; J. Metamorph. Geol. 15.
Vos, J.
2003-01-01
In a previous study on the annoyance caused by a great variety of shooting sounds [J. Acoust. Soc. Am. 109, 244-253 (2001)], it was shown that the annoyance, as rated indoors with the windows closed, could be adequately predicted from the outdoor A-weighted and C-weighted sound-exposure levels [ASEL
Psychologické důsledky jazykové abstraktnosti
Czech Academy of Sciences Publication Activity Database
Graf, Sylvie
2012-01-01
Roč. 56, č. 5 (2012), s. 420-434 ISSN 0009-062X R&D Projects: GA ČR GAP407/10/2394 Institutional support: RVO:68081740 Keywords : language abstractness * linguistic category model * linguistic intergroup bias * linguistic expectancy bias Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Czech Academy of Sciences Publication Activity Database
Komrsková, Daniela; Lojek, Antonín; Hrbáč, J.; Číž, Milan
2006-01-01
Roč. 21, č. 4 (2006), s. 239-244 ISSN 1522-7235 R&D Projects: GA ČR(CZ) GA524/01/1219 Institutional research plan: CEZ:AV0Z50040507 Keywords : antioxidant capacity * luminometry Subject RIV: BO - Biophysics Impact factor: 0.874, year: 2006
Czech Academy of Sciences Publication Activity Database
Květon, Petr; Jelínek, Martin; Vobořil, Dalibor; Klimusová, H.
2012-01-01
Roč. 56, č. 1 (2012), s. 31-40 ISSN 0009-062X R&D Projects: GA ČR GP406/09/P284 Institutional research plan: CEZ:AV0Z70250504 Keywords : nominal categories model * item response theory * distractor * test Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
2011-07-08
... NUCLEAR REGULATORY COMMISSION [Docket No. 50-244; Docket No. 72-67] R.E. Ginna Nuclear Power Plant, LLC, R.E. Ginna Nuclear Power Plant, R.E. Ginna Independent Spent Fuel Storage Installation; Notice of... Facility Operating License No. DPR-18, for the R.E. Ginna Nuclear Power Plant (Ginna), currently held by R...
Powdery Mildew Resistance in 268 Entries of Hordeum vulgare
DEFF Research Database (Denmark)
Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J
1984-01-01
A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...
Lynn, Richard; Vanhanen, Tatu
2012-01-01
This paper summarizes the results of 244 correlates of national IQs that have been published from 2002 through 2012 and include educational attainment, cognitive output, educational input, per capita income, economic growth, other economic variables, crime, political institutions, health, fertility, sociological variables, and geographic and…
Aerospace medicine and biology. A continuing bibliography with indexes
International Nuclear Information System (INIS)
1982-03-01
This bibliography lists 244 reports, articles, and other documents introduced into the NASA scientific and technical information system in February 1981. Aerospace medicine and aerobiology topics are included. Listings for physiological factors, astronaut performance, control theory, artificial intelligence, and cybernetics are included
Deprese z pohledu psychologie osobních konstruktů
Czech Academy of Sciences Publication Activity Database
Kovářová, Marie; Filip, Miroslav
2012-01-01
Roč. 56, č. 5 (2012), s. 435-447 ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : depression * psychology of personal constructs * psychotherapy Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012
Development of a 5kw Francis Turbine Runner Using Computation ...
African Journals Online (AJOL)
A small scale Francis turbine runner for a turbine located at Awba dam in the University of Ibadan with designed head and flow rate of 6m and 0.244m3/s is designed. The basic design of the Francis turbine runner is completed based on basic fluid dynamics turbo machinery principles. A 2-D and 3-D steady state, ...
Effect of sub-clinical mastitis on milk yield and composition of dairy ...
African Journals Online (AJOL)
protein, butter fat and chloride percentages but not on lactose content. There was a tendency for CP and chloride percentages to increase with increase in CMT scores. However, the mean chloride value obtained in this study of 0.244 was higher than expected. Further, mastitis significantly reduced BF content of milk from ...
Solar heating for an electronics manufacturing plant--Blue Earth, Minnesota
1981-01-01
Partial space heating for 97,000 square foot plant is supplied by 360 flat plate solar collectors; energy is sorted as heat in indoor 20,000 gallon water tank. System includes all necessary control electronics for year round operation. During December 1978, solar energy supplied 24.4 percent of building's space heating load.
76 FR 58047 - Notice of Intent to Grant Exclusive License
2011-09-19
... Code AL; Phone (281) 244-7148; Fax (281) 483-6936. Information about other NASA inventions available... States to practice the inventions described and claimed in US Patent Application Serial Number 12/757,657... patent rights in this invention have been assigned to the United States of America as represented by the...
77 FR 43867 - Notice of Intent To Grant Partially Exclusive License
2012-07-26
...; Phone (281)244-7148; Fax (281) 483-6936. Information about other NASA inventions available for licensing... United States to practice the invention described and claimed in U.S. Patent Nos. 7,295,884 entitled... rights in these inventions have been assigned to the United States of America as represented by the...
Schaap-Jonker, Hanneke; Eurelings-Bonekoe, Elisabeth E.M.; Jonker, Evert R.; Zock, Hetty
2008-01-01
This article presents the Dutch Questionnaire God Image (QGI), which has two theory-based dimensions: feelings towards God and perceptions of God’s actions. This instrument was validated among a sample of 804 respondents, of which 244 persons received psychotherapy. Results showed relationships
Czech Academy of Sciences Publication Activity Database
Mareš, Pavel
2010-01-01
Roč. 92, 2-3 (2010), s. 244-248 ISSN 0920-1211 R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : zonisamide * pentylenetetrazol * ontogeny Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.302, year: 2010
Orofacial cleft risk is increased with maternal smoking and specific detoxification-gene variants
DEFF Research Database (Denmark)
Shi, Min; Christensen, Kaare; Weinberg, Clarice R
2007-01-01
Maternal smoking is a recognized risk factor for orofacial clefts. Maternal or fetal pharmacogenetic variants are plausible modulators of this risk. In this work, we studied 5,427 DNA samples, including 1,244 from subjects in Denmark and Iowa with facial clefting and 4,183 from parents, siblings,...
Link Maps and Map Meetings: Scaffolding Student Learning
Lindstrom, Christine; Sharma, Manjula D.
2009-01-01
With student numbers decreasing and traditional teaching methods having been found inefficient, it is widely accepted that alternative teaching methods need to be explored in tertiary physics education. In 2006 a different teaching environment was offered to 244 first year students with little or no prior formal instruction in physics. Students…
Delimitation of cryptic species inside Claviceps purpurea
Czech Academy of Sciences Publication Activity Database
Pažoutová, Sylvie; Pešicová, Kamila; Chudíčková, Milada; Šrůtka, P.; Kolařík, Miroslav
2015-01-01
Roč. 119, č. 1 (2015), s. 7-26 ISSN 1878-6146 R&D Projects: GA ČR(CZ) GA13-00788S Institutional support: RVO:61388971 Keywords : C. arundinis * C. humidiphila * C. microcephala Subject RIV: EE - Microbiology, Virology Impact factor: 2.244, year: 2015
UAV-Based Optical Granulometry as Tool for Detecting Changes in Structure of Flood Depositions
Czech Academy of Sciences Publication Activity Database
Langhammer, J.; Lendzioch, T.; Miřijovský, J.; Hartvich, Filip
2017-01-01
Roč. 9, č. 3 (2017), č. článku UNSP 240. ISSN 2072-4292 Institutional support: RVO:67985891 Keywords : granulometry * UAV * photogrammetry * fluvial geomorphology * alluvial sediment Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Physical geography Impact factor: 3.244, year: 2016
Big Rock Point Nuclear Plant. Annual operating report for 1976
International Nuclear Information System (INIS)
1977-01-01
Net electrical power generated was 244,492.9 MWH with the reactor on line 4,405 hrs. Information is presented concerning operations, power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, release of radioactive materials, reportable occurrences, and fuel performance
CW frequency doubling of 1029 nm radiation using single pass bulk and waveguide PPLN crystals
Czech Academy of Sciences Publication Activity Database
Chiodo, N.; Du Burck, F.; Hrabina, Jan; Candela, Y.; Wallerand, J. P.; Acef, O.
2013-01-01
Roč. 311, 15 January (2013), s. 239-244 ISSN 0030-4018 R&D Projects: GA ČR GPP102/11/P820 Institutional support: RVO:68081731 Keywords : IR laser * second harmonic generation * waveguide and bulk crystals * periodically poled lithium niobate * 1029 nm wavelength Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.542, year: 2013
355-nm hypersensitization of optical fibers
Canagasabey, A.; Canning, J.; Groothoff, N.
2003-01-01
A study is presented on 355-nm hypersensitization of optical fibers. It is found that the intrinsic 244-nm photosensitivity of boron-codoped germanosilicate optical fibers is enhanced by 355-nm hypersensitization. Hypersensitization through standard polymer coating is also demonstrated.
2012-04-17
.... Chirikof (620) 0.0031 7,282 23 Kodiak (630) 0.0002 8,986 2 Annual WYK (640) 0.0000 3,244 0 SEO (650) 0.0000... 293 0 Demersal shelf rockfish Annual SEO 0.0000 293 0 Thornyhead rockfish Annual W 0.0047 150 1 C 0...
Chiral smectogens with four-phenyl-ring molecular core, laterally substituted by iodine atom
Czech Academy of Sciences Publication Activity Database
Podoliak, Natalia; Novotná, Vladimíra; Kašpar, Miroslav; Hamplová, Věra; Pacherová, Oliva
2015-01-01
Roč. 42, č. 3 (2015), s. 404-411 ISSN 0267-8292 R&D Projects: GA ČR GA13-14133S; GA MŠk(CZ) LD14007 Institutional support: RVO:68378271 Keywords : liquid crystals * iodine lateral substitution * lactic acid unit * ferroelectric phase Subject RIV: JJ - Other Materials Impact factor: 2.244, year: 2015
Morin, Alexandre J. S.; Arens, A. Katrin; Tracey, Danielle; Parker, Philip D.; Ciarrochi, Joseph; Craven, Rhonda G.; Maïano, Christophe
2017-01-01
This study examines the development of self-esteem in a sample of 138 Australian adolescents (90 males; 48 females) with cognitive abilities in the lowest 15% (L-CA) and a matched sample of 556 Australian adolescents (312 males; 244 females) with average to high levels of cognitive abilities (A/H-CA). These participants were measured annually…
Self induced gratings in ternary SiO2:SnO2:Na2O bulk glasses by UV light seeding.
Lancry, M; Douay, M; Niay, P; Beclin, F; Menke, Y; Milanese, D; Ferraris, M; Poumellec, B
2005-09-05
The diffraction efficiency of gratings written in ternary SnO2:SiO2:Na2O bulk glasses rises dramatically with time after the occultation of the cw 244nm light used to write the thick hologram. This self-induced behavior lasts for several hours and ultimately leads to refractive index changes as high as 3 10-3.
Strong overtones and combination bands in ultraviolet resonance Raman spectroscopy
Efremov, E.V.; Ariese, F.; Mank, A.J.G.; Gooijer, C.
2006-01-01
Ultraviolet resonance Raman spectroscopy is carried out using a continuous wave frequency-doubled argon ion laser operated at 229, 244, and 257 nm in order to characterize the overtones and combination bands for several classes of organic compounds in liquid solutions. Contrary to what is generally
Site summaries | | African Crop Science Journal
African Journals Online (AJOL)
(African Crop Science Journal 1999 7(3) Special Issue: Monograph on geographic shifts in highland cooking banana (Musa, group AAA-EA) production in Uganda: 244-297). AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...
Enfermedades infecciosas y migración. Una responsabilidad compartida.
Directory of Open Access Journals (Sweden)
María Elvira Balcells
2017-09-01
Full Text Available En la actualidad, se estima que más de 244 millones de personas viven fuera de sus países de origen ya sea por conflictos políticos, pobreza, búsqueda de nuevas oportunidades laborales o en educación, la mayoría de los cuales se mueve intrarregionalmente.
DEFF Research Database (Denmark)
Lund, A.B. Kiholm; Hove, H.D.; Kirchhoff, M.
2008-01-01
A 15q24 microduplication, reciprocal to the minimal critical region for the recently described 15q24 microdeletion syndrome, was found in a 2-year-old boy by 244k Agilent oligoarray CGH analysis. The boy had global developmental delay and dysmorphic facial features, digital and genital abnormalit...
What Contributes to First-Year Student Teachers' Sense of Professional Agency in the Classroom?
Soini, Tiina; Pietarinen, Janne; Toom, Auli; Pyhältö, Kirsi
2015-01-01
This study explores Finnish first-year primary teacher students' (N = 244) sense of professional agency in the classroom. In addition, the interrelation between student teachers' sense of professional agency and the perceptions of teacher education as a learning environment is explored. The sense of professional agency in the classroom…
ISSN 2073-9990 East Cent. Afr. J. s 9990 East Cent. Afr. J. s
African Journals Online (AJOL)
Prof Kakande
COSECSA/ASEA Publication -East and Central African Journal of Surgery. .... Only the manner of skin closure varied. ... Table 1. Wound Closure Time. Mean wound closure time in group A was 244+8.20 seconds whereas mean wound ... They have been used on skin, bone, cartilage graft, and middle ear surgery, repair of.
Update on alternative occupant volume testing
2010-04-27
This paper describes the conduct of the first of a series of quasi-static compression tests of rail passenger equipment being done to examine occupant volume strength. Budd Pioneer car 244 has been chosen as the test article for examination of altern...