The 25th European Conference on Information Systems (ECIS 2017

Directory of Open Access Journals (Sweden)

Michal Doležel

2017-12-01

Full Text Available This short note reports on my experience from The 25th European Conference on Information Systems (ECIS. The conference was titled “Information Systems for a smart, sustainable and inclusive world“, and took place in Guimarães, Portugal in June 2017. I discuss the thematic focus of the conference and its scope. Then I refer about two workshops I attended during the conference.

Coupling of channel thermalhydraulics and fuel behaviour in ACR-1000 safety analyses

International Nuclear Information System (INIS)

Huang, F.L.; Lei, Q.M.; Zhu, W.; Bilanovic, Z.

2008-01-01

Channel thermalhydraulics and fuel thermal-mechanical behaviour are interlinked. This paper describes a channel thermalhydraulics and fuel behaviour coupling methodology that has been used in ACR-1000 safety analyses. The coupling is done for all 12 fuel bundles in a fuel channel using the channel thermalhydraulics code CATHENA MOD-3.5d/Rev 2 and the transient fuel behaviour code ELOCA 2.2. The coupling approach can be used for every fuel element or every group of fuel elements in the channel. Test cases are presented where a total of 108 fuel element models are set up to allow a full coupling between channel thermalhydraulics and detailed fuel analysis for a channel containing a string of 12 fuel bundles. An additional advantage of this coupling approach is that there is no need for a separate detailed fuel analysis because the coupling analysis, once done, provides detailed calculations for the fuel channel (fuel bundles, pressure tube, and calandria tube) as well as all the fuel elements (or element groups) in the channel. (author)

Techniques for heavy-ion coupled-channels calculations. I. Long-range Coulomb coupling

International Nuclear Information System (INIS)

Rhoades-Brown, M.; Macfarlane, M.H.; Pieper, S.C.

1980-01-01

Direct-reaction calculations for heavy ions require special computational techniques that take advantage of the physical peculiarities of heavy-ion systems. This paper is the first of a series on quantum-mechanical coupled-channels calculations for heavy ions. It deals with the problems posed by the long range of the Coulomb coupling interaction. Our approach is to use the Alder-Pauli factorization whereby the channel wave functions are expressed as products of Coulomb functions and modulating amplitudes. The equations for the modulating amplitudes are used to integrate inwards from infinity to a nuclear matching radius ( approx. = 20 fm). To adequate accuracy, the equations for the amplitudes can be reduced to first order and solved in first Born approximation. The use of the Born approximation leads to rapid recursion relations for the solutions of the Alder-Pauli equations and hence to a great reduction in computational labor. The resulting coupled-channels Coulomb functions can then be matched in the usual way to solutions of the coupled radial equations in the interior region of r space. Numerical studies demonstrate the reliability of the various techniques introduced

Commercial Off-the-Shelf (COTS) Components and Enterprise Component Information System (eCIS)

Energy Technology Data Exchange (ETDEWEB)

John Minihan; Ed Schmidt; Greg Enserro; Melissa Thompson

2008-06-30

The purpose of the project was to develop the processes for using commercial off-the-shelf (COTS) parts for WR production and to put in place a system for implementing the data management tools required to disseminate, store, track procurement, and qualify vendors. Much of the effort was devoted to determining if the use of COTS parts was possible. A basic question: How does the Nuclear Weapons Complex (NWC) begin to use COTS in the weapon Stockpile Life Extension Programs with high reliability, affordability, while managing risk at acceptable levels? In FY00, it was determined that a certain weapon refurbishment program could not be accomplished without the use of COTS components. The elements driving the use of COTS components included decreased cost, greater availability, and shorter delivery time. Key factors that required implementation included identifying the best suppliers and components, defining life cycles and predictions of obsolescence, testing the feasibility of using COTS components with a test contractor to ensure capability, as well as quality and reliability, and implementing the data management tools required to disseminate, store, track procurement, and qualify vendors. The primary effort of this project then was to concentrate on the risks involved in the use of COTS and address the issues of part and vendor selection, procurement and acceptance processes, and qualification of the parts via part and sample testing. The Enterprise Component Information System (eCIS) was used to manage the information generated by the COTS process. eCIS is a common interface for both the design and production of NWC components and systems integrating information between SNL National Laboratory (SNL) and the Kansas City Plant (KCP). The implementation of COTS components utilizes eCIS from part selection through qualification release. All part related data is linked across an unclassified network for access by both SNL and KCP personnel. The system includes not

Coupled-channel analysis for phi photoproduction with Lambda

NARCIS (Netherlands)

Ozaki, S.; Hosaka, A.; Nagahiro, H.; Scholten, O.

We investigate photoproduction of phi mesons off protons within a coupled-channel effective-Lagrangian method which is based on the K-matrix approach. Since the threshold energy of the K Lambda(1520) channel is close to that of phi N, the contribution of this channel to f photoproduction near the

75 FR 38179 - Proposed Collection; Comment Request for Forms W-8BEN, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2010-07-01

... W-8BEN, W-8ECI, W- 8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice... soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8ECI, Certificate of Foreign Person's Claim for Exemption From Withholding...

Analysis of neutron cross sections using the coupled-channel theory

International Nuclear Information System (INIS)

Tanaka, Shigeya

1975-01-01

Fast neutron total and scattering cross sections calculated with the coupled-channel theory and the spherical optical model are compared with experimental data. The optical-potential parameters used in both the calculations were obtained from comparison of calculations with scattering data for 209 Bi. The calculations for total cross sections were made for thirty-five nuclides from 23 Na to 239 Pu in the energy range of 0.25 to 15 MeV, and good results were obtained with the coupled-channel calculations. The comparisons of the calculations with the elastic data for about twenty nuclides were made at incident energies of 8 and 14 MeV. In general, the coupled-channel calculations at 8 MeV have given better agreements with the experimental data than the spherical optical-model calculations. At 14 MeV, differences between both the calculations were small. The analysis was also made for the elastic and inelastic scattering by several nuclei such as Fe, Ni, 120 Sn, Pu in the low energy region, and good results have been given by the coupled-channel calculations. Thus, it is demonstrated that the coupled-channel calculations with one set of the optical parameters well reproduce the total and scattering cross sections over a wide energy and mass region. (auth.)

Single- and coupled-channel radial inverse scattering with supersymmetric transformations

International Nuclear Information System (INIS)

Baye, Daniel; Sparenberg, Jean-Marc; Pupasov-Maksimov, Andrey M; Samsonov, Boris F

2014-01-01

The present status of the three-dimensional inverse-scattering method with supersymmetric transformations is reviewed for the coupled-channel case. We first revisit in a pedagogical way the single-channel case, where the supersymmetric approach is shown to provide a complete, efficient and elegant solution to the inverse-scattering problem for the radial Schrödinger equation with short-range interactions. A special emphasis is put on the differences between conservative and non-conservative transformations, i.e. transformations that do or do not conserve the behaviour of solutions of the radial Schrödinger equation at the origin. In particular, we show that for the zero initial potential, a non-conservative transformation is always equivalent to a pair of conservative transformations. These single-channel results are illustrated on the inversion of the neutron–proton triplet eigenphase shifts for the S- and D-waves. We then summarize and extend our previous works on the coupled-channel case, i.e. on systems of coupled radial Schrödinger equations, and stress remaining difficulties and open questions of this problem by putting it in perspective with the single-channel case. We mostly concentrate on two-channel examples to illustrate general principles while keeping mathematics as simple as possible. In particular, we discuss the important difference between the equal-threshold and different-threshold problems. For equal thresholds, conservative transformations can provide non-diagonal Jost and scattering matrices. Iterations of such transformations in the two-channel case are studied and shown to lead to practical algorithms for inversion. A convenient particular technique where the mixing parameter can be fitted without modifying the eigenphases is developed with iterations of pairs of conjugate transformations. This technique is applied to the neutron–proton triplet S–D scattering matrix, for which exactly-solvable matrix potential models are constructed

Channel coupling in heavy quarkonia: Energy levels, mixing, widths, and new states

International Nuclear Information System (INIS)

Danilkin, I. V.; Simonov, Yu. A.

2010-01-01

The mechanism of channel coupling via decay products is used to study energy shifts, level mixing as well as the possibility of new near-threshold resonances in cc, bb systems. The Weinberg eigenvalue method is formulated in the multichannel problems, which allows one to describe coupled-channel resonances and wave functions in a unitary way, and to predict new states due to channel coupling. Realistic wave functions for all single-channel states and decay matrix elements computed earlier are exploited, and no new fitting parameters are involved. Examples of level shifts, widths, and mixings are presented; the dynamical origin of X(3872) and the destiny of the single-channel 2 3 P 1 (cc) state are clarified. As a result a sharp and narrow peak in the state with quantum numbers J PC =1 ++ is found at 3.872 GeV, while the single-channel resonance originally around 3.940 GeV becomes increasingly broad and disappears with growing coupling to open channels.

Coupled channels Marchenko inversion for nucleon-nucleon potentials

International Nuclear Information System (INIS)

Kohlhoff, H.; Geramb, H.V. von

1994-01-01

Marchenko inversion is used to determine local energy independent but channel dependent potential matrices from optimum sets of experimental phase shifts. 3 SD 1 and 3 PF 2 channels of nucleon-nucleon systems contain in their off-diagonal potential matrices explicitly the tensor force for T = 0 and 1 isospin. We obtain, together with single channels, complete sets of quantitative nucleon-nucleon potential results which are ready for application in nuclear structure and reaction analyses. The historic coupled channels inversion result of Newton and Fulton is revisited. (orig.)

K Lambda and K Sigma photoproduction in a coupled-channels framework

NARCIS (Netherlands)

Usov, A; Scholten, O

A coupled-channels analysis, based on the K-matrix approach, is presented for photo-induced kaon production. It is shown that channel coupling effects are large and should not be ignored. The importance of contact terms in the analysis, associated with short-range correlations, is pointed out. The

Coupled-channels analyses for 9,11Li + 208Pb fusion reactions with multi-neutron transfer couplings

Science.gov (United States)

Choi, Ki-Seok; Cheoun, Myung-Ki; So, W. Y.; Hagino, K.; Kim, K. S.

2018-05-01

We discuss the role of two-neutron transfer processes in the fusion reaction of the 9,11Li + 208Pb systems. We first analyze the 9Li + 208Pb reaction by taking into account the coupling to the 7Li + 210Pb channel. To this end, we assume that two neutrons are directly transferred to a single effective channel in 210Pb and solve the coupled-channels equations with the two channels. By adjusting the coupling strength and the effective Q-value, we successfully reproduce the experimental fusion cross sections for this system. We then analyze the 11Li + 208Pb reaction in a similar manner, that is, by taking into account three effective channels with 11Li + 208Pb, 9Li + 210Pb, and 7Li + 212Pb partitions. In order to take into account the halo structure of the 11Li nucleus, we construct the potential between 11Li and 208Pb with a double folding procedure, while we employ a Woods-Saxon type potential with the global Akyüz-Winther parameters for the other channels. Our calculation indicates that the multiple two-neutron transfer process plays a crucial role in the 11Li + 208Pb fusion reaction at energies around the Coulomb barrier.

Couple stress fluid flow in a rotating channel with peristalsis

Science.gov (United States)

Abd elmaboud, Y.; Abdelsalam, Sara I.; Mekheimer, Kh. S.

2018-04-01

This article describes a new model for obtaining closed-form semi-analytical solutions of peristaltic flow induced by sinusoidal wave trains propagating with constant speed on the walls of a two-dimensional rotating infinite channel. The channel rotates with a constant angular speed about the z - axis and is filled with couple stress fluid. The governing equations of the channel deformation and the flow rate inside the channel are derived using the lubrication theory approach. The resulting equations are solved, using the homotopy perturbation method (HPM), for exact solutions to the longitudinal velocity distribution, pressure gradient, flow rate due to secondary velocity, and pressure rise per wavelength. The effect of various values of physical parameters, such as, Taylor's number and couple stress parameter, together with some interesting features of peristaltic flow are discussed through graphs. The trapping phenomenon is investigated for different values of parameters under consideration. It is shown that Taylor's number and the couple stress parameter have an increasing effect on the longitudinal velocity distribution till half of the channel, on the flow rate due to secondary velocity, and on the number of closed streamlines circulating the bolus.

Coupling between scattering channels with SUSY transformations for equal thresholds

International Nuclear Information System (INIS)

Pupasov, Andrey M; Samsonov, Boris F; Sparenberg, Jean-Marc; Baye, Daniel

2009-01-01

Supersymmetric (SUSY) transformations of the multichannel Schroedinger equation with equal thresholds and arbitrary partial waves in all channels are studied. The structures of the transformation function and the superpotential are analysed. Relations between Jost and scattering matrices of superpartner potentials are obtained. In particular, we show that a special type of SUSY transformation allows us to introduce a coupling between scattering channels starting from a potential with an uncoupled scattering matrix. The possibility for this coupling to be trivial is discussed. We show that the transformation introduces bound and virtual states with a definite degeneracy at the factorization energy. A detailed study of the potential and scattering matrices is given for the 2 x 2 case. The possibility of inverting coupled-channel scattering data by such a SUSY transformation is demonstrated by several examples (s-s, s-p and s-d partial waves)

Continuum level density of a coupled-channel system in the complex scaling method

International Nuclear Information System (INIS)

Suzuki, Ryusuke; Kato, Kiyoshi; Kruppa, Andras; Giraud, Bertrand G.

2008-01-01

We study the continuum level density (CLD) in the formalism of the complex scaling method (CSM) for coupled-channel systems. We apply the formalism to the 4 He=[ 3 H+p]+[ 3 He+n] coupled-channel cluster model where there are resonances at low energy. Numerical calculations of the CLD in the CSM with a finite number of L 2 basis functions are consistent with the exact result calculated from the S-matrix by solving coupled-channel equations. We also study channel densities. In this framework, the extended completeness relation (ECR) plays an important role. (author)

Total and Compound Formation Cross Sections for Americium Nuclei: Recommendations for Coupled-Channels Calculations

Energy Technology Data Exchange (ETDEWEB)

Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-04-11

Calculations for total cross sections and compound-nucleus (CN) formation cross sections for americium isotopes are described, for use in the 2017 NA-22 evaluation effort. The code ECIS 2006 was used in conjunction with Frank Dietrich's wrapper `runtemplate'.

Optimization of Training Signal Transmission for Estimating MIMO Channel under Antenna Mutual Coupling Conditions

Directory of Open Access Journals (Sweden)

Xia Liu

2010-01-01

Full Text Available This paper reports investigations on the effect of antenna mutual coupling on performance of training-based Multiple-Input Multiple-Output (MIMO channel estimation. The influence of mutual coupling is assessed for two training-based channel estimation methods, Scaled Least Square (SLS and Minimum Mean Square Error (MMSE. It is shown that the accuracy of MIMO channel estimation is governed by the sum of eigenvalues of channel correlation matrix which in turn is influenced by the mutual coupling in transmitting and receiving array antennas. A water-filling-based procedure is proposed to optimize the training signal transmission to minimize the MIMO channel estimation errors.

PIP2 mediates functional coupling and pharmacology of neuronal KCNQ channels

DEFF Research Database (Denmark)

Kim, Robin Y; Pless, Stephan A; Kurata, Harley T

2017-01-01

Retigabine (RTG) is a first-in-class antiepileptic drug that suppresses neuronal excitability through the activation of voltage-gated KCNQ2-5 potassium channels. Retigabine binds to the pore-forming domain, causing a hyperpolarizing shift in the voltage dependence of channel activation. To elucid......Retigabine (RTG) is a first-in-class antiepileptic drug that suppresses neuronal excitability through the activation of voltage-gated KCNQ2-5 potassium channels. Retigabine binds to the pore-forming domain, causing a hyperpolarizing shift in the voltage dependence of channel activation....... These findings reveal an important role for PIP2 in coupling retigabine binding to altered VSD function. We identify a polybasic motif in the proximal C terminus of retigabine-sensitive KCNQ channels that contributes to VSD-pore coupling via PIP2, and thereby influences the unique gating effects of retigabine....

Dynamical coupled channel approach to omega meson production

Energy Technology Data Exchange (ETDEWEB)

Mark Paris

2007-09-10

The dynamical coupled channel approach of Matsuyama, Sato, and Lee is used to study the $\\omega$--meson production induced by pions and photons scattering from the proton. The parameters of the model are fixed in a two-channel (\\omega N,\\pi N) calculation for the non-resonant and resonant contributions to the $T$ matrix by fitting the available unpolarized differential cross section data. The polarized photon beam asymmetry is predicted and compared to existing data.

Mechanism of electromechanical coupling in voltage-gated potassium channels

Directory of Open Access Journals (Sweden)

Rikard eBlunck

2012-09-01

Full Text Available Voltage-gated ion channels play a central role in the generation of action potentials in the nervous system. They are selective for one type of ion – sodium, calcium or potassium. Voltage-gated ion channels are composed of a central pore that allows ions to pass through the membrane and four peripheral voltage sensing domains that respond to changes in the membrane potential. Upon depolarization, voltage sensors in voltage-gated potassium channels (Kv undergo conformational changes driven by positive charges in the S4 segment and aided by pairwise electrostatic interactions with the surrounding voltage sensor. Structure-function relations of Kv channels have been investigated in detail, and the resulting models on the movement of the voltage sensors now converge to a consensus; the S4 segment undergoes a combined movement of rotation, tilt and vertical displacement in order to bring 3-4 e+ each through the electric field focused in this region. Nevertheless, the mechanism by which the voltage sensor movement leads to pore opening, the electromechanical coupling, is still not fully understood. Thus, recently, electromechanical coupling in different Kv channels has been investigated with a multitude of techniques including electrophysiology, 3D crystal structures, fluorescence spectroscopy and molecular dynamics simulations. Evidently, the S4-S5 linker, the covalent link between the voltage sensor and pore, plays a crucial role. The linker transfers the energy from the voltage sensor movement to the pore domain via an interaction with the S6 C-termini, which are pulled open during gating. In addition, other contact regions have been proposed. This review aims to provide (i an in-depth comparison of the molecular mechanisms of electromechanical coupling in different Kv channels; (ii insight as to how the voltage sensor and pore domain influence one another; and (iii theoretical predictions on the movement of the cytosolic face of the KV channels

Coupled-channel equations and off-shell transformations in many-body scattering

International Nuclear Information System (INIS)

Cattapan, G.; Vanzani, V.

1977-01-01

The general structure and the basic features of several many-body coupled-channel integral equations, obtained by means of the channel coupling array device, are studied in a systematic way. Particular attention is paid to the employment of symmetric transition operators. The connection between different formulations has been clarified and the role played by some off-shell transformations for many-body transition operators has been discussed. Specific choices of the coupling scheme are considered and the corresponding coupled equations are compared with similar equations previously derived. Several sets of linear relations between transition operators have also been presented and used in a three-body context to derive uncoupled integral equations with connected kernel

Coupled channels effects in heavy ion elastic scattering

International Nuclear Information System (INIS)

Bond, P.D.

1977-01-01

The effects of inelastic excitation on the elastic scattering of heavy ions are considered within a coupled channels framework. Both Coulomb and nuclear excitation results are applied to 18 O + 184 W and other heavy ion reactions

Coupled channels description of the α-decay fine structure

Science.gov (United States)

Delion, D. S.; Ren, Zhongzhou; Dumitrescu, A.; Ni, Dongdong

2018-05-01

We review the coupled channels approach of α transitions to excited states. The α-decaying states are identified as narrow outgoing Gamow resonances in an α-daughter potential. The real part of the eigenvalue corresponds to the Q-value, while the imaginary part determines the half of the total α-decay width. We first review the calculations describing transitions to rotational states treated by the rigid rotator model, in even–even, odd-mass and odd–odd nuclei. It is found that the semiclassical method overestimates the branching ratios to excited 4+ for some even–even α-emitters and fails in explaining the unexpected inversion of branching ratios of some odd-mass nuclei, while the coupled-channels results show good agreement with the experimental data. Then, we review the coupled channels method for α-transitions to 2+ vibrational and transitional states. We present the results of the Coherent State Model that describes in a unified way the spectra of vibrational, transitional and rotational nuclei. We evidence general features of the α-decay fine structure, namely the linear dependence between α-intensities and excitation energy, the linear correlation between the strength of the α-core interaction and spectroscopic factor, and the inverse correlation between the nuclear collectivity, given by electromagnetic transitions, and α-clustering.

Coupling of unidimensional neutron kinetics to thermal hydraulics in parallel channels

International Nuclear Information System (INIS)

Cecenas F, M.; Campos G, R.M.

2003-01-01

In this work the dynamic behavior of a consistent system in fifteen channels in parallel that represent the reactor core of a BWR type, coupled of a kinetic neutronic model in one dimension is studied by means of time series. The arrangement of channels is obtained collapsing the assemblies that it consists the core to an arrangement of channels prepared in straight lines, and it is coupled to the unidimensional solution of the neutron diffusion equation. This solution represents the radial power distribution, and initially the static solution is obtained to verify that the one modeling core is critic. The coupled set nuclear-thermal hydraulics it is solved numerically by means of a net of CPUs working in the outline teacher-slave by means of Parallel Virtual Machine (PVM), subject to the restriction that the pressure drop is equal for each channel, which is executed iterating on the refrigerant distribution. The channels are dimensioned according to the one Stability Benchmark of the Ringhals swedish plant, organized by the Nuclear Energy Agency in 1994. From the information of this benchmark it is obtained the axial power profile for each channel, which is assumed as invariant in the time. To obtain the time series, the system gets excited with white noise (sequence that statistically obeys to a normal distribution with zero media), so that the power generated in each channel it possesses the same ones characteristics of a typical signal obtained by means of the acquisition of those signals of neutron flux in a BWR reactor. (Author)

Kv7.1 ion channels require a lipid to couple voltage sensing to pore opening.

Science.gov (United States)

Zaydman, Mark A; Silva, Jonathan R; Delaloye, Kelli; Li, Yang; Liang, Hongwu; Larsson, H Peter; Shi, Jingyi; Cui, Jianmin

2013-08-06

Voltage-gated ion channels generate dynamic ionic currents that are vital to the physiological functions of many tissues. These proteins contain separate voltage-sensing domains, which detect changes in transmembrane voltage, and pore domains, which conduct ions. Coupling of voltage sensing and pore opening is critical to the channel function and has been modeled as a protein-protein interaction between the two domains. Here, we show that coupling in Kv7.1 channels requires the lipid phosphatidylinositol 4,5-bisphosphate (PIP2). We found that voltage-sensing domain activation failed to open the pore in the absence of PIP2. This result is due to loss of coupling because PIP2 was also required for pore opening to affect voltage-sensing domain activation. We identified a critical site for PIP2-dependent coupling at the interface between the voltage-sensing domain and the pore domain. This site is actually a conserved lipid-binding site among different K(+) channels, suggesting that lipids play an important role in coupling in many ion channels.

Subconductance states of mitochondrial chloride channels: implication for functionally-coupled tetramers.

Science.gov (United States)

Tomasek, Milan; Misak, Anton; Grman, Marian; Tomaskova, Zuzana

2017-08-01

Recently, it has been discovered that isoforms of intracellular chloride channels (CLIC) are present in cardiac mitochondria. By reconstituting rat cardiac mitochondrial chloride channels into bilayer lipid membranes, we detected three equally separated subconductance states with conductance increment of 45 pS and < 2% occupancy. The observed rare events of channel decomposition into substates, accompanied by disrupted gating, provide an insight into channel quaternary structure. Our findings suggest that the observed channels work as four functionally coupled subunits with synchronized gating. We discuss the putative connection of channel activity from native mitochondria with the recombinant CLIC channels. However, conclusive evidence is needed to prove this connection. © 2017 Federation of European Biochemical Societies.

Coupling of SK channels, L-type Ca2+ channels, and ryanodine receptors in cardiomyocytes.

Science.gov (United States)

Zhang, Xiao-Dong; Coulibaly, Zana A; Chen, Wei Chun; Ledford, Hannah A; Lee, Jeong Han; Sirish, Padmini; Dai, Gu; Jian, Zhong; Chuang, Frank; Brust-Mascher, Ingrid; Yamoah, Ebenezer N; Chen-Izu, Ye; Izu, Leighton T; Chiamvimonvat, Nipavan

2018-03-16

Small-conductance Ca 2+ -activated K + (SK) channels regulate the excitability of cardiomyocytes by integrating intracellular Ca 2+ and membrane potentials on a beat-to-beat basis. The inextricable interplay between activation of SK channels and Ca 2+ dynamics suggests the pathology of one begets another. Yet, the exact mechanistic underpinning for the activation of cardiac SK channels remains unaddressed. Here, we investigated the intracellular Ca 2+ microdomains necessary for SK channel activation. SK currents coupled with Ca 2+ influx via L-type Ca 2+ channels (LTCCs) continued to be elicited after application of caffeine, ryanodine or thapsigargin to deplete SR Ca 2+ store, suggesting that LTCCs provide the immediate Ca 2+ microdomain for the activation of SK channels in cardiomyocytes. Super-resolution imaging of SK2, Ca v 1.2 Ca 2+ channel, and ryanodine receptor 2 (RyR2) was performed to quantify the nearest neighbor distances (NND) and localized the three molecules within hundreds of nanometers. The distribution of NND between SK2 and RyR2 as well as SK2 and Ca v 1.2 was bimodal, suggesting a spatial relationship between the channels. The activation mechanism revealed by our study paved the way for the understanding of the roles of SK channels on the feedback mechanism to regulate the activities of LTCCs and RyR2 to influence local and global Ca 2+ signaling.

Multistage Coupling of Laser-Wakefield Accelerators with Curved Plasma Channels

Science.gov (United States)

Luo, J.; Chen, M.; Wu, W. Y.; Weng, S. M.; Sheng, Z. M.; Schroeder, C. B.; Jaroszynski, D. A.; Esarey, E.; Leemans, W. P.; Mori, W. B.; Zhang, J.

2018-04-01

Multistage coupling of laser-wakefield accelerators is essential to overcome laser energy depletion for high-energy applications such as TeV-level electron-positron colliders. Current staging schemes feed subsequent laser pulses into stages using plasma mirrors while controlling electron beam focusing with plasma lenses. Here a more compact and efficient scheme is proposed to realize the simultaneous coupling of the electron beam and the laser pulse into a second stage. A partly curved channel, integrating a straight acceleration stage with a curved transition segment, is used to guide a fresh laser pulse into a subsequent straight channel, while the electrons continue straight. This scheme benefits from a shorter coupling distance and continuous guiding of the electrons in plasma while suppressing transverse beam dispersion. Particle-in-cell simulations demonstrate that the electron beam from a previous stage can be efficiently injected into a subsequent stage for further acceleration while maintaining high capture efficiency, stability, and beam quality.

Near-Barrier Fusion of Heavy Nuclei. Coupling of the Channels

CERN Document Server

Zagrebaev, V I

2003-01-01

The problem of quantum description of near-barrier fusion of heavy nuclei taking place under strong coupling of relative motion with rotation of deformed nuclei and with dynamic deformations of their surfaces is studied in the paper. A new effective method is proposed for numerical solution of a set of coupled Schrodinger equations with boundary conditions corresponding to a full absorption of the flux penetrated through the multi-dimensional Coulomb barrier. The method has no limitation on the number of coupled channels and allows one to calculate fusion cross-sections of very heavy nuclei used for synthesis of super-heavy elements. A combined analysis of the multi-dimensional potential energy surface relief and the multi-channel wave function in the vicinity of the Coulomb barrier gives a clear interpretation of near-barrier fusion dynamics. Comparison with experimental data and with semi-empirical model calculations is performed. The computing codes are allocated at the web-server http://nrv.jinr.ru/nrv/ w...

Effects of couple stresses in MHD channel flow

International Nuclear Information System (INIS)

Soundalgekar, V.M.; Aranake, R.N.

1977-01-01

An analysis of fully developed MHD channel flow of an electrically conducting incompressible fluid, taking into account the couple stresses, is carried out. Exact solutions are derived for velocity profiles, current density, skin-friction and coefficient of mass flux. They are influenced by the magnetic field, the loading parameter k, and the non-dimensional parameter (a=b 1 /lambda). Their variations with respect to M, k and a are represented graphically, this is followed by a physical discussion. It is observed that the couple stresses are more effective in the presence of a very weak magnetic field. (Auth.)

Schematic large-dimension coupled-channel study of strong inelastic excitations to high-lying states in colliding nuclei

Energy Technology Data Exchange (ETDEWEB)

Kamimura, M. [Rijksuniversiteit Groningen (Netherlands). Kernfysisch Versneller Inst.; Nakano, M.; Yahiro, M.; Ikegami, H.; Muraoka, M. [eds.

1980-01-01

A mechanism of the strong inelastic excitation of colliding nuclei (e.g. deep inelastic heavy-ion collision) was studied in a schematic way based on a coupled channel (CC) framework. The purpose of this work is to see the gross behavior of the inelastic excitation strength versus epsilon (i.e. energy spectrum) for the assumed specific types of CC potentials between a large number of inelastic channels. Schematic large dimension CC calculation was considered rather than small-dimension CC calculation. The coupled N + 1 equations can be reduced to uncoupled N + 1 equations through the wellknown unitary transformation. An interesting case is that there exists strong channel independent coupling between any pair of the channels, all of which are almost degenerate in internal energy as compared with incoming c.m. energy. It was found that inelastic scattering hardly occurred while the collision was almost confined to the elastic component. The numerical calculation of S-matrix was carried out. Other cases, such as zero CC potential, the coupling between inelastic channel and entrance channel, and the case that the thickness of the coupling was changed, were investigated. As the results of the present study, it can be said that this CC coupling model may be useful for discussing continuum-continuum interactions in a breakup reaction by simulating the continuum states with many channels made discrete.

Tetraquark candidate Zc(3900 from coupled-channel scattering - how to extract hadronic interactions? -

Directory of Open Access Journals (Sweden)

Ikeda Yoichi

2018-01-01

On the basis of the HAL QCD method, the structure of the tetraquark candidate Zc(3900, which was experimentally reported in e+e- collisions, is studied by the s-wave two-meson coupled-channel scattering. The results show that the Zc(3900 is not a conventional resonance but a threshold cusp. A semi-phenomenological analysis with the coupled-channel interaction to the experimentally observed decay mode is also presented to confirm the conclusion.

Cross-channel coupling in positron-atom scattering

International Nuclear Information System (INIS)

McAlinden, M.T.; Kernoghan, A.A.; Walters, H.R.J.

1994-01-01

Coupled-state calculations including positronium channels are reported for positron scattering by atomic hydrogen, lithium and sodium. Integrated cross sections and total cross sections are presented for all three atoms. For lithium differential cross sections are also given. Throughout, comparison is made between results calculated with and without inclusion of the positronium channels. S-wave cross sections for positron scattering by atomic hydrogen in the Ps(1s, 2s, 2p) + H(1s, 2s, 2p) approximation show the high energy resonance first observed by Higgins and Burke in the coupled-static approximation. This resonance has now moved up to 51.05 eV and narrowed in width to 2.92 eV. Other pronounced structure is seen in the S-wave cross sections between 10 and 20 eV; it is tentatively suggested that this structure may be due to the formation of a temporary pseudo-molecular collision complex. Results calculated in the Ps(1s, 2s, anti 3 anti s, anti 4 anti s, 2p, anti 3 anti p, anti 4 anti p, anti 3 anti d, anti 4 anti d) + H(1s, 2s, anti 3 anti s, anti 4 anti s, 2p, anti 3 anti p, anti 4 anti p, anti 3 anti d, anti 4 anti d) approximation show convergence towards accurate values in the energy region below and in the Ore gap. Contrary to previous work on lithium using only an atomic basis, it is found that coupling to the 3d state of lithium is not so important when positronium channels are included; this is because a mixed basis of atom and positronium states gives a more rapidly convergent approximation than an expansion based on atom states alone. The threshold behaviour of the elastic cross section and the Ps(1s) formation cross section for lithium is investigated. Results in the Ps(1s, 2s, 2p) + Na(3s, 3p) approximation for sodium show good agreement with the total cross section measurements of Kwan et al. (orig.)

Multi-channels coupling-induced pattern transition in a tri-layer neuronal network

Science.gov (United States)

Wu, Fuqiang; Wang, Ya; Ma, Jun; Jin, Wuyin; Hobiny, Aatef

2018-03-01

Neurons in nerve system show complex electrical behaviors due to complex connection types and diversity in excitability. A tri-layer network is constructed to investigate the signal propagation and pattern formation by selecting different coupling channels between layers. Each layer is set as different states, and the local kinetics is described by Hindmarsh-Rose neuron model. By changing the number of coupling channels between layers and the state of the first layer, the collective behaviors of each layer and synchronization pattern of network are investigated. A statistical factor of synchronization on each layer is calculated. It is found that quiescent state in the second layer can be excited and disordered state in the third layer is suppressed when the first layer is controlled by a pacemaker, and the developed state is dependent on the number of coupling channels. Furthermore, the collapse in the first layer can cause breakdown of other layers in the network, and the mechanism is that disordered state in the third layer is enhanced when sampled signals from the collapsed layer can impose continuous disturbance on the next layer.

A finite range coupled channel Born approximation code

International Nuclear Information System (INIS)

Nagel, P.; Koshel, R.D.

1978-01-01

The computer code OUKID calculates differential cross sections for direct transfer nuclear reactions in which multistep processes, arising from strongly coupled inelastic states in both the target and residual nuclei, are possible. The code is designed for heavy ion reactions where full finite range and recoil effects are important. Distorted wave functions for the elastic and inelastic scattering are calculated by solving sets of coupled differential equations using a Matrix Numerov integration procedure. These wave functions are then expanded into bases of spherical Bessel functions by the plane-wave expansion method. This approach allows the six-dimensional integrals for the transition amplitude to be reduced to products of two one-dimensional integrals. Thus, the inelastic scattering is treated in a coupled channel formalism while the transfer process is treated in a finite range born approximation formalism. (Auth.)

Coupled-channel analysis for heavy-ion scattering

International Nuclear Information System (INIS)

Kim, Byung-Taik.

1978-01-01

A method is given to carry out much faster coupled-channel (CC) calculations including the Coulomb excitation. For this purpose, two approximation techniques were used, namely, the WKB approximation of Alder and Pauli, in handling the effects of Coulomb excitation, and the Pade approximation for handling the large partial wave contribution. The formulation of CC calculations based on these two approximations is briefly discussed and some results of numerical calculations are shown for 16 O scattering with 152 Sm at 72 MeV

Dynamic analysis of multiple nuclear-coupled boiling channels based on a multi-point reactor model

International Nuclear Information System (INIS)

Lee, J.D.; Pan Chin

2005-01-01

This work investigates the non-linear dynamics and stabilities of a multiple nuclear-coupled boiling channel system based on a multi-point reactor model using the Galerkin nodal approximation method. The nodal approximation method for the multiple boiling channels developed by Lee and Pan [Lee, J.D., Pan, C., 1999. Dynamics of multiple parallel boiling channel systems with forced flows. Nucl. Eng. Des. 192, 31-44] is extended to address the two-phase flow dynamics in the present study. The multi-point reactor model, modified from Uehiro et al. [Uehiro, M., Rao, Y.F., Fukuda, K., 1996. Linear stability analysis on instabilities of in-phase and out-of-phase modes in boiling water reactors. J. Nucl. Sci. Technol. 33, 628-635], is employed to study a multiple-channel system with unequal steady-state neutron density distribution. Stability maps, non-linear dynamics and effects of major parameters on the multiple nuclear-coupled boiling channel system subject to a constant total flow rate are examined. This study finds that the void-reactivity feedback and neutron interactions among subcores are coupled and their competing effects may influence the system stability under different operating conditions. For those cases with strong neutron interaction conditions, by strengthening the void-reactivity feedback, the nuclear-coupled effect on the non-linear dynamics may induce two unstable oscillation modes, the supercritical Hopf bifurcation and the subcritical Hopf bifurcation. Moreover, for those cases with weak neutron interactions, by quadrupling the void-reactivity feedback coefficient, period-doubling and complex chaotic oscillations may appear in a three-channel system under some specific operating conditions. A unique type of complex chaotic attractor may evolve from the Rossler attractor because of the coupled channel-to-channel thermal-hydraulic and subcore-to-subcore neutron interactions. Such a complex chaotic attractor has the imbedding dimension of 5 and the

Heavy-ion fusion: Channel-coupling effects, the barrier penetration model, and the threshold anomaly for heavy-ion potentials

International Nuclear Information System (INIS)

Satchler, G.R.; Nagarajan, M.A.; Lilley, J.S.; Thompson, I.J.

1987-01-01

We study the formal structure of the influence of channel coupling on near- and sub-barrier fusion. The reduction to a one-channel description is studied, with emphasis on the channel-coupling effects being manifest primarily as an energy dependence (the ''threshold anomaly'') of the real nuclear potential. The relation to the barrier penetration model is examined critically. The results of large-scale coupled-channel calculations are used as ''data'' to illustrate the discussion. Particular emphasis is placed on the importance of reproducing correctly the partial-wave (or ''spin'') distributions. The simple barrier penetration model is found to be adequate to exhibit the strong enhancements due to channel couplings when the threshold anomaly is taken into account, although there may be important corrections due to the long-ranged peripheral absorption, especially from Coulomb excitation. copyright 1987 Academic Press, Inc

On-the-energy-shell approximation for the heavy ion couple-channels problems

International Nuclear Information System (INIS)

Carlson, B.V.; Hussein, M.S.

Starting with the coupled channels equations describing multiple Coulomb excitations in heavy ion collisions an approximation scheme is developed based on replacing the channel Green's functions by their on-the-energy shell forms, which permits an exact analytic solution for the scattering matrix. The trivially equivalent Coulomb polarization potential valid for strong coupling and small energy loss in the excitation processes is constructed. This potential is seen to have a very simple r-dependence. A simple formula for the sub-barrier elastic scattering cross section is then derived both by using the WRB approximation and by summing the Born series for the T-matrix. Comparison of the two forms for the elastic cross section shows that they give almost identical numerical results in the small coupling limit only. The results are also compared with the predictions of the Alder-Winther theory. (Author) [pt

Sub-channel/system coupled code development and its application to SCWR-FQT loop

International Nuclear Information System (INIS)

Liu, X.J.; Cheng, X.

2015-01-01

Highlights: • A coupled code is developed for SCWR accident simulation. • The feasibility of the code is shown by application to SCWR-FQT loop. • Some measures are selected by sensitivity analysis. • The peak cladding temperature can be reduced effectively by the proposed measures. - Abstract: In the frame of Super-Critical Reactor In Pipe Test Preparation (SCRIPT) project in China, one of the challenge tasks is to predict the transient performance of SuperCritical Water Reactor-Fuel Qualification Test (SCWR-FQT) loop under some accident conditions. Several thermal–hydraulic codes (system code, sub-channel code) are selected to perform the safety analysis. However, the system code cannot simulate the local behavior of the test bundle, and the sub-channel code is incapable of calculating the whole system behavior of the test loop. Therefore, to combine the merits of both codes, and minimizes their shortcomings, a coupled sub-channel and system code system is developed in this paper. Both of the sub-channel code COBRA-SC and system code ATHLET-SC are adapted to transient analysis of SCWR. Two codes are coupled by data transfer and data adaptation at the interface. In the new developed coupled code, the whole system behavior including safety system characteristic is analyzed by system code ATHLET-SC, whereas the local thermal–hydraulic parameters are predicted by the sub-channel code COBRA-SC. The codes are utilized to get the local thermal–hydraulic parameters in the SCWR-FQT fuel bundle under some accident case (e.g. a flow blockage during LOCA). Some measures to mitigate the accident consequence are proposed by the sensitivity study and trialed to demonstrate their effectiveness in the coupled simulation. The results indicate that the new developed code has good feasibility to transient analysis of supercritical water-cooled test. And the peak cladding temperature caused by blockage in the fuel bundle can be reduced effectively by the safety measures

Sub-channel/system coupled code development and its application to SCWR-FQT loop

Energy Technology Data Exchange (ETDEWEB)

Liu, X.J., E-mail: xiaojingliu@sjtu.edu.cn [School of Nuclear Science and Engineering, Shanghai Jiao Tong University, 800 Dong Chuan Road, Shanghai 200240 (China); Cheng, X. [Institute of Fusion and Reactor Technology, Karlsruhe Institute of Technology, Vincenz-Prießnitz-Str. 3, 76131 Karlsruhe (Germany)

2015-04-15

Highlights: • A coupled code is developed for SCWR accident simulation. • The feasibility of the code is shown by application to SCWR-FQT loop. • Some measures are selected by sensitivity analysis. • The peak cladding temperature can be reduced effectively by the proposed measures. - Abstract: In the frame of Super-Critical Reactor In Pipe Test Preparation (SCRIPT) project in China, one of the challenge tasks is to predict the transient performance of SuperCritical Water Reactor-Fuel Qualification Test (SCWR-FQT) loop under some accident conditions. Several thermal–hydraulic codes (system code, sub-channel code) are selected to perform the safety analysis. However, the system code cannot simulate the local behavior of the test bundle, and the sub-channel code is incapable of calculating the whole system behavior of the test loop. Therefore, to combine the merits of both codes, and minimizes their shortcomings, a coupled sub-channel and system code system is developed in this paper. Both of the sub-channel code COBRA-SC and system code ATHLET-SC are adapted to transient analysis of SCWR. Two codes are coupled by data transfer and data adaptation at the interface. In the new developed coupled code, the whole system behavior including safety system characteristic is analyzed by system code ATHLET-SC, whereas the local thermal–hydraulic parameters are predicted by the sub-channel code COBRA-SC. The codes are utilized to get the local thermal–hydraulic parameters in the SCWR-FQT fuel bundle under some accident case (e.g. a flow blockage during LOCA). Some measures to mitigate the accident consequence are proposed by the sensitivity study and trialed to demonstrate their effectiveness in the coupled simulation. The results indicate that the new developed code has good feasibility to transient analysis of supercritical water-cooled test. And the peak cladding temperature caused by blockage in the fuel bundle can be reduced effectively by the safety measures

Effect of isovector coupling channel on the macroscopic part of the nuclear binding energy

International Nuclear Information System (INIS)

Haddad, S.

2011-04-01

The effect of the isovector coupling channel on the macroscopic part of the nuclear binding energy is determined utilizing the relativistic density dependent Thomas-Fermi approach for the calculation of the macroscopic part of the nuclear binding energy, and the dependency of this effect on the numbers of neutrons and protons is studied. The isovector coupling channel leads to increased nuclear binding energy, and this effect sharpens with growing excess of the number of neutrons on the number of protons. (author)

Modeling satellite-Earth quantum channel downlinks with adaptive-optics coupling to single-mode fibers

Science.gov (United States)

Gruneisen, Mark T.; Flanagan, Michael B.; Sickmiller, Brett A.

2017-12-01

The efficient coupling of photons from a free-space quantum channel into a single-mode optical fiber (SMF) has important implications for quantum network concepts involving SMF interfaces to quantum detectors, atomic systems, integrated photonics, and direct coupling to a fiber network. Propagation through atmospheric turbulence, however, leads to wavefront errors that degrade mode matching with SMFs. In a free-space quantum channel, this leads to photon losses in proportion to the severity of the aberration. This is particularly problematic for satellite-Earth quantum channels, where atmospheric turbulence can lead to significant wavefront errors. This report considers propagation from low-Earth orbit to a terrestrial ground station and evaluates the efficiency with which photons couple either through a circular field stop or into an SMF situated in the focal plane of the optical receiver. The effects of atmospheric turbulence on the quantum channel are calculated numerically and quantified through the quantum bit error rate and secure key generation rates in a decoy-state BB84 protocol. Numerical simulations include the statistical nature of Kolmogorov turbulence, sky radiance, and an adaptive-optics system under closed-loop control.

Asymptotic analysis of the average, steady, isotherml flow in coupled, parallel channels

International Nuclear Information System (INIS)

Lund, K.O.

1976-01-01

The conservation equations of mass and momentum are derived for the average flow of gases in coupled, parallel channels, or rod bundles. In the case of gas-cooled rod bundles the pitch of the rods is relatively large so the flows in the channels are strongly coupled. From this observation a perturbation parameter is derived and the descriptive equations are scaled using this parameter, which represents the ratio of the axial flow area to the transverse flow area, and which is of the order of 10 -3 in current gas-cooled fast breeder reactor designs. By expanding the velocities into perturbation series the equations for two channels are solved as an initial value problem, and the results compared to a finite difference solution of the same problem. The N-channel problem is solved to the lowest order as a two-point boundary value problem with the pressures specified at the inlet and the outlet. It is concluded from the study that asymptotic methods are effective in solving the flow problems of rod bundles; however, further work is required to evaluate the possible computational advantages of the methods

The Effect of Extending the Length of the Coupling Coils in a Muon Ionization Cooling Channel

International Nuclear Information System (INIS)

Green, Michael A.

2007-01-01

RF cavities are used to re-accelerate muons that have been cooled by absorbers that are in low beta regions of a muon ionization cooling channel. A superconducting coupling magnet (or magnets) are around or among the RF cavities of a muon ionization-cooling channel. The field from the magnet guides the muons so that they are kept within the iris of the RF cavities that are used to accelerate the muons. This report compares the use of a single short coupling magnet with an extended coupling magnet that has one or more superconducting coils as part of a muon-cooling channel of the same design as the muon ionization cooling experiment (MICE). Whether the superconducting magnet is short and thick or long and this affects the magnet stored energy and the peak field in the winding. The magnetic field distribution also affects is the muon beam optics in the cooling cell of a muon cooling channel

Coupling between the voltage-sensing and pore domains in a voltage-gated potassium channel.

Science.gov (United States)

Schow, Eric V; Freites, J Alfredo; Nizkorodov, Alex; White, Stephen H; Tobias, Douglas J

2012-07-01

Voltage-dependent potassium (Kv), sodium (Nav), and calcium channels open and close in response to changes in transmembrane (TM) potential, thus regulating cell excitability by controlling ion flow across the membrane. An outstanding question concerning voltage gating is how voltage-induced conformational changes of the channel voltage-sensing domains (VSDs) are coupled through the S4-S5 interfacial linking helices to the opening and closing of the pore domain (PD). To investigate the coupling between the VSDs and the PD, we generated a closed Kv channel configuration from Aeropyrum pernix (KvAP) using atomistic simulations with experiment-based restraints on the VSDs. Full closure of the channel required, in addition to the experimentally determined TM displacement, that the VSDs be displaced both inwardly and laterally around the PD. This twisting motion generates a tight hydrophobic interface between the S4-S5 linkers and the C-terminal ends of the pore domain S6 helices in agreement with available experimental evidence.

Unidirectional photoreceptor-to-Müller glia coupling and unique K+ channel expression in Caiman retina.

Directory of Open Access Journals (Sweden)

Astrid Zayas-Santiago

Full Text Available Müller cells, the principal glial cells of the vertebrate retina, are fundamental for the maintenance and function of neuronal cells. In most vertebrates, including humans, Müller cells abundantly express Kir4.1 inwardly rectifying potassium channels responsible for hyperpolarized membrane potential and for various vital functions such as potassium buffering and glutamate clearance; inter-species differences in Kir4.1 expression were, however, observed. Localization and function of potassium channels in Müller cells from the retina of crocodiles remain, hitherto, unknown.We studied retinae of the Spectacled caiman (Caiman crocodilus fuscus, endowed with both diurnal and nocturnal vision, by (i immunohistochemistry, (ii whole-cell voltage-clamp, and (iii fluorescent dye tracing to investigate K+ channel distribution and glia-to-neuron communications.Immunohistochemistry revealed that caiman Müller cells, similarly to other vertebrates, express vimentin, GFAP, S100β, and glutamine synthetase. In contrast, Kir4.1 channel protein was not found in Müller cells but was localized in photoreceptor cells. Instead, 2P-domain TASK-1 channels were expressed in Müller cells. Electrophysiological properties of enzymatically dissociated Müller cells without photoreceptors and isolated Müller cells with adhering photoreceptors were significantly different. This suggests ion coupling between Müller cells and photoreceptors in the caiman retina. Sulforhodamine-B injected into cones permeated to adhering Müller cells thus revealing a uni-directional dye coupling.Our data indicate that caiman Müller glial cells are unique among vertebrates studied so far by predominantly expressing TASK-1 rather than Kir4.1 K+ channels and by bi-directional ion and uni-directional dye coupling to photoreceptor cells. This coupling may play an important role in specific glia-neuron signaling pathways and in a new type of K+ buffering.

Channel-coupling theory of covalent bonding in H2: A further application of arrangement-channel quantum mechanics

International Nuclear Information System (INIS)

Levin, F.S.; Krueger, H.

1977-01-01

The dissociation energy D/sub e/ and the equilibrium proton-proton separation R/sub eq/ of H 2 are calculated using the methods of arrangement-channel quantum mechanics. This theory is the channel component version of the channel-coupling array approach to many-body scattering, applied to bound-state problems. In the approximation used herein, the wave function is identical to that of the classic Heitler-London-Sugiura valence-bond calculation, which gave D/sub e/ = 3.14 eV and R/sub eq/ = 1.65a 0 , values accurate to 34% and 17.8%, respectively. The present method yields D/sub e/ = 4.437 eV and R/sub eq/ approx. = 1.42a 0 , accurate to 6.5% and 1%, respectively. Some implications of these results are discussed

Manual and automation testing and verification of TEQ [ECI PROPIRETRY

Science.gov (United States)

Abhichandra, Ravi; Jasmine Pemeena Priyadarsini, M.

2017-11-01

The telecommunication industry has progressed from 1G to 4G and now 5G is gaining prominence. Given the pace of this abrupt transformation, technological obsolescence is becoming a serious issue to deal with. Adding to this fact is that the execution of each technology requires ample investment into network, infrastructure, development etc. As a result, the industry is becoming more dynamic and strategy oriented. It requires professionals who not only can understand technology but also can evaluate the same from a business perspective. The “Information Revolution” and the dramatic advances in telecommunications technology, which has made this possible, currently drive the global economy in large part. As wireless networks become more advanced and far-reaching, we are redefining the notion of connectivity and the possibilities of communications technology. In this paper I test and verify the optical cards and automate this test procedure by using a new in-house technology “TEQ” developed by ECI TELECOM which uses one the optical cards itself to pump traffic of 100gbps.

Photo-Ionization of Noble Gases: A Demonstration of Hybrid Coupled Channels Approach

Directory of Open Access Journals (Sweden)

Vinay Pramod Majety

2015-01-01

Full Text Available We present here an application of the recently developed hybrid coupled channels approach to study photo-ionization of noble gas atoms: Neon and Argon. We first compute multi-photon ionization rates and cross-sections for these inert gas atoms with our approach and compare them with reliable data available from R-matrix Floquet theory. The good agreement between coupled channels and R-matrix Floquet theory show that our method treats multi-electron systems on par with the well established R-matrix theory. We then apply the time dependent surface flux (tSURFF method with our approach to compute total and angle resolved photo-electron spectra from Argon with linearly and circularly polarized 12 nm wavelength laser fields, a typical wavelength available from Free Electron Lasers (FELs.

Optical model representation of coupled channel effects

International Nuclear Information System (INIS)

Wall, N.S.; Cowley, A.A.; Johnson, R.C.; Kobas, A.M.

1977-01-01

A modification to the usual 6-parameter Woods-Saxon parameterization of the optical model for the scattering of composite particles is proposed. This additional real term reflects the effect of coupling other channels to the elastic scattering. The analyses favor a repulsive interaction for this term, especially for alpha particles. It is found that the repulsive term when combined with a Woods-Saxon term yields potentials with central values and volume integrals similar to those found by uncoupled elastic scattering calculations. These values are V(r = 0) approximately equal to 125 MeV and J/4A approximately equal to 300 MeV-fm 3

Coupled channel calculations of K-shell ionization in asymmetric collision systems

International Nuclear Information System (INIS)

Mehler, G.; Greiner, W.; Soff, G.

1986-07-01

We report theoretical results on K-shell ionization for a variety of asymmetric collision systems. The calculated ionization rates are compared with experimental data. The coupled channel formalism underlying these calculations is presented. It is based on a set of relativistic target centred states, taking a screened potential of Dirac-Fock-Slater type into account. We discuss the effects of different matrix elements, e.g. continuum-continuum couplings. The binding effect is inherently contained in our approach and described in a dynamical way. (orig.)

Channel coupling in A(e,e N)B reactions

CERN Document Server

Kell, J

1999-01-01

The sensitivity of momentum distributions, recoil polarization observables, and response functions for nucleon knockout by polarized electron scattering to channel coupling in final-state interactions is investigated using a model in which both the distorting and the coupling potentials are constructed by folding density-dependent nucleon-nucleon effective interactions with nuclear transition densities. Elastic reorientation, inelastic scattering, and charge exchange are included for all possible couplings within the model space. Calculations for sup 1 sup 6 O are presented for 200 and 433 MeV ejectile energies, corresponding to proposed experiments at MAMI and TJNAF, and for sup 1 sup 2 C at 70 and 270 MeV, corresponding to experiments at NIKHEF and MIT-Bates. The relative importance of charge exchange decreases as the ejectile energy increases, but remains significant for 200 MeV. Both proton and neutron knockout cross sections for large recoil momenta, p sub m greater than 300 MeV/c, are substantially affe...

Measurement of the Higgs boson coupling properties in the $H\\rightarrow ZZ^{*} \\rightarrow 4\\ell$ decay channel at $\\sqrt{s}$ = 13 TeV with the ATLAS detector

CERN Document Server

The ATLAS collaboration

2017-01-01

The coupling properties of the Higgs boson are studied in the four-lepton decay channel using 36.1 fb$^{-1}$ of $pp$ collision data from the LHC at a centre-of-mass energy of 13 TeV collected by the ATLAS detector. Cross sections are measured for the four key production modes in several exclusive regions of the phase space and are interpreted in terms of coupling modifiers. The inclusive cross section in the $H \\rightarrow ZZ^*$ decay and for a Higgs boson absolute rapidity below 2.5 is measured to be $1.73^{+0.24}_{-0.23}$(stat.)$^{+0.10}_{-0.08}$(exp.)$\\pm 0.04$(th.)~pb compared to the Standard Model prediction of $1.34\\pm0.06$~pb. In addition, the tensor structure of the Higgs boson couplings is studied using an effective Lagrangian approach for the description of interactions beyond the Standard Model. Improved constraints are placed on the non-Standard-Model CP-even and CP-odd couplings to $Z$ bosons and on the CP-odd coupling to gluons.

Evidence for phonon-mediated coupling in superconducting Ba0.6K0.4BiO3

International Nuclear Information System (INIS)

Hinks, D.G.; Dabrowski, B.; Richards, D.R.; Jorgensen, J.D.; Pei, S.; Zasadzinski, J.F.

1989-01-01

Superconducting Ba 0.6 K 0.4 BiO 3 , with a T c of 30 K, shows a large 18 O isotope effect which indicates that phonons are involved in the pairing mechanism. Infrared reflectivity measurements indicate a value for the superconducting gap consistent with moderate coupling (2Δ/k T c = 3.5 ± 0.5). A mediating energy for pairing of about 40 meV would be required to obtain a T c of 30 K. Strong coupling of electrons by optical phonons (which are present in this material with energies up to 80 meV) could account for the observed transition temperature. Recent tunneling spectroscopy shows the presence of strongly coupled optical phonons in the 40 to 70 meV region, indicating that superconductivity in this material may be phonon mediated

Isovector coupling channel and central properties of the charge density distribution in heavy spherical nuclei

International Nuclear Information System (INIS)

Haddad, S.

2010-01-01

The influence of the isovector coupling channel on the central depression parameter and the central value of the charge density distribution in heavy spherical nuclei was studied. The isovector coupling channel leads to about 50% increase of the central depression parameter, and weakens the dependency of both central depression parameter and the central density on the asymmetry, impressively contributing to the semibubble form of the charge density distribution in heavy nuclei, and increasing the probability of larger nuclei with higher proton numbers and higher neutron-to-proton ratios stable. (author)

G-protein-coupled inward rectifier potassium channels involved in corticostriatal presynaptic modulation.

Science.gov (United States)

Meneses, David; Mateos, Verónica; Islas, Gustavo; Barral, Jaime

2015-09-01

Presynaptic modulation has been associated mainly with calcium channels but recent data suggests that inward rectifier potassium channels (K(IR)) also play a role. In this work we set to characterize the role of presynaptic K(IR) channels in corticostriatal synaptic transmission. We elicited synaptic potentials in striatum by stimulating cortical areas and then determined the synaptic responses of corticostriatal synapsis by using paired pulse ratio (PPR) in the presence and absence of several potassium channel blockers. Unspecific potassium channels blockers Ba(2+) and Cs(+) reduced the PPR, suggesting that these channels are presynaptically located. Further pharmacological characterization showed that application of tertiapin-Q, a specific K(IR)3 channel family blocker, also induced a reduction of PPR, suggesting that K(IR)3 channels are present at corticostriatal terminals. In contrast, exposure to Lq2, a specific K(IR)1.1 inward rectifier potassium channel, did not induce any change in PPR suggesting the absence of these channels in the presynaptic corticostriatal terminals. Our results indicate that K(IR)3 channels are functionally expressed at the corticostriatal synapses, since blockage of these channels result in PPR decrease. Our results also help to explain how synaptic activity may become sensitive to extracellular signals mediated by G-protein coupled receptors. A vast repertoire of receptors may influence neurotransmitter release in an indirect manner through regulation of K(IR)3 channels. © 2015 Wiley Periodicals, Inc.

The effect of anthocyanins from red wine and blackberry on the integrity of a keratinocyte model using ECIS.

Science.gov (United States)

Évora, Ana; de Freitas, Victor; Mateus, Nuno; Fernandes, Iva

2017-11-15

There is a growing market demand for the incorporation of plant-derived ingredients into new products for the cosmetic industry. Anthocyanins are polyphenols arising from plant secondary metabolism that have been shown to possess many bioactive properties such as free radical scavenging, antimicrobial, and chemopreventive activities. In this work, the biological activities of red wine and blackberry anthocyanins were assessed by developing a new keratinocyte barrier model using the HaCat cell line and a microelectrode-based biosensor device, referred to as Electric Cell-Substrate Impedance Sensing (ECIS). Cells were seeded at the optimal cellular density of 1.6 × 10 6 cells per mL and the half-time was calculated to be 3.55 ± 0.67 hours. The compounds' cytotoxicity was assessed and anthocyanin pigments showed no cytotoxicity towards keratinocyte cells. Wound healing assays were also performed using ECIS and it was observed that the tested pigments enhanced the healing rate of keratinocyte cells by reducing the healing time more than 50%. Cyanidin-3-glucoside presented the best results recovering 50% of the injured area in 1.48(±0.15) hours, followed by the blackberry anthocyanins (2.01 ± 0.18 hours), malvidin-3-glucoside (2.03 ± 0.09 hours) and red wine anthocyanins (2.36 ± 0.76 hours). All presented significant differences from the control 4.91(±1.11) hours.

Effect of the isovector coupling channel on the macroscopic part of ...

Indian Academy of Sciences (India)

Physics Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus, Syria. E-mail: pscientific@aec.org.sy. MS received 10 June 2012; revised 18 October 2012; accepted 12 December 2012. Abstract. The effect of isovector coupling channel on the macroscopic part of the nuclear binding energy is studied ...

Coupled-channel analysis of nucleon scattering from 40Ca

International Nuclear Information System (INIS)

Delaroche, J.P.; Honore, G.M.; Tornow, W.; Walter, R.L.

1985-05-01

Differential cross sections and analyzing powers for neutron scattering from 40 Ca have been measured at TUNL in the 10-17 MeV energy range. These measurements and other σ(theta) and σsub(T) measurements, as well as available 40 Ca+p data, have been combined together in a coupled-channel analysis in order to trace the properties (energy dependencies, spin-orbit potentials, deformation parameters) of the nucleon + 40 Ca potential up to 80 MeV

Coupled-channel analysis of nucleon scattering from 40Ca

International Nuclear Information System (INIS)

Delaroche, J.-P.; Honore, G.M.; Tornow, W.; Walter, R.L.

1986-01-01

Differential cross sections and analyzing powers for neutron scattering from 40 Ca have been measured at TUNL in the 10-17 MeV energy range. These measurements and other σ(theta) and σsub(T) measurements, as well as available 40 Ca+p data, have been combined together in a coupled-channel analysis in order to trace the properties (energy dependencies, spin-orbit potentials, deformation parameters) of the nucleon + 40 Ca potential up to 80 MeV. (author)

Coupled Model of channels in parallel and neutron kinetics in two dimensions

International Nuclear Information System (INIS)

Cecenas F, M.; Campos G, R.M.; Valle G, E. del

2004-01-01

In this work an arrangement of thermohydraulic channels is presented that represent those four quadrants of a nucleus of reactor type BWR. The channels are coupled to a model of neutronic in two dimensions that allow to generate the radial profile of power of the reactor. Nevertheless that the neutronic pattern is of two dimensions, it is supplemented with axial additional information when considering the axial profiles of power for each thermo hydraulic channel. The stationary state is obtained the one it imposes as frontier condition the same pressure drop for all the channels. This condition is satisfied to iterating on the flow of coolant in each channel to equal the pressure drop in all the channels. This stationary state is perturbed later on when modifying the values for the effective sections corresponding to an it assembles. The calculation in parallel of the neutronic and the thermo hydraulic is carried out with Vpm (Virtual parallel machine) by means of an outline teacher-slave in a local net of computers. (Author)

Tuning the allosteric regulation of artificial muscarinic and dopaminergic ligand-gated potassium channels by protein engineering of G protein-coupled receptors

Science.gov (United States)

Moreau, Christophe J.; Revilloud, Jean; Caro, Lydia N.; Dupuis, Julien P.; Trouchet, Amandine; Estrada-Mondragón, Argel; Nieścierowicz, Katarzyna; Sapay, Nicolas; Crouzy, Serge; Vivaudou, Michel

2017-01-01

Ligand-gated ion channels enable intercellular transmission of action potential through synapses by transducing biochemical messengers into electrical signal. We designed artificial ligand-gated ion channels by coupling G protein-coupled receptors to the Kir6.2 potassium channel. These artificial channels called ion channel-coupled receptors offer complementary properties to natural channels by extending the repertoire of ligands to those recognized by the fused receptors, by generating more sustained signals and by conferring potassium selectivity. The first artificial channels based on the muscarinic M2 and the dopaminergic D2L receptors were opened and closed by acetylcholine and dopamine, respectively. We find here that this opposite regulation of the gating is linked to the length of the receptor C-termini, and that C-terminus engineering can precisely control the extent and direction of ligand gating. These findings establish the design rules to produce customized ligand-gated channels for synthetic biology applications. PMID:28145461

Dynamical coupled-channel analysis at EBAC. (Excited Baryon Analysis Center)

International Nuclear Information System (INIS)

Lee, T.-S.H.; Thomas Jefferson National Accelerator Facility, Newport News, VA

2008-01-01

In this contribution, the author reports on the dynamical coupled-channels analysis being pursued at the Excited Baryon Analysis Center (EBAC) of Jefferson Laboratory. EBAC was established in January 2006. Its objective is to extract the parameters associated with the excited states (N*) of the nucleon from the world data of meson production reactions, and to also develop theoretical interpretations of the extracted N* parameters

Pitch Channel Control of a REMUS AUV with Input Saturation and Coupling Disturbances

Directory of Open Access Journals (Sweden)

Nailong Wu

2018-02-01

Full Text Available The motion of an underwater vehicle is prone to be affected by time-varying model parameters and the actuator limitation in control practice. Adaptive control is an effective method to deal with the general system dynamic uncertainties and disturbances. However, the effect of disturbances control on transient dynamics is not prominent. In this paper, we redesign the L 1 adaptive control architecture (L1AC with anti-windup (AW compensator to guarantee robust and fast adaption of the underwater vehicle with input saturation and coupling disturbances. To reduce the fluctuation of vehicle states, the Riccati-based AW compensator is utilized to compensate the output signal from L1AC controller via taking proper modification. The proposed method is applied to the pitch channel of REMUS vehicle’s six Degrees Of Freedom (DOF model with strong nonlinearities and compared with L1AC baseline controller. Simulations show the effectiveness of the proposed control strategy compared to the original L1AC. Besides, the fluctuation in roll channel coupled with pitch channel is suppressed according to the performances of control tests.

Coupled channel analysis of s-wave ππ and K anti-K photoproduction

International Nuclear Information System (INIS)

Chueng-Ryong Ji; Szczepaniak, A.; Kaminski, R.; Lesniak, L.; Williams, R.

1997-10-01

We present a coupled channel partial wave analysis of non-diffractive S-wave π + π - and K + K - photoproduction focusing on the K anti-K threshold. Final state interactions are included. We calculate total cross sections, angular and effective mass distributions in both ππ and K anti-K channels. Our results indicate that these processes are experimentally measurable and valuable information on the f 0 (980) resonance structure can be obtained. (author)

Double-Nanodomain Coupling of Calcium Channels, Ryanodine Receptors, and BK Channels Controls the Generation of Burst Firing.

Science.gov (United States)

Irie, Tomohiko; Trussell, Laurence O

2017-11-15

Action potentials clustered into high-frequency bursts play distinct roles in neural computations. However, little is known about ionic currents that control the duration and probability of these bursts. We found that, in cartwheel inhibitory interneurons of the dorsal cochlear nucleus, the likelihood of bursts and the interval between their spikelets were controlled by Ca 2+ acting across two nanodomains, one between plasma membrane P/Q Ca 2+ channels and endoplasmic reticulum (ER) ryanodine receptors and another between ryanodine receptors and large-conductance, voltage- and Ca 2+ -activated K + (BK) channels. Each spike triggered Ca 2+ -induced Ca 2+ release (CICR) from the ER immediately beneath somatic, but not axonal or dendritic, plasma membrane. Moreover, immunolabeling demonstrated close apposition of ryanodine receptors and BK channels. Double-nanodomain coupling between somatic plasma membrane and hypolemmal ER cisterns provides a unique mechanism for rapid control of action potentials on the millisecond timescale. Copyright © 2017 Elsevier Inc. All rights reserved.

Measurement of the Higgs boson coupling properties in the diphoton, ZZ and WW decay channels using the ATLAS detector

CERN Document Server

Gupta, Ruchi; The ATLAS collaboration

2017-01-01

The coupling properties of the Higgs boson are studied in the diphoton, ZZ to four-lepton decay channels using 36.1 fb$^{-1}$ of $pp$ collision data from the LHC at a centre-of-mass energy of 13 TeV collected by the ATLAS detector. Measurements of simplified template cross sections, designed to measure the different Higgs boson production processes in specific regions of phase space, are reported for diphoton and four-leptons decay channels. Cross sections for different higgs boson production modes are interpreted in terms of coupling modifiers. In ZZ decay channel, the tensor structure of the Higgs boson couplings is studied using an effective Lagrangian approach for the description of interactions beyond the Standard Model.

Temperature and Voltage Coupling to Channel Opening in Transient Receptor Potential Melastatin 8 (TRPM8)*♦

Science.gov (United States)

Raddatz, Natalia; Castillo, Juan P.; Gonzalez, Carlos; Alvarez, Osvaldo; Latorre, Ramon

2014-01-01

Expressed in somatosensory neurons of the dorsal root and trigeminal ganglion, the transient receptor potential melastatin 8 (TRPM8) channel is a Ca2+-permeable cation channel activated by cold, voltage, phosphatidylinositol 4,5-bisphosphate, and menthol. Although TRPM8 channel gating has been characterized at the single channel and macroscopic current levels, there is currently no consensus regarding the extent to which temperature and voltage sensors couple to the conduction gate. In this study, we extended the range of voltages where TRPM8-induced ionic currents were measured and made careful measurements of the maximum open probability the channel can attain at different temperatures by means of fluctuation analysis. The first direct measurements of TRPM8 channel temperature-driven conformational rearrangements provided here suggest that temperature alone is able to open the channel and that the opening reaction is voltage-independent. Voltage is a partial activator of TRPM8 channels, because absolute open probability values measured with fully activated voltage sensors are less than 1, and they decrease as temperature rises. By unveiling the fast temperature-dependent deactivation process, we show that TRPM8 channel deactivation is well described by a double exponential time course. The fast and slow deactivation processes are temperature-dependent with enthalpy changes of 27.2 and 30.8 kcal mol−1. The overall Q10 for the closing reaction is about 33. A three-tiered allosteric model containing four voltage sensors and four temperature sensors can account for the complex deactivation kinetics and coupling between voltage and temperature sensor activation and channel opening. PMID:25352597

Electric cell-substrate impedance sensing (ECIS) based real-time measurement of titer dependent cytotoxicity induced by adenoviral vectors in an IPI-2I cell culture model.

Science.gov (United States)

Müller, Jakob; Thirion, Christian; Pfaffl, Michael W

2011-01-15

Recombinant viral vectors are widespread tools for transfer of genetic material in various modern biotechnological applications like for example RNA interference (RNAi). However, an accurate and reproducible titer assignment represents the basic step for most downstream applications regarding a precise multiplicity of infection (MOI) adjustment. As necessary scaffold for the studies described in this work we introduce a quantitative real-time PCR (qPCR) based approach for viral particle measurement. Still an implicated problem concerning physiological effects is that the appliance of viral vectors is often attended by toxic effects on the individual target. To determine the critical viral dose leading to cell death we developed an electric cell-substrate impedance sensing (ECIS) based assay. With ECIS technology the impedance change of a current flow through the cell culture medium in an array plate is measured in a non-invasive manner, visualizing effects like cell attachment, cell-cell contacts or proliferation. Here we describe the potential of this online measurement technique in an in vitro model using the porcine ileal epithelial cell line IPI-2I in combination with an adenoviral transfection vector (Ad5-derivate). This approach shows a clear dose-depending toxic effect, as the amount of applied virus highly correlates (p<0.001) with the level of cell death. Thus this assay offers the possibility to discriminate the minimal non-toxic dose of the individual transfection method. In addition this work suggests that the ECIS-device bears the feasibility to transfer this assay to multiple other cytotoxicological questions. Copyright © 2010 Elsevier B.V. All rights reserved.

Reaction channel coupling effects for nucleons on 16O: Induced undularity and proton-neutron potential differences

Science.gov (United States)

Keeley, N.; Mackintosh, R. S.

2018-01-01

Background: Precise fitting of scattering observables suggests that the nucleon-nucleus interaction is l dependent. Such l dependence has been shown to be S -matrix equivalent to an undulatory l -independent potential. The undulations include radial regions where the imaginary term is emissive. Purpose: To study the dynamical polarization potential (DPP) generated in proton-16O and neutron-16O interaction potentials by coupling to pickup channels. Undulatory features occurring in these DPPs can be compared with corresponding features of empirical optical model potentials (OMPs). Furthermore, the additional inclusion of coupling to vibrational states of the target will provide evidence for dynamically generated nonlocality. Methods: The fresco code provides the elastic channel S -matrix Sl j for chosen channel couplings. Inversion, Sl j→V (r ) +l .s VSO(r ) , followed by subtraction of the bare potential, yields an l -independent and local representation of the DPP due to the chosen couplings. Results: The DPPs have strongly undulatory features, including radial regions of emissivity. Certain features of empirical DPPs appear, e.g., the full inverted potential has emissive regions. The DPPs for different collective states are additive except near the nuclear center, whereas the collective and reaction channel DPPs are distinctly nonadditive over a considerable radial range, indicating dynamical nonlocality. Substantial differences between the DPPs due to pickup coupling for protons and neutrons occur; these imply a greater difference between proton and neutron OMPs than the standard phenomenological prescription. Conclusions: The onus is on those who object to undularity in the local and l -independent representation of nucleon elastic scattering to show why such undulations do not occur. This work suggests that it is not legitimate to halt model-independent fits to high-quality data at the appearance of undularity.

Investigating the relationship between watching satellite channels and intimacy and marital satisfaction of couples in Isfahan, Iran, in 2014.

Science.gov (United States)

Babaie, Zohre; Keshvari, Mahrokh; Zamani, Ahmadreza

2016-01-01

In the age of communication and media that families are rapidly driven towards using satellite channels and other media, considering family health in this regard is essential. A determinant of health is marital satisfaction. The aim of this study was to investigate the relationship between watching satellite channels and intimacy and marital satisfaction in Isfahan, Iran. This cross-sectional and correlational study was conducted on one group of 480 couples ( n = 960) participating from 8 health-treatment centers in Isfahan. Multi-stage cluster sampling was used in this study. Inclusion criteria included at least 2 years of marriage. After completion of Bagarozzi's Marital Intimacy Questionnaire and ENRICH Marital Inventory, the couples were divided into two groups based on watching satellite networks. Data were analyzed using SPSS 18. There was a significant relationship between intimacy and marital satisfaction in both viewers and non-viewers of satellite channels ( P satellite viewing group was 22.4 minutes and in non-viewers group was 47.95 min. In addition, the duration of interaction had a significant relationship with marital satisfaction and intimacy ( P satellite channels reduced the intimacy and marital satisfaction of the couples, and duration of interaction among the couples.

Coupled-channel analysis of nucleon scattering from /sup 40/Ca

Energy Technology Data Exchange (ETDEWEB)

Delaroche, J.-P.; Honore, G.M.; Tornow, W.; Walter, R.L.

1986-01-01

Differential cross sections and analyzing powers for neutron scattering from /sup 40/Ca have been measured at TUNL in the 10-17 MeV energy range. These measurements and other sigma(theta) and sigmasub(T) measurements, as well as available /sup 40/Ca+p data, have been combined together in a coupled-channel analysis in order to trace the properties (energy dependencies, spin-orbit potentials, deformation parameters) of the nucleon + /sup 40/Ca potential up to 80 MeV.

Entangled state teleportation through a couple of quantum channels composed of XXZ dimers in an Ising- XXZ diamond chain

Science.gov (United States)

Rojas, M.; de Souza, S. M.; Rojas, Onofre

2017-02-01

The quantum teleportation plays an important role in quantum information process, in this sense, the quantum entanglement properties involving an infinite chain structure is quite remarkable because real materials could be well represented by an infinite chain. We study the teleportation of an entangled state through a couple of quantum channels, composed by Heisenberg dimers in an infinite Ising-Heisenberg diamond chain, the couple of chains are considered sufficiently far away from each other to be ignored the any interaction between them. To teleporting a couple of qubits through the quantum channel, we need to find the average density operator for Heisenberg spin dimers, which will be used as quantum channels. Assuming the input state as a pure state, we can apply the concept of fidelity as a useful measurement of teleportation performance of a quantum channel. Using the standard teleportation protocol, we have derived an analytical expression for the output concurrence, fidelity, and average fidelity. We study in detail the effects of coupling parameters, external magnetic field and temperature dependence of quantum teleportation. Finally, we explore the relations between entanglement of the quantum channel, the output entanglement and the average fidelity of the system. Through a kind of phase diagram as a function of Ising-Heisenberg diamond chain model parameters, we illustrate where the quantum teleportation will succeed and a region where the quantum teleportation could fail.

Non-local coupled-channels optical calculation of electron scattering by atomic hydrogen at 54.42 eV

International Nuclear Information System (INIS)

Ratnavelu, K.; McCarthy, I.E.

1990-01-01

The present study incorporates the non-local optical potentials for the continuum within the coupled-channels optical framework to study electron scattering from atomic hydrogen at 54.42 eV. Nine-state coupled-channels calculations with non-local and local continuum optical potentials were performed. The results for differential, total and ionization cross sections as well as the 2p angular correlation parameters λ and R are comparable with other non-perturbative calculations. There are still discrepancies between theory and experiment, particularly for λ and R at larger angles. (author)

Coupled-channel analysis of nucleon scattering from /sup 40/Ca

International Nuclear Information System (INIS)

Delaroche, J.P.; Honore, G.M.; Tornow, W.; Walter, R.L.

1985-01-01

Differential cross sections and analyzing powers for neutron scattering from /sup 40/Ca have been measured at TUNL in the 10-17 MeV energy range. These measurements and other σ(θ) and σ/sub T/ measurements, as well as available /sup 40/Ca+p data, have been combined together in a coupled-channel analysis in order to trace the properties (energy dependencies, spin-orbit potentials, deformation parameters) of the nucleon + /sup 40/Ca potential up to 80 MeV

A unitary approach to the coupling between the NN and πNN channels

International Nuclear Information System (INIS)

Blankleider, B.

1980-11-01

Some basic properties of the πNN system, in particular its coupling to the NN channel, are investigated. A set of linear integral equations that couple the N-N to the π-d channel, and satisfy two- and three-body unitarity is derived. By including the π-N amplitude in the P 11 channel, and retaining certain disconnected diagrams, it is found that the propagators for the nucleons, and form factors for the vertices, become dressed without changing the basic structure of the equations. For the numerical solution relativistic kinematics for the pion and non-relativistic kinematics for the nucleons are used. There is uncertainty about the importance of real pion absorption in the π-d elastic scattering reaction. Although the effect of absorption can be very large, its influence is cancelled to a large extent by the further inclusion of P 11 rescattering. The inclusion of absorption signnificantly lowers the dips in the π-d differential cross sections at higher energies. The model is able to reproduce the sole experimental value of the tensor polarization t 20 at 180 deg. so far available. Numerical results for the reaction NN→πd are in excellent agreement with the differential cross sections at all but the very high energies

Putative Structural and Functional Coupling of the Mitochondrial BKCa Channel to the Respiratory Chain.

Directory of Open Access Journals (Sweden)

Piotr Bednarczyk

Full Text Available Potassium channels have been found in the inner mitochondrial membranes of various cells. These channels regulate the mitochondrial membrane potential, the matrix volume and respiration. The activation of these channels is cytoprotective. In our study, the single-channel activity of a large-conductance Ca(2+-regulated potassium channel (mitoBKCa channel was measured by patch-clamping mitoplasts isolated from the human astrocytoma (glioblastoma U-87 MG cell line. A potassium-selective current was recorded with a mean conductance of 290 pS in symmetrical 150 mM KCl solution. The channel was activated by Ca(2+ at micromolar concentrations and by the potassium channel opener NS1619. The channel was inhibited by paxilline and iberiotoxin, known inhibitors of BKCa channels. Western blot analysis, immuno-gold electron microscopy, high-resolution immunofluorescence assays and polymerase chain reaction demonstrated the presence of the BKCa channel β4 subunit in the inner mitochondrial membrane of the human astrocytoma cells. We showed that substrates of the respiratory chain, such as NADH, succinate, and glutamate/malate, decrease the activity of the channel at positive voltages. This effect was abolished by rotenone, antimycin and cyanide, inhibitors of the respiratory chain. The putative interaction of the β4 subunit of mitoBKCa with cytochrome c oxidase was demonstrated using blue native electrophoresis. Our findings indicate possible structural and functional coupling of the mitoBKCa channel with the mitochondrial respiratory chain in human astrocytoma U-87 MG cells.

Examen d'analyses récentes portant sur l'Étude canadienne sur l'incidence des signalements de cas de violence et de négligence envers les enfants (ECI

Directory of Open Access Journals (Sweden)

D. Potter

2015-01-01

Full Text Available Introduction : Cette analyse a comme objectif de rassembler les articles évalués par les pairs utilisant des données tirées de l'Étude canadienne sur l'incidence des signalements de cas de violence et de négligence envers les enfants (ECI publiées depuis novembre 2011 ainsi que des suréchantillons provinciaux de l'ECI, d'évaluer la qualité de leurs conclusions, de les synthétiser et de faire le bilan des variations dans l'utilisation de ces données. Méthodologie : Nous avons sélectionné les articles au moyen du suivi des demandes d'accès aux données de l'ECI effectué par l'Agence de la santé publique du Canada et au suivi des publications produites au moyen de ces données. Deux évaluateurs au moins ont examiné de façon indépendante les articles et en ont évalué la qualité. Résultats : Nous avons conservé 32 articles. Leurs points forts étaient en général les suivants : objectifs de recherche clairement établis, variables de contrôle appropriées, analyses pertinentes, taille de l'échantillon suffisante, conclusions pertinentes et utilité pour les pratiques et politiques. Leur point problématique était le plus souvent une définition floue des variables et des critères d'inclusion des cas. La plupart du temps, les articles mesuraient les associations entre les caractéristiques des mauvais traitements et celles des enfants, des pourvoyeurs de soins, du ménage et de l'organisme ou de la personne à l'origine du signalement et ils s'intéressaient aux conséquences des signalements, par exemple l'ouverture d'un dossier pour une prestation continue de services ou le placement. Conclusion : Les articles utilisant des données de l'ECI ont obtenu des scores positifs pour la plupart des indicateurs de qualité. Dans leurs analyses les plus récentes, les chercheurs se sont concentrés sur les catégories de maltraitance insuffisamment étudiées jusqu'ici (exposition à la violence conjugale, négligence et

Sensitivity of fusion and quasi-elastic barrier distributions of {sub 16}O+{sub 144}Sm reaction on the coupling radius parameter

Energy Technology Data Exchange (ETDEWEB)

Zamrun, Muhammad; Usman, Ida; Variani, Viska Inda [Department of Physics, Haluoleo University, Kendari, Sulawesi Tengagra, 93232 (Indonesia); Kassim, Hasan Abu [Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia)

2014-03-05

We study the heavy-ion collision at sub-barrier energies of {sub 16}O+{sub 144}Sm system using full order coupled-channels formalism. We especially investigate the sensitivity of fusion and quasi-elastic barrier distributions for this system on the coupling radius parameter. We found that the coupled-channels calculations of the fusion and the quasi-elastic barrier distributions are sensitive to the coupling radius for this reaction in contrast to the fusion and quasi-elastic cross section. Our study indicates that the larger coupling radius, i.e., r{sub coup}=1.20, is required by the experimental quasi-elastic barrier distribution. However, the experimental fusion barrier distribution compulsory the small value, i.e., r{sub coup}=1.06.

Gating transitions in the selectivity filter region of a sodium channel are coupled to the domain IV voltage sensor.

Science.gov (United States)

Capes, Deborah L; Arcisio-Miranda, Manoel; Jarecki, Brian W; French, Robert J; Chanda, Baron

2012-02-14

Voltage-dependent ion channels are crucial for generation and propagation of electrical activity in biological systems. The primary mechanism for voltage transduction in these proteins involves the movement of a voltage-sensing domain (D), which opens a gate located on the cytoplasmic side. A distinct conformational change in the selectivity filter near the extracellular side has been implicated in slow inactivation gating, which is important for spike frequency adaptation in neural circuits. However, it remains an open question whether gating transitions in the selectivity filter region are also actuated by voltage sensors. Here, we examine conformational coupling between each of the four voltage sensors and the outer pore of a eukaryotic voltage-dependent sodium channel. The voltage sensors of these sodium channels are not structurally symmetric and exhibit functional specialization. To track the conformational rearrangements of individual voltage-sensing domains, we recorded domain-specific gating pore currents. Our data show that, of the four voltage sensors, only the domain IV voltage sensor is coupled to the conformation of the selectivity filter region of the sodium channel. Trapping the outer pore in a particular conformation with a high-affinity toxin or disulphide crossbridge impedes the return of this voltage sensor to its resting conformation. Our findings directly establish that, in addition to the canonical electromechanical coupling between voltage sensor and inner pore gates of a sodium channel, gating transitions in the selectivity filter region are also coupled to the movement of a voltage sensor. Furthermore, our results also imply that the voltage sensor of domain IV is unique in this linkage and in the ability to initiate slow inactivation in sodium channels.

NCBI nr-aa BLAST: CBRC-DRER-06-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-06-0073 ref|NP_001025549.1| potassium voltage-gated channel, shaker-relat...ed subfamily, member 3 [Gallus gallus] gb|AAP94028.1| shaker subfamily potassium channel Kv1.3 [Gallus gallus] NP_001025549.1 0.0 74% ...

Do TRPC channels support working memory? Comparing modulations of TRPC channels and working memory through G-protein coupled receptors and neuromodulators.

Science.gov (United States)

Reboreda, Antonio; Theissen, Frederik M; Valero-Aracama, Maria J; Arboit, Alberto; Corbu, Mihaela A; Yoshida, Motoharu

2018-03-01

Working memory is a crucial ability we use in daily life. However, the cellular mechanisms supporting working memory still remain largely unclear. A key component of working memory is persistent neural firing which is believed to serve short-term (hundreds of milliseconds up to tens of seconds) maintenance of necessary information. In this review, we will focus on the role of transient receptor potential canonical (TRPC) channels as a mechanism underlying persistent firing. Many years of in vitro work have been suggesting a crucial role of TRPC channels in working memory and temporal association tasks. If TRPC channels are indeed a central mechanism for working memory, manipulations which impair or facilitate working memory should have a similar effect on TRPC channel modulation. However, modulations of working memory and TRPC channels were never systematically compared, and it remains unanswered whether TRPC channels indeed contribute to working memory in vivo or not. In this article, we review the effects of G-protein coupled receptors (GPCR) and neuromodulators, including acetylcholine, noradrenalin, serotonin and dopamine, on working memory and TRPC channels. Based on comparisons, we argue that GPCR and downstream signaling pathways that activate TRPC, generally support working memory, while those that suppress TRPC channels impair it. However, depending on the channel types, areas, and systems tested, this is not the case in all studies. Further work to clarify involvement of specific TRPC channels in working memory tasks and how they are affected by neuromodulators is still necessary in the future. Copyright © 2018 Elsevier B.V. All rights reserved.

Dirac potentials in a coupled channel approach to inelastic scattering

International Nuclear Information System (INIS)

Mishra, V.K.; Clark, B.C.; Cooper, E.D.; Mercer, R.L.

1990-01-01

It has been shown that there exist transformations that can be used to change the Lorentz transformation character of potentials, which appear in the Dirac equation for elastic scattering. We consider the situation for inelastic scattering described by coupled channel Dirac equations. We examine a two-level problem where both the ground and excited states are assumed to have zero spin. Even in this simple case we have not found an appropriate transformation. However, if the excited state has zero excitation energy it is possible to find a transformation

NCBI nr-aa BLAST: CBRC-DRER-06-0073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-06-0073 ref|NP_001079227.1| shaker-like potassium channel subunit Kv1.3B ...[Xenopus laevis] gb|AAK83378.1|AF395810_1 shaker-like potassium channel subunit Kv1.3B [Xenopus laevis] NP_001079227.1 0.0 87% ...

Development of sub-channel/system coupled code and its application to a supercritical water-cooled test loop

International Nuclear Information System (INIS)

Liu, X.J.; Yang, T.; Cheng, X.

2014-01-01

To analyze the local thermal-hydraulic parameters in the supercritical water reactor-fuel qualification test (SCWR-FQT) fuel bundle with a flow blockage, a coupled sub-channel and system code system is developed in this paper. Both of the sub-channel code and system code are adapted to transient analysis of SCWR. Two codes are coupled by data transfer and data adaptation at the interface. In the coupled code, the whole system behavior including safety system characteristic is analyzed by system code ATHLET-SC, whereas the local thermal-hydraulic parameters are predicted by the sub-channel code COBRA-SC. Sensitivity analysis are carried out respectively in ATHLET-SC and COBRA-SC code, to identify the appropriate models for description of the flow blockage phenomenon in the test loop. Some measures to mitigate the accident consequence are also trialed to demonstrate their effectiveness. The results indicate that the new developed code has good feasibility to transient analysis of supercritical water-cooled test. And the peak cladding temperature caused by blockage in the fuel assembly can be reduced effectively by the safety measures of SCWR-FQT. (author)

78 FR 63570 - Proposed Collection; Comment Request for Forms W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY

Science.gov (United States)

2013-10-24

... W-8BEN, W-8BEN-E, W-8ECI, W-8EXP, and W-8IMY AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Form W-8BEN, Certificate of Foreign Status of Beneficial Owner for United States Tax Withholding, Form W-8BEN-E, Certificate of Status of Beneficial Owner for...

NCBI nr-aa BLAST: CBRC-MDOM-06-0132 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-06-0132 ref|NP_997055.1| G protein-coupled receptor for asthma susceptibi...rotein coupled receptor 154; AltName: Full=G-protein coupled receptor for asthma susceptibility; AltName: Fu

Estimating Total Fusion Cross Sections by Using a Coupled-Channel Method

Energy Technology Data Exchange (ETDEWEB)

Choi, Ki-Seok; Cheoun, Myung-Ki [Soongsil University, Seoul (Korea, Republic of); Kim, K. S. [Korea Aerospace University, Koyang (Korea, Republic of); Kim, T. H.; So, W. Y. [Kangwon National University at Dogye, Samcheok (Korea, Republic of)

2017-01-15

We calculate the total fusion cross sections for the {sup 6}He + {sup 209}Bi, {sup 6}Li + {sup 209}Bi,{sup 9}Be + {sup 208}Pb, {sup 10}Be + {sup 209}Bi, and {sup 11}Li + {sup 208}Pb systems by using a coupled-channel (CC) method and compare the results with the experimental data. In the CC approach for the total fusion cross sections, we exploit a globally determined Wood-Saxon potential with Aky¨uz-Winther parameters and couplings of the ground state to the low-lying excited states in the projectile and the target nuclei. The total fusion cross sections obtained with the CC are compared with those obtained without the CC couplings. The latter approach is tantamount to a one-dimensional barrier penetration model. Finally, our approach is applied to understand new data for the {sup 11}Li+{sup 208}Pb system. Possible ambiguities inherent in those approaches are discussed in detail for further applications to the fusion system of halo and/or neutron-rich nuclei.

Piezoelectric coupling in a field-effect transistor with a nanohybrid channel of ZnO nanorods grown vertically on graphene.

Science.gov (United States)

Quang Dang, Vinh; Kim, Do-Il; Thai Duy, Le; Kim, Bo-Yeong; Hwang, Byeong-Ung; Jang, Mi; Shin, Kyung-Sik; Kim, Sang-Woo; Lee, Nae-Eung

2014-12-21

Piezoelectric coupling phenomena in a graphene field-effect transistor (GFET) with a nano-hybrid channel of chemical-vapor-deposited Gr (CVD Gr) and vertically aligned ZnO nanorods (NRs) under mechanical pressurization were investigated. Transfer characteristics of the hybrid channel GFET clearly indicated that the piezoelectric effect of ZnO NRs under static or dynamic pressure modulated the channel conductivity (σ) and caused a positive shift of 0.25% per kPa in the Dirac point. However, the GFET without ZnO NRs showed no change in either σ or the Dirac point. Analysis of the Dirac point shifts indicated transfer of electrons from the CVD Gr to ZnO NRs due to modulation of their interfacial barrier height under pressure. High responsiveness of the hybrid channel device with fast response and recovery times was evident in the time-dependent behavior at a small gate bias. In addition, the hybrid channel FET could be gated by mechanical pressurization only. Therefore, a piezoelectric-coupled hybrid channel GFET can be used as a pressure-sensing device with low power consumption and a fast response time. Hybridization of piezoelectric 1D nanomaterials with a 2D semiconducting channel in FETs enables a new design for future nanodevices.

Coupled-channel dynamics in the Nambu--Jona-Lasinio model

International Nuclear Information System (INIS)

Celenza, L.S.; Pantziris, A.; Shakin, C.M.; Szweda, J.

1993-01-01

We study the scalar-isoscalar sector of the Nambu--Jona-Lasinio (NJL) model and extend the model to include a description of the coupling of the quark-antiquark states to the two-pion continuum. The q bar q interaction gives rise to a sigma meson, which takes on a width and energy shift that depends upon the strength of the coupling for q+bar q→π+π. (For weak channel coupling, the resonance is located at the mass of the sigma, m σ congruent 2m q cons , where m q cons is the constituent quark mass of the NJL model.) We consider two models for the q bar q→ππ coupling. In the first model, we find a low-energy resonance, with the resonance energy E R ≤2m q cons . We then see that the values, obtained from the analysis of experimental data, of the scalar-isoscalar phase shift describing ππ scattering δ 0 0 , are not compatible with the existence of a low-mass sigma. In the second model, the resonance is pushed upward into the region of the two-quark continuum, E R >2m q cons . This second model provides an example of a phenomenon where the behavior of the q bar q T matrix is parametrized for q 2 ≤0 by a mass that is smaller than the physical mass that characterizes the pole in the T matrix. The behavior of the second model suggests how the absence of experimental evidence for a low-mass sigma may be reconciled with the importance of such a meson in nuclear structure studies

Coupled channel calculations for electron-positron pair production in collisions of heavy ions

CERN Document Server

Gail, M; Scheid, W

2003-01-01

Coupled channel calculations are performed for electron-positron pair production in relativistic collisions of heavy ions. For this purpose the wavefunction is expanded into different types of basis sets consisting of atomic wavefunctions centred around the projectile ion only and around both of the colliding nuclei. The results are compared with experimental data from Belkacem et al (1997 Phys. Rev. A 56 2807).

Coupled channel theory of pion--deuteron reaction applied to threshold scattering

International Nuclear Information System (INIS)

Mizutani, T.; Koltun, D.S.

1977-01-01

Scattering and absorption of pions by a nuclear target are treated together in a coupled channel theory. The theory is developed explicitly for the problem of pion scattering and absorption by a deuteron. The equations are presented in terms of the integral equations of three-body scattering theory. The method is then applied in an approximate from to calculate the contribution of pion absorption to the scattering length for pion--deuteron scattering. The sensitivity of the calculated results to the model assumptions and approximations is investigated

Some tools of the trade we've developed for our cross-section calculations

International Nuclear Information System (INIS)

Gardner, D.G.; Gardner, M.A.

1992-11-01

A number of compute codes have been modified or developed, both main-frame and PC. Seven codes, of which three are discussed in some detail. The later are: a controller-driven, double-precision version of the coupled-channel code ECIS; the latest version of STAPRE, a precompound plus Hauser-Feshbach nuclear reaction code; and NUSTART, a PC code that analyzes large sets of discrete nuclear levels and the multipole transitions among them. All main-frame codes are now being converted to the UNICOS operating system

Coupled channel folding model description of α scattering from 9Be

International Nuclear Information System (INIS)

Roy, S.; Chatterjee, J.M.; Majumdar, H.; Datta, S.K.; Banerjee, S.R.; Chintalapudi, S.N.

1995-01-01

Alpha scattering from 9 Be at E α = 65 MeV is described in the coupled channel framework with phenomenological as well as folded potentials. The multipole components of the deformed density of 9 Be are derived from Nilsson model wave functions. Reasonably good agreements are obtained for the angular distributions of 3/2 - (g.s.) and 5/2 - (2.43 MeV) states of the ground state band with folded potentials. The deformation predicted by the model corroborates with that derived from the phenomenological analysis with potentials of different geometries

cAMP control of HCN2 channel Mg2+ block reveals loose coupling between the cyclic nucleotide-gating ring and the pore.

Directory of Open Access Journals (Sweden)

Alex K Lyashchenko

Full Text Available Hyperpolarization-activated cyclic nucleotide-regulated HCN channels underlie the Na+-K+ permeable IH pacemaker current. As with other voltage-gated members of the 6-transmembrane KV channel superfamily, opening of HCN channels involves dilation of a helical bundle formed by the intracellular ends of S6 albeit this is promoted by inward, not outward, displacement of S4. Direct agonist binding to a ring of cyclic nucleotide-binding sites, one of which lies immediately distal to each S6 helix, imparts cAMP sensitivity to HCN channel opening. At depolarized potentials, HCN channels are further modulated by intracellular Mg2+ which blocks the open channel pore and blunts the inhibitory effect of outward K+ flux. Here, we show that cAMP binding to the gating ring enhances not only channel opening but also the kinetics of Mg2+ block. A combination of experimental and simulation studies demonstrates that agonist acceleration of block is mediated via acceleration of the blocking reaction itself rather than as a secondary consequence of the cAMP enhancement of channel opening. These results suggest that the activation status of the gating ring and the open state of the pore are not coupled in an obligate manner (as required by the often invoked Monod-Wyman-Changeux allosteric model but couple more loosely (as envisioned in a modular model of protein activation. Importantly, the emergence of second messenger sensitivity of open channel rectification suggests that loose coupling may have an unexpected consequence: it may endow these erstwhile "slow" channels with an ability to exert voltage and ligand-modulated control over cellular excitability on the fastest of physiologically relevant time scales.

Coupling of unidimensional neutron kinetics to thermal hydraulics in parallel channels; Acoplamiento de cinetica neutronica unidimensional a canales termohidraulicos en paralelo

Energy Technology Data Exchange (ETDEWEB)

Cecenas F, M.; Campos G, R.M. [IIE, Av. Reforma 113, Col. Palmira, Cuernavaca, Morelos (Mexico)]. e-mail: mcf@iie.org.mx

2003-07-01

In this work the dynamic behavior of a consistent system in fifteen channels in parallel that represent the reactor core of a BWR type, coupled of a kinetic neutronic model in one dimension is studied by means of time series. The arrangement of channels is obtained collapsing the assemblies that it consists the core to an arrangement of channels prepared in straight lines, and it is coupled to the unidimensional solution of the neutron diffusion equation. This solution represents the radial power distribution, and initially the static solution is obtained to verify that the one modeling core is critic. The coupled set nuclear-thermal hydraulics it is solved numerically by means of a net of CPUs working in the outline teacher-slave by means of Parallel Virtual Machine (PVM), subject to the restriction that the pressure drop is equal for each channel, which is executed iterating on the refrigerant distribution. The channels are dimensioned according to the one Stability Benchmark of the Ringhals swedish plant, organized by the Nuclear Energy Agency in 1994. From the information of this benchmark it is obtained the axial power profile for each channel, which is assumed as invariant in the time. To obtain the time series, the system gets excited with white noise (sequence that statistically obeys to a normal distribution with zero media), so that the power generated in each channel it possesses the same ones characteristics of a typical signal obtained by means of the acquisition of those signals of neutron flux in a BWR reactor. (Author)

High-slope-efficiency 2.06 μm Ho: YLF laser in-band pumped by a fiber-coupled broadband diode.

Science.gov (United States)

Ji, Encai; Liu, Qiang; Nie, Mingming; Cao, Xuezhe; Fu, Xing; Gong, Mali

2016-03-15

We first demonstrate the laser performance of a compact 2.06 μm Ho: YLF laser resonantly pumped by a broadband fiber-coupled diode. In continuous-wave (CW) operation, maximum output power of 1.63 W, corresponding to a slope efficiency of 89.2%, was obtained with a near diffraction-limited beam quality. In actively Q-switched operation, maximum pulse energy of 1.1 mJ was achieved at the repetition frequency of 100 Hz. The minimum pulse duration was 43 ns. The performance in both the CW and Q-switched regimes indicates that the current fiber-coupled diode in-band pumped Ho: YLF laser has great potential in certain conditions that require several watts of output power or several millijoules of short pulse energy.

Calculation of spin-dependent observables in electron-sodium scattering using the coupled-channel optical method

International Nuclear Information System (INIS)

Bray, Igor.

1992-04-01

The calculations of the 3 2 S and 3 2 P spin asymmetries and the angular momentum for singlet and triplet scattering for projectile energies of 10 and 20 eV is presented. Together these observables give a most stringent test of any electron-atom scattering theory. An excellent agreement was found between the results of the coupled-channel optical method and experiment, which for the spin asymmetries can only be obtained by a good description of the couplings between the lower-lying target states and the target continuum. 10 refs., 2 figs

Importance of channel coupling for very large angle proton-nucleus scattering and the failure of the optical model

International Nuclear Information System (INIS)

Amado, R.D.; Sparrow, D.A.

1984-01-01

The importance of inelastic channels in proton-nucleus scattering grows with momentum transfer, q, so that for large q coupled channels are required. This happens when the elastic and inelastic cross sections become comparable. We incorporate these ideas in a simple analytic framework to explain the large angle p- 208 Pb elastic scattering data at 800 MeV for which standard optical model calculations have failed completely

Inelastic scattering of polarized protons and nuclear deformation in 16O, 18O

International Nuclear Information System (INIS)

de Swiniarski, R.; Pham, D.L.

1984-01-01

Many data concerning inelastic scattering of polarized protons at intermediate energy are now available. We have analyzed some of these data coming from LAMPF at 800 MeV for 16 O (6) and 18 O (7) in order to further study nuclear deformations for these light nuclei. Analyzing powers (A(theta)) and cross-sections ((σ/theta)) for elastic and inelastic scattering of 800 MeV polarized protons from 16 O and 18 O have been analyzed in the coupled-channels (CC) collective model using the code ECIS from Raynal

Development of sub-channel code SACoS and its application in coupled neutronics/thermal hydraulics system for SCWR

International Nuclear Information System (INIS)

Chaudri, Khurrum Saleem; Su Yali; Chen Ronghua; Tian Wenxi; Su Guanghui; Qiu Suizheng

2012-01-01

Highlights: ► A tool is developed for coupled neutronics/thermal-hydraulic analysis for SCWR. ► For thermal hydraulic analysis, a sub-channel code SACoS is developed and verified. ► Coupled analysis agree quite well with the reference calculations. ► Different choice of important parameters makes huge difference in design calculations. - Abstract: Supercritical Water Reactor (SCWR) is one of the promising reactors from the list of fourth generation of nuclear reactors. High thermal efficiency and low cost of electricity make it an attractive option in the era of growing energy demand. An almost seven fold density variation for coolant/moderator along the active height does not allow the use of constant density assumption for design calculations, as used for previous generations of reactors. The advancement in computer technology gives us the superior option of performing coupled analysis. Thermal hydraulics calculations of supercritical water systems present extra challenges as not many computational tools are available to perform that job. This paper introduces a new sub-channel code called Sub-channel Analysis Code of SCWR (SACoS) and its application in coupled analyses of High Performance Light Water Reactor (HPLWR). SACoS can compute the basic thermal hydraulic parameters needed for design studies of a supercritical water reactor. Multiple heat transfer and pressure drop correlations are incorporated in the code according to the flow regime. It has the additional capability of calculating the thermal hydraulic parameters of moderator flowing in water box and between fuel assemblies under co-current or counter current flow conditions. Using MCNP4c and SACoS, a coupled system has been developed for SCWR design analyses. The developed coupled system is verified by performing and comparing HPLWR calculations. The results were found to be in very good agreement. Significant difference between the results was seen when Doppler feedback effect was included in

Channel coupling and distortion effects in the excitation of the 02+ state in 12C by alpha scattering

International Nuclear Information System (INIS)

Bauhoff, W.

1983-01-01

The excitation of the 0 2 + (7.65 MeV) state in 12 C by inelastic alpha scattering is investigated using microscopic resonating-group wave-functions in a coupled channel folding model. The importance of coupling to other states and the influence of varying the optical potential in the excited states is studied. Both effects must be taken into account for a quantitative description

A ligand channel through the G protein coupled receptor opsin.

Directory of Open Access Journals (Sweden)

Peter W Hildebrand

Full Text Available The G protein coupled receptor rhodopsin contains a pocket within its seven-transmembrane helix (TM structure, which bears the inactivating 11-cis-retinal bound by a protonated Schiff-base to Lys296 in TM7. Light-induced 11-cis-/all-trans-isomerization leads to the Schiff-base deprotonated active Meta II intermediate. With Meta II decay, the Schiff-base bond is hydrolyzed, all-trans-retinal is released from the pocket, and the apoprotein opsin reloaded with new 11-cis-retinal. The crystal structure of opsin in its active Ops* conformation provides the basis for computational modeling of retinal release and uptake. The ligand-free 7TM bundle of opsin opens into the hydrophobic membrane layer through openings A (between TM1 and 7, and B (between TM5 and 6, respectively. Using skeleton search and molecular docking, we find a continuous channel through the protein that connects these two openings and comprises in its central part the retinal binding pocket. The channel traverses the receptor over a distance of ca. 70 A and is between 11.6 and 3.2 A wide. Both openings are lined with aromatic residues, while the central part is highly polar. Four constrictions within the channel are so narrow that they must stretch to allow passage of the retinal beta-ionone-ring. Constrictions are at openings A and B, respectively, and at Trp265 and Lys296 within the retinal pocket. The lysine enforces a 90 degrees elbow-like kink in the channel which limits retinal passage. With a favorable Lys side chain conformation, 11-cis-retinal can take the turn, whereas passage of the all-trans isomer would require more global conformational changes. We discuss possible scenarios for the uptake of 11-cis- and release of all-trans-retinal. If the uptake gate of 11-cis-retinal is assigned to opening B, all-trans is likely to leave through the same gate. The unidirectional passage proposed previously requires uptake of 11-cis-retinal through A and release of photolyzed all

Larkin Mill Dam channel geometry from 2008-06-09 to 2010-06-16 (NCEI Accession 0152472)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — We are collecting stream channel geometry and bed sediment grain size distribution data at the Parker River to evaluate physical habitat changes associated with the...

Research on out-phase oscillation in a nuclear-coupled parallel double-channel boiling system

International Nuclear Information System (INIS)

Zhou Linglan; Zhang Hong; Liu Yu; Zang Xi'nian

2011-01-01

In this paper, the RELAP5 thermal-hydraulic system code is coupled with the TDOT-T 3D neutron kinetic code by PVM (Parallel Virtual Machine). A parallel double-channel boiling system is built by the coupled code and the instability boundary of out-of-phase oscillation in the system is obtained. The effects of axis power distribution and neutron feedback on the out-of-phase oscillation are analyzed in details. It is found that there are type-Ⅰ and type-Ⅱ density wave oscillation regions when the axial power peak is located at upstream of the heating section. At relatively lower values of fuel time constant, the neutron feedback always delays both types of density wave oscillations. (authors)

Traveling Wave-Guide Channels of a New Coupled Integrable Dispersionless System

International Nuclear Information System (INIS)

Souleymanou, Abbagari; Kuetche, Victor K.; Bouetou, Thomas B.; Kofane, Timoleon C.

2012-01-01

In the wake of the recent investigation of new coupled integrable dispersionless equations by means of the Darboux transformation [Zhaqilao, et al., Chin. Phys. B 18 (2009) 1780], we carry out the initial value analysis of the previous system using the fourth-order Runge-Kutta's computational scheme. As a result, while depicting its phase portraits accordingly, we show that the above dispersionless system actually supports two kinds of solutions amongst which the localized traveling wave-guide channels. In addition, paying particular interests to such localized structures, we construct the bilinear transformation of the current system from which scattering amongst the above waves can be deeply studied. (general)

Wave failure at strong coupling in intracellular C a2 + signaling system with clustered channels

Science.gov (United States)

Li, Xiang; Wu, Yuning; Gao, Xuejuan; Cai, Meichun; Shuai, Jianwei

2018-01-01

As an important intracellular signal, C a2 + ions control diverse cellular functions. In this paper, we discuss the C a2 + signaling with a two-dimensional model in which the inositol 1,4,5-trisphosphate (I P3 ) receptor channels are distributed in clusters on the endoplasmic reticulum membrane. The wave failure at large C a2 + diffusion coupling is discussed in detail in the model. We show that with varying model parameters the wave failure is a robust behavior with either deterministic or stochastic channel dynamics. We suggest that the wave failure should be a general behavior in inhomogeneous diffusing systems with clustered excitable regions and may occur in biological C a2 + signaling systems.

Optimization of nanoparticle focusing by coupling thermophoresis and engineered vortex in a microfluidic channel

Science.gov (United States)

Zhao, Chao; Cao, Zhibo; Fraser, John; Oztekin, Alparslan; Cheng, Xuanhong

2017-01-01

Enriching nanoparticles in an aqueous solution is commonly practiced for various applications. Despite recent advances in microfluidic technologies, a general method to concentrate nanoparticles in a microfluidic channel in a label free and continuous flow fashion is not yet available, due to strong Brownian motion on the nanoscale. Recent research of thermophoresis indicates that thermophoretic force can overcome the Brownian force to direct nanoparticle movement. Coupling thermophoresis with natural convection on the microscale has been shown to induce significant enrichment of biomolecules in a thermal diffusion column. However, the column operates in a batch process, and the concentrated samples are inconvenient to retrieve. We have recently designed a microfluidic device that combines a helical fluid motion and simple one-dimensional temperature gradient to achieve effective nanoparticle focusing in a continuous flow. The helical convection is introduced by microgrooves patterned on the channel floor, which directly controls the focusing speed and power. Here, COMSOL simulations are conducted to study how the device geometry and flow rate influence transport and subsequent nanoparticle focusing, with a constant temperature gradient. The results demonstrate a complex dependence of nanoparticle accumulation on the microgroove tilting angle, depth, and spacing, as well as channel width and flow rate. Further dimensional analyses reveal that the ratio between particle velocities induced by thermophoretic and fluid inertial forces governs the particle concentration factor, with a maximum concentration at a ratio of approximately one. This simple relationship provides fundamental insights about nanoparticle transport in coupled flow and thermal fields. The study also offers a useful guideline to the design and operation of nanoparticle concentrators based on combining engineered helical fluid motion subject to phoretic fields.

Local anesthetics disrupt energetic coupling between the voltage-sensing segments of a sodium channel.

Science.gov (United States)

Muroi, Yukiko; Chanda, Baron

2009-01-01

Local anesthetics block sodium channels in a state-dependent fashion, binding with higher affinity to open and/or inactivated states. Gating current measurements show that local anesthetics immobilize a fraction of the gating charge, suggesting that the movement of voltage sensors is modified when a local anesthetic binds to the pore of the sodium channel. Here, using voltage clamp fluorescence measurements, we provide a quantitative description of the effect of local anesthetics on the steady-state behavior of the voltage-sensing segments of a sodium channel. Lidocaine and QX-314 shifted the midpoints of the fluorescence-voltage (F-V) curves of S4 domain III in the hyperpolarizing direction by 57 and 65 mV, respectively. A single mutation in the S6 of domain IV (F1579A), a site critical for local anesthetic block, abolished the effect of QX-314 on the voltage sensor of domain III. Both local anesthetics modestly shifted the F-V relationships of S4 domain IV toward hyperpolarized potentials. In contrast, the F-V curve of the S4 domain I was shifted by 11 mV in the depolarizing direction upon QX-314 binding. These antagonistic effects of the local anesthetic indicate that the drug modifies the coupling between the voltage-sensing domains of the sodium channel. Our findings suggest a novel role of local anesthetics in modulating the gating apparatus of the sodium channel.

Coupled channel folding model description of {alpha} scattering from {sup 9}Be

Energy Technology Data Exchange (ETDEWEB)

Roy, S.; Chatterjee, J.M.; Majumdar, H. [Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Calcutta 700064 (India); Datta, S.K. [Nuclear Science Centre, P.O.10502, New Delhi 110067 (India); Banerjee, S.R. [Variable Energy Cyclotron Centre, 1/AF Bidhannagar, Calcutta 700064 (India); Chintalapudi, S.N. [Inter-University Consortium, Department of Atomic Energy Facilities, Bidhannagar, Calcutta 700064 (India)

1995-09-01

Alpha scattering from {sup 9}Be at {ital E}{sub {alpha}}= 65 MeV is described in the coupled channel framework with phenomenological as well as folded potentials. The multipole components of the deformed density of {sup 9}Be are derived from Nilsson model wave functions. Reasonably good agreements are obtained for the angular distributions of 3/2{sup {minus}}(g.s.) and 5/2{sup {minus}}(2.43 MeV) states of the ground state band with folded potentials. The deformation predicted by the model corroborates with that derived from the phenomenological analysis with potentials of different geometries.

Irreversibility analysis of hydromagnetic flow of couple stress fluid with radiative heat in a channel filled with a porous medium

Directory of Open Access Journals (Sweden)

A.S. Eegunjobi

Full Text Available Numerical analysis of the intrinsic irreversibility of a mixed convection hydromagnetic flow of an electrically conducting couple stress fluid through upright channel filled with a saturated porous medium and radiative heat transfer was carried out. The thermodynamics first and second laws were employed to examine the problem. We obtained the dimensionless nonlinear differential equations and solves numerically with shooting procedure joined with a fourth order Runge-Kutta-Fehlberg integration scheme. The temperature and velocity obtained, used to analyse the entropy generation rate together with some various physical parameters of the flow. Our results are presented graphically and talk over. Keywords: MHD channel flow, Couple stress fluid, Porous medium, Thermal radiation, Entropy generation, Injection/suction

Voltage-sensing domain mode shift is coupled to the activation gate by the N-terminal tail of hERG channels.

Science.gov (United States)

Tan, Peter S; Perry, Matthew D; Ng, Chai Ann; Vandenberg, Jamie I; Hill, Adam P

2012-09-01

Human ether-a-go-go-related gene (hERG) potassium channels exhibit unique gating kinetics characterized by unusually slow activation and deactivation. The N terminus of the channel, which contains an amphipathic helix and an unstructured tail, has been shown to be involved in regulation of this slow deactivation. However, the mechanism of how this occurs and the connection between voltage-sensing domain (VSD) return and closing of the gate are unclear. To examine this relationship, we have used voltage-clamp fluorometry to simultaneously measure VSD motion and gate closure in N-terminally truncated constructs. We report that mode shifting of the hERG VSD results in a corresponding shift in the voltage-dependent equilibrium of channel closing and that at negative potentials, coupling of the mode-shifted VSD to the gate defines the rate of channel closure. Deletion of the first 25 aa from the N terminus of hERG does not alter mode shifting of the VSD but uncouples the shift from closure of the cytoplasmic gate. Based on these observations, we propose the N-terminal tail as an adaptor that couples voltage sensor return to gate closure to define slow deactivation gating in hERG channels. Furthermore, because the mode shift occurs on a time scale relevant to the cardiac action potential, we suggest a physiological role for this phenomenon in maximizing current flow through hERG channels during repolarization.

Fast neutron scattering from soft nuclei: coupled-channel formalism and illustrations

International Nuclear Information System (INIS)

Delaroche, J.P.

1986-01-01

Spectra of most of the even-even nuclei have a character which is neither that of a pure vibrator nor that of a pure rotor. Instead, the nuclear spectra display very often both characters. Therefore, improvements in the analysises of nucleon scattering and reaction cross sections require that appropriate collective models of nuclear structure be used. A selection of these models is reviewed, and suggestions are given as to how to extend the familiar coupled-channel formalism to incorporate these enriched collective pictures. These extensions are primarily intended to describe inelastic scattering from levels belonging to β - , γ - and octupole bands. Illustrations are given for neutron and proton scattering off various nuclei [fr

A 1D-2D coupled SPH-SWE model applied to open channel flow simulations in complicated geometries

Science.gov (United States)

Chang, Kao-Hua; Sheu, Tony Wen-Hann; Chang, Tsang-Jung

2018-05-01

In this study, a one- and two-dimensional (1D-2D) coupled model is developed to solve the shallow water equations (SWEs). The solutions are obtained using a Lagrangian meshless method called smoothed particle hydrodynamics (SPH) to simulate shallow water flows in converging, diverging and curved channels. A buffer zone is introduced to exchange information between the 1D and 2D SPH-SWE models. Interpolated water discharge values and water surface levels at the internal boundaries are prescribed as the inflow/outflow boundary conditions in the two SPH-SWE models. In addition, instead of using the SPH summation operator, we directly solve the continuity equation by introducing a diffusive term to suppress oscillations in the predicted water depth. The performance of the two approaches in calculating the water depth is comprehensively compared through a case study of a straight channel. Additionally, three benchmark cases involving converging, diverging and curved channels are adopted to demonstrate the ability of the proposed 1D and 2D coupled SPH-SWE model through comparisons with measured data and predicted mesh-based numerical results. The proposed model provides satisfactory accuracy and guaranteed convergence.

Coupled channels description of single and mutual excitation in the scatttering of 7Li from 12C and sup(24,26)Mg

International Nuclear Information System (INIS)

Cook, J.; Clarke, N.M.; Coopersmith, J.; Griffiths, R.J.

1982-01-01

Coupled channels calculations have been made for the scattering of 7 Li from 12 C at 63 and 79 MeV and from sup(24,26)Mg at 88 MeV. The calculations describe, simultaneously, the elastic scattering, excitation of 7 Li to the 478 keV 1/2 - state, excitation of the target to its first 2 + state, and the mutual excitation of both projectile and target to their 1/2 - and 2 + states respectively. The potentials have been used for the ground states of 7 Li, 12 C and sup(24,26)Mg and also the transition densities to the excited states using a microscopic plus macroscopic prescription. For the mutual excitation, both one-step processes with iota = 0, 2 and 4 and two-step processes were included. The calculations show that the two-step processes are the dominant contribution to the mutual excitation, but at forward angles, the oscillations in the data are only reproduced with the coherent addition of the one-step processes, which are dominated by the iota = 4 contribution. Even when coupling to all single and mutual excitations are included the real potential still requires a normalization of about 0.6. The addition of the quadrupole re-orientation matrix element for the ground state dows not significantly change this value. These calculations confirm that the coupling to the first excited inelastic levels of target and ejectile is not the source of the anomalous M3Y normalization, and that the dominant mode of mutual excitation is a two-step processes. However, direct one-step mutual excitation is important for small angles (THETA approx. 0 ). (orig.)

Investigating the relationship between watching satellite channels and intimacy and marital satisfaction of couples in Isfahan, Iran, in 2014

OpenAIRE

Babaie, Zohre; Keshvari, Mahrokh; Zamani, Ahmadreza

2016-01-01

Background: In the age of communication and media that families are rapidly driven towards using satellite channels and other media, considering family health in this regard is essential. A determinant of health is marital satisfaction. The aim of this study was to investigate the relationship between watching satellite channels and intimacy and marital satisfaction in Isfahan, Iran. Materials and Methods: This cross-sectional and correlational study was conducted on one group of 480 couples ...

/sup 16/O(/sup 16/O, /sup 12/C)/sup 20/Ne reaction in the framework of the coupled channel formalism

Energy Technology Data Exchange (ETDEWEB)

Krause, O; Scheid, W; Greiner, W [Frankfurt Univ. (Germany, F.R.). Inst. fuer Theoretische Physik

1974-01-01

The transfer reaction /sup 16/O(/sup 16/O, /sup 12/C)/sup 20/Ne is treated in the coupled channel formalism. The influence of the transfer channels on the intermediate structure in the elastic excitation function is discussed. The /sup 16/O and /sup 20/Ne-nuclei are described in an ..cap alpha..-cluster model.

NCBI nr-aa BLAST: CBRC-CELE-06-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CELE-06-0037 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 2e-38 29% ...

Development of the coupled 'system thermal-hydraulics, 3D reactor kinetics, and hot channel' analysis capability of the MARS code

Energy Technology Data Exchange (ETDEWEB)

Jeong, J. J.; Chung, B. D.; Lee, W.J

2005-02-01

The subchannel analysis capability of the MARS 3D module has been improved. Especially, the turbulent mixing and void drift models for flow mixing phenomena in rod bundles have been assessed using some well-known rod bundle test data. Then, the subchannel analysis feature was combined to the existing coupled 'system Thermal-Hydraulics (T/H) and 3D reactor kinetics' calculation capability of MARS. These features allow the coupled 'system T/H, 3D reactor kinetics, and hot channel' analysis capability and, thus, realistic simulations of hot channel behavior as well as global system T/H behavior. In this report, the MARS code features for the coupled analysis capability are described first. The code modifications relevant to the features are also given. Then, a coupled analysis of the Main Steam Line Break (MSLB) is carried out for demonstration. The results of the coupled calculations are very reasonable and realistic, and show these methods can be used to reduce the over-conservatism in the conventional safety analysis.

On-line coupling of sample preconcentration by LVSEP with gel electrophoretic separation on T-channel chips.

Science.gov (United States)

Kitagawa, Fumihiko; Kinami, Saeko; Takegawa, Yuuki; Nukatsuka, Isoshi; Sueyoshi, Kenji; Kawai, Takayuki; Otsuka, Koji

2017-01-01

To achieve an on-line coupling of the sample preconcentration by a large-volume sample stacking with an electroosmotic flow pump (LVSEP) with microchip gel electrophoresis (MCGE), a sample solution, a background solution for LVSEP and a sieving solution for MCGE were loaded in a T-form channel and three reservoirs on PDMS microchips. By utilizing the difference in the flow resistance of the two channels, a low-viscosity sample and a viscous polymer solution were easily introduced into the LVSEP and MCGE channels, respectively. Fluorescence imaging of the sequential LVSEP-MCGE processes clearly demonstrated that a faster stacking of anionic fluorescein and successive introduction into the MCGE channel can be carried out on the T-channel chip. To evaluate the preconcentration performance, a conventional MCZE analysis of fluorescein on the cross-channel chip was compared with LVSEP-MCGE on the short T-channel chip, and as a result that the value of sensitive enhancement factor (SEF) was estimated to be 370. The repeatability of the peak height was good with the RSD value of 3.2%, indicating the robustness of the enrichment performance. In the successive LVSEP-MCGE analysis of φX174/HaeIII digest, the DNA fragments were well enriched to a sharp peak in the LVSEP channel, and they were separated in the MCGE channel, whose electropherogram was well-resembled with that in the conventional MCGE. The values of SEF for the DNA fragments were calculated to be ranging from 74 to 108. Thus, the successive LVSEP-MCGE analysis was effective for both preconcentrating and separating DNA fragments. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Coupled channel effects in quasi-elastic barrier distributions of 16,18O + 206Pb systems

International Nuclear Information System (INIS)

Jha, V.; Roy, B.J.; Parkar, V.V.; Kumawat, H.; Pal, U.K.; Pandit, S.K.; Mahata, K.; Shrivastava, A.; Mohanty, A.K.

2013-01-01

The fusion barrier distribution and QEBD for the 16 O + 208 Pb have been studied in great detail. The couplings due to the collective excitations of the colliding nuclei are found to have the dominant effect as deduced by the conventional coupled-channels calculations used to explain the experimental QEBD and fusion barrier distributions. In contrast, for the 18 O + 206 Pb system, the role of single neutron stripping (Q-value= -1.308 MeV) and neutron pair transfer (Q-value = + 1.917 MeV) are expected to be significant. In the present work, the QEBD measurements for the 18 O + 206 Pb system are performed for the investigation of these aspects

Search for anomalous Wtb couplings and top FCNC in t-channel single-top-quark events

CERN Document Server

CMS Collaboration

2014-01-01

Single-top-quark events in the $t$-channel are used to probe Wtb anomalous couplings and to search for top quark Flavor Changing Neutral Current (FCNC) interactions in proton-proton collisions at $\\sqrt{s}=7$ TeV. The analyzed data correspond to an integrated luminosity of 5~fb$^{-1}$. Events with the top quark decaying into a muon, neutrino and b-quark are selected. A Bayesian neural network is used to discriminate between signal and backgrounds. The observed event yields are consistent with SM prediction, and exclusion limits at 95\\% C.L. are determined. The exclusion limits on anomalous right vector and left tensor couplings of the Wtb vertex are found to be $|f_{V}^{R}|< 0.34$ and $|f_{T}^{L}|<0.09$. In the scenarios with FCNC tcg and tug couplings, limits on the coupling strengths are found to be $\\kappa_{tug}/\\Lambda < 1.8 \\cdot 10^{-2}~ \\mathrm{TeV^{-1}},\\ \\kappa_{tcg}/\\Lambda < 5.6 \\cdot 10^{-2} ~ \\mathrm{TeV^{-1}}$ which corresponds to limits on the branching ratios $Br(t~\\rightarrow~u+g)...

Singlet channel coupling in deuteron elastic scattering at intermediate energies

International Nuclear Information System (INIS)

Al-Khalili, J.S.; Tostevin, J.A.; Johnson, R.C.

1990-01-01

Intermediate energy deuteron elastic scattering is investigated in a three-body model incorporating relativistic kinematics. The effects of deuteron breakup to singlet spin intermediate states, on the elastic scattering observables for the 58 Ni(d vector, d) 58 Ni reaction at 400 and 700 MeV, are studied quantitatively. The singlet-breakup contributions to the elastic amplitude are estimated within an approximate two-step calculation. The calculation makes an adiabatic approximation in the intermediate states propagator which allows the use of closure over the np intermediate states continuum. The singlet channel coupling is found to produce large effects on the calculated reaction tensor analysing power A yy , characteristic of a dynamically induced second-rank tensor interaction. By inspection of the calculated breakup amplitudes we show this induced interaction to be of the T L tensor type. (orig.)

Measurement and analysis of channel attenuation characteristics for an implantable galvanic coupling human-body communication.

Science.gov (United States)

Zhang, Shuang; Pun, Sio Hang; Mak, Peng Un; Qin, Yu-Ping; Liu, Yi-He; Vai, Mang I

2016-11-14

In this study, an experiment was designed to verify the low power consumption of galvanic coupling human-body communication. A silver electrode (silver content: 99%) is placed in a pig leg and a sine wave signal with the power of 0 dBm is input. Compared with radio frequency communication and antenna transmission communication, attenuation is reduced by approximately 10 to 15 dB, so channel characteristics are highly improved.

The coupled-channel T-matrix: its lowest-order Born + Lanczos approximants

International Nuclear Information System (INIS)

Znojil, M.

1995-01-01

Three iterative methods of solution of the Lippmann-Schwinger equations (viz., the method of continued fractions by J.Horacek and T.Sasakawa), its Born-remainder modification and a coupled-channel matrix-continued-fraction generalization are all interpreted as special cases of a common iterative matrix prescription. Firstly, in terms of certain asymmetric projectors P≠P + , we re-derive the three particular older methods as different realizations of the well-known Lanczos inversion. Then, a generalized iteration method is proposed as a Born-like re-arrangement of any intermediate Lanczos iteration step. A maximal flexibility is achieved in the formalism which might compete with the standard Pade re-summations in practice. Its first few truncations are listed, therefore. 26 refs., 1 tab

Coupled-channel optical calculation of electron-atom scattering: elastic scattering from sodium at 20 to 150 eV

International Nuclear Information System (INIS)

Bray, Igor; Konovalov, D.A.; McCarthy, I.E.

1991-04-01

A coupled-channel optical method for electron-atom scattering is applied to elastic electron-sodium scattering at energies of 20, 22.1, 54.4, 100, and 150 eV. It is demonstrated that the effect of all the inelastic channels on elastic scattering may be well reproduced by the 'ab initio' calculated complex non-local polarization potential. Whilst the experiments generally agree at small angles and therefore agree on the total elastic cross section, there is considerable discrepancy at intermediate and backward angles. 9 refs., 2 tabs., 1 fig

PLUGM: a coupled thermal-hydraulic computer model for freezing melt flow in a channel

International Nuclear Information System (INIS)

Pilch, M.

1982-01-01

PLUGM is a coupled thermal-hydraulic computer model for freezing liquid flow and plugging in a cold channel. PLUGM is being developed at Sandia National Laboratories for applications in Sandia's ex-vessel Core Retention Concept Assessment Program and in Sandia's LMFBR Transition Phase Program. The purpose of this paper is to introduce PLUGM and demonstrate how it can be used in the analysis of two of the core retention concepts under investigation at Sandia: refractory brick crucibles and particle beds

Two-channel totally asymmetric simple exclusion processes

International Nuclear Information System (INIS)

Pronina, Ekaterina; Kolomeisky, Anatoly B

2004-01-01

Totally asymmetric simple exclusion processes, consisting of two coupled parallel lattice chains with particles interacting with hard-core exclusion and moving along the channels and between them, are considered. In the limit of strong coupling between the channels, the particle currents, density profiles and a phase diagram are calculated exactly by mapping the system into an effective one-channel totally asymmetric exclusion model. For intermediate couplings, a simple approximate theory, that describes the particle dynamics in vertical clusters of two corresponding parallel sites exactly and neglects the correlations between different vertical clusters, is developed. It is found that, similarly to the case of one-channel totally asymmetric simple exclusion processes, there are three stationary state phases, although the phase boundaries and stationary properties strongly depend on inter-channel coupling. Extensive computer Monte Carlo simulations fully support the theoretical predictions

A containment analysis for SBLOCA without ECI in the refurbished Wolsong-1 Nuclear Power Plant

Energy Technology Data Exchange (ETDEWEB)

Kim, T.M.; Moon, B.J.; Bae, C.J.; Lee, S.H.; Choi, C.J.; Lee, D.S. [NSSS, Korea Power Engineering Company, Inc., Daejeon (Korea, Republic of); Kim, S.M. [NETEC, Korea Hydro and Nuclear Power Company, Inc., Daejeon (Korea, Republic of)

2010-07-01

A small break leading to loss of coolant accident (SBLOCA), being one of the topic accidents in the nuclear plant diagnosis in recent years, has been analyzed and evaluated for the refurbished Wolsong-1 Nuclear Power Plant (NPP). The industry standard toolset (IST) codes developed by CANDU Owners Group and updated models including design change parameters are applied to the event analyses. GOTHIC code has been used for the containment analysis of Wolsong-1. Also, SMART-IST code fitted in the Iodine Chemistry (IMOD-2) model has been used to predict nuclide behavior within the containment considering various aspects. IMOD-2 was incorporated into SMART-IST as a module dealing the chemical transformations and mass transfer of iodine species in containment. IMOD-2 model is very sensitive to paint and chemicals. The parameter studies for IMOD-2 model are performed to decide the analysis value set. The developed methodology and the results of SBLOCA without ECI are presented herein. Under the most heat-up conditions, the radionuclide release from the failed fuel into the containment and subsequently to the environment is such that the radioactive doses to the public are below the acceptable limits. (author)

Resonant excitation of coupled Rayleigh waves in a short and narrow fluid channel clad between two identical metal plates

Directory of Open Access Journals (Sweden)

Victor M. García-Chocano

2011-12-01

Full Text Available Transmission of ultrasonic waves through a slit between two water immersed brass plates is studied for sub-wavelength plate thicknesses and slit apertures. Extraordinary high absorption is observed at discrete frequencies corresponding to resonant excitation of Rayleigh waves on the both sides of the channel. The coupling of the Rayleigh waves occurs through the fluid and the corresponding contribution to the dispersion has been theoretically derived and also experimentally confirmed. Symmetric and anti-symmetric modes are predicted but only the symmetric mode resonances have been observed. It follows from the dispersion equation that the coupled Rayleigh waves cannot be excited in a channel with apertures less than the critical one. The calculated critical aperture is in a good agreement with the measured acoustic spectra. These findings could be applied to design a broadband absorptive metamaterial.

Tetraquark candidate Zc(3900) from coupled-channel scattering - how to extract hadronic interactions? -

Science.gov (United States)

Ikeda, Yoichi

2018-03-01

We present recent progress of lattice QCD studies on hadronic interactions which play a crucial role to understand the properties of atomic nuclei and hadron resonances. There are two methods, the plateau method (or the direct method) and the HAL QCD method, to study the hadronic interactions. In the plateau method, the determination of a ground state energy from the temporal correlation functions of multi-hadron systems is a key to reliably extract the physical observables. It turns out that, due to the contamination of excited elastic scattering states nearby, one can easily be misled by a fake plateau into extracting the ground state energy. We introduce a consistency check (sanity check) which can rule out obviously false results obtained from a fake plateau, and find that none of the results obtained at the moment for two-baryon systems in the plateau method pass the test. On the other hand, the HAL QCD method is free from the fake-plateau problem. We investigate the systematic uncertainties of the HAL QCD method, which are found to be well controlled. On the basis of the HAL QCD method, the structure of the tetraquark candidate Zc(3900), which was experimentally reported in e+e- collisions, is studied by the s-wave two-meson coupled-channel scattering. The results show that the Zc(3900) is not a conventional resonance but a threshold cusp. A semi-phenomenological analysis with the coupled-channel interaction to the experimentally observed decay mode is also presented to confirm the conclusion.

Simulation of A Main Steam Line Break Accident Using the Coupled 'System Thermal-Hydraulics, 3D reactor Kinetics, and Hot Channel' Analysis Capability of MARS 3.0

International Nuclear Information System (INIS)

Jeong, Jae Jun; Chung, Bub Dong

2005-09-01

For realistic analysis of thermal-hydraulics (T-H) transients in light water reactors, KAERI has developed the best-estimate T-H system code, MARS. The code has been improved from the consolidated version of the RELAP5/MOD3 and COBRA-TF codes. Then, the MARS code was coupled with a three-dimensional (3-D) reactor kinetics code, MASTER. This coupled calculation feature, in conjunction with the existing hot channel analysis capabilities of the MARS and MASTER codes, allows for more realistic simulations of nuclear system transients. In this work, a main steam line break (MSLB) accident is simulated using the coupled 'system T-H, 3-D reactor kinetics, and hot channel analysis' feature of the MARS code. Two coupled calculations are performed for demonstration. First, a coupled calculation of the 'system T-H and 3-D reactor kinetics' with a refined core T-H nodalization is carried out to obtain global core power and local departure from nucleate boiling (DNB) ratio (DNBR) behaviors. Next, for a more accurate DNBR prediction, another coupled calculation with subchannel meshes for the hot channels is performed. The results of the coupled calculations are very reasonable and consistent so that these can be used to remove the excessive conservatism in the conventional safety analysis

Exploratory study of possible resonances in heavy meson - heavy baryon coupled-channel interactions

Science.gov (United States)

Shen, Chao-Wei; Rönchen, Deborah; Meißner, Ulf-G.; Zou, Bing-Song

2018-01-01

We use a unitary coupled-channel model to study the \\bar{{{D}}}{{{Λ }}}{{c}}-\\bar{{{D}}}{{{Σ }}}{{c}} interactions. In our calculation, SU(3) flavor symmetry is applied to determine the coupling constants. Several resonant and bound states with different spin and parity are dynamically generated in the mass range of the recently observed pentaquarks. The approach is also extended to the hidden beauty sector to study the {{B}}{{{Λ }}}{{b}}-{{B}}{{{Σ }}}{{b}} interactions. As the b-quark mass is heavier than the c-quark mass, there are more resonances observed for the {{B}}{{{Λ }}}{{b}}-{{B}}{{{Σ }}}{{b}} interactions and they are more tightly bound. Supported by DFG and NSFC through funds provided to the Sino-German CRC 110 “Symmetry and the Emergence of Structure in QCD” (NSFC 11621131001, DFG TR110), as well as an NSFC fund (11647601). The work of UGM was also supported by the CAS President’s International Fellowship Initiative (PIFI) (2017VMA0025)

Dynamical coupled-channels model for meson productions and application to strange nuclear physics

International Nuclear Information System (INIS)

Nakamura, S.X.; Kamano, H.; Lee, T.-S.H.; Sato, T.

2013-01-01

We discuss our dynamical coupled-channels (DCC) model in the context of extracting interesting strange nuclear physics from forthcoming J-PARC data. We describe the dynamical contents of the model, and its capability of describing a large amount of data of S=0 sector, namely, πN, γN → πN, ηN, KΛ, KΣ data. Then we discuss future extensions of the DCC model to S ≠ 0 and B ≥ 1 sectors. We emphasize that realistic amplitudes will be essential for extracting interesting physics from data, and the extended DCC model will play an important role there. (author)

Study of doubly excited states of H- and He in the coupled-channel hypersperical adiabatic approach

International Nuclear Information System (INIS)

Abrashkevich, A.G.; Abrashkevich, D.G.; Vinitskij, S.I.; Kaschiev, M.S.; Puzynin, I.V.

1989-01-01

Doubly excited states (DES) of H - and He are investigated within the coupled-channel hyperspherical adiabatic (HSA) approach. Influence of the angular and radial electron correlations on the rate of convergence of the values of the potential curves and matrix elements of radial coupling is studied numerically. The scheme based on molecular classification of the HSA basis states is used for the classification of DES. The results of the multichannel calculations of 1 S e and 1 P 0 DES of H - and He below the second threshold are presented. The obtained results are compared with other calculations and experiment. The region of applicability of the adiabatic approximation is discussed. 75 refs.; 10 tabs

Static and dynamic polarizabilities of Na- within a variationally stable coupled-channel hyperspherical method

International Nuclear Information System (INIS)

Masili, Mauro; Groote, J.J. de

2004-01-01

Using a model potential representation combined with a variationally stable method, we present a precise calculation of the electric dipole polarizabilities of the sodium negative ion (Na - ). The effective two-electron eigensolutions for Na - are obtained from a hyperspherical coupled-channel calculation. This approach allows efficient error control and insight into the system's properties through one-dimensional potential curves. Our result of 1018.3 a.u. for the static dipole polarizability is in agreement with previous calculations and supports our results for the dynamic polarizability, which has scarcely been investigated hitherto

n + 2759Co(En≤20 MeV) nuclear data calculation and analysis

International Nuclear Information System (INIS)

Wang Shunuan

2006-01-01

Whole set of nuclear data calculation in ENDF/B-6 format for n + 27 59 Co (E n ≤20 MeV) has been finished by using spherical optical model, coupled channel optical model, pre-equilibrium exciton model and Hauser-Fashbach equilibrium statistical model. The calculated cross sections, angular distributions, spectrum and double differential cross sections by using codes of APOM, ECIS95 and UNF are compared with all existing experimental data for n + 27 59 Co(E n ≤20 MeV) takefrom EXFOR. The calculated results are analyzed from point of view of theoretical model and model parameters used. The work is for CENDL-3. (authors)

Parallel coupling of symmetric and asymmetric exclusion processes

International Nuclear Information System (INIS)

Tsekouras, K; Kolomeisky, A B

2008-01-01

A system consisting of two parallel coupled channels where particles in one of them follow the rules of totally asymmetric exclusion processes (TASEP) and in another one move as in symmetric simple exclusion processes (SSEP) is investigated theoretically. Particles interact with each other via hard-core exclusion potential, and in the asymmetric channel they can only hop in one direction, while on the symmetric lattice particles jump in both directions with equal probabilities. Inter-channel transitions are also allowed at every site of both lattices. Stationary state properties of the system are solved exactly in the limit of strong couplings between the channels. It is shown that strong symmetric couplings between totally asymmetric and symmetric channels lead to an effective partially asymmetric simple exclusion process (PASEP) and properties of both channels become almost identical. However, strong asymmetric couplings between symmetric and asymmetric channels yield an effective TASEP with nonzero particle flux in the asymmetric channel and zero flux on the symmetric lattice. For intermediate strength of couplings between the lattices a vertical-cluster mean-field method is developed. This approximate approach treats exactly particle dynamics during the vertical transitions between the channels and it neglects the correlations along the channels. Our calculations show that in all cases there are three stationary phases defined by particle dynamics at entrances, at exits or in the bulk of the system, while phase boundaries depend on the strength and symmetry of couplings between the channels. Extensive Monte Carlo computer simulations strongly support our theoretical predictions. Theoretical calculations and computer simulations predict that inter-channel couplings have a strong effect on stationary properties. It is also argued that our results might be relevant for understanding multi-particle dynamics of motor proteins

Simulation of A Main Steam Line Break Accident Using the Coupled 'System Thermal-Hydraulics, 3D reactor Kinetics, and Hot Channel' Analysis Capability of MARS 3.0

Energy Technology Data Exchange (ETDEWEB)

Jeong, Jae Jun; Chung, Bub Dong

2005-09-15

For realistic analysis of thermal-hydraulics (T-H) transients in light water reactors, KAERI has developed the best-estimate T-H system code, MARS. The code has been improved from the consolidated version of the RELAP5/MOD3 and COBRA-TF codes. Then, the MARS code was coupled with a three-dimensional (3-D) reactor kinetics code, MASTER. This coupled calculation feature, in conjunction with the existing hot channel analysis capabilities of the MARS and MASTER codes, allows for more realistic simulations of nuclear system transients. In this work, a main steam line break (MSLB) accident is simulated using the coupled 'system T-H, 3-D reactor kinetics, and hot channel analysis' feature of the MARS code. Two coupled calculations are performed for demonstration. First, a coupled calculation of the 'system T-H and 3-D reactor kinetics' with a refined core T-H nodalization is carried out to obtain global core power and local departure from nucleate boiling (DNB) ratio (DNBR) behaviors. Next, for a more accurate DNBR prediction, another coupled calculation with subchannel meshes for the hot channels is performed. The results of the coupled calculations are very reasonable and consistent so that these can be used to remove the excessive conservatism in the conventional safety analysis.

Super-pixel extraction based on multi-channel pulse coupled neural network

Science.gov (United States)

Xu, GuangZhu; Hu, Song; Zhang, Liu; Zhao, JingJing; Fu, YunXia; Lei, BangJun

2018-04-01

Super-pixel extraction techniques group pixels to form over-segmented image blocks according to the similarity among pixels. Compared with the traditional pixel-based methods, the image descripting method based on super-pixel has advantages of less calculation, being easy to perceive, and has been widely used in image processing and computer vision applications. Pulse coupled neural network (PCNN) is a biologically inspired model, which stems from the phenomenon of synchronous pulse release in the visual cortex of cats. Each PCNN neuron can correspond to a pixel of an input image, and the dynamic firing pattern of each neuron contains both the pixel feature information and its context spatial structural information. In this paper, a new color super-pixel extraction algorithm based on multi-channel pulse coupled neural network (MPCNN) was proposed. The algorithm adopted the block dividing idea of SLIC algorithm, and the image was divided into blocks with same size first. Then, for each image block, the adjacent pixels of each seed with similar color were classified as a group, named a super-pixel. At last, post-processing was adopted for those pixels or pixel blocks which had not been grouped. Experiments show that the proposed method can adjust the number of superpixel and segmentation precision by setting parameters, and has good potential for super-pixel extraction.

The interpretation of resonance formation in coupled-channel models of positron scattering by atomic hydrogen using localized optical potentials

International Nuclear Information System (INIS)

Bransden, B.H.; Hewitt, R.N.

1997-01-01

Above-threshold resonances can occur in coupled-channel models of the e + + H system when Ps formation is taken into account (although it should be pointed out that, in this specific system, resonances do not occur in an exact theory). In general, to understand the mechanism of resonance formation it is useful to obtain the exact optical potential in a given channel in a localized form. The methods of achieving this localization are discussed with reference to a specific application to the resonance found in the two-state approximation for the l = 0 partial wave. (author)

Protein translocation channel of mitochondrial inner membrane and matrix-exposed import motor communicate via two-domain coupling protein.

Science.gov (United States)

Banerjee, Rupa; Gladkova, Christina; Mapa, Koyeli; Witte, Gregor; Mokranjac, Dejana

2015-12-29

The majority of mitochondrial proteins are targeted to mitochondria by N-terminal presequences and use the TIM23 complex for their translocation across the mitochondrial inner membrane. During import, translocation through the channel in the inner membrane is coupled to the ATP-dependent action of an Hsp70-based import motor at the matrix face. How these two processes are coordinated remained unclear. We show here that the two domain structure of Tim44 plays a central role in this process. The N-terminal domain of Tim44 interacts with the components of the import motor, whereas its C-terminal domain interacts with the translocation channel and is in contact with translocating proteins. Our data suggest that the translocation channel and the import motor of the TIM23 complex communicate through rearrangements of the two domains of Tim44 that are stimulated by translocating proteins.

Coupled channels description of single and mutual excitation in the scatttering of /sup 7/Li from /sup 12/C and sup(24,26)Mg

Energy Technology Data Exchange (ETDEWEB)

Cook, J.; Clarke, N.M.; Coopersmith, J.; Griffiths, R.J. (King' s Coll., London (UK). Wheatstone Physics Lab.)

1982-09-27

Coupled channels calculations have been made for the scattering of /sup 7/Li from /sup 12/C at 63 and 79 MeV and from sup(24,26)Mg at 88 MeV. The calculations describe, simultaneously, the elastic scattering, excitation of /sup 7/Li to the 478 keV 1/2/sup -/ state, excitation of the target to its first 2/sup +/ state, and the mutual excitation of both projectile and target to their 1/2/sup -/ and 2/sup +/ states respectively. The potentials have been used for the ground states of /sup 7/Li, /sup 12/C and sup(24,26)Mg and also the transition densities to the excited states using a microscopic plus macroscopic prescription. For the mutual excitation, both one-step processes with iota = 0, 2 and 4 and two-step processes were included. The calculations show that the two-step processes are the dominant contribution to the mutual excitation, but at forward angles, the oscillations in the data are only reproduced with the coherent addition of the one-step processes, which are dominated by the iota = 4 contribution. Even when coupling to all single and mutual excitations are included the real potential still requires a normalization of about 0.6. The addition of the quadrupole re-orientation matrix element for the ground state dows not significantly change this value. These calculations confirm that the coupling to the first excited inelastic levels of target and ejectile is not the source of the anomalous M3Y normalization, and that the dominant mode of mutual excitation is a two-step processes. However, direct one-step mutual excitation is important for small angles (THETA approx. <= 20/sup 0/).

Second law analysis for hydromagnetic couple stress fluid flow through a porous channel

Directory of Open Access Journals (Sweden)

S.O. Kareem

2016-06-01

Full Text Available In this work, the combined effects of magnetic field and ohmic heating on the entropy generation rate in the flow of couple stress fluid through a porous channel are investigated. The equations governing the fluid flow are formulated, non-dimensionalised and solved using a rapidly convergent semi-analytical Adomian decomposition method (ADM. The result of the computation shows a significant dependence of fluid’s thermophysical parameters on Joule’s dissipation as well as decline in the rate of change of fluid momentum due to the interplay between Lorentz and viscous forces. Moreover, the rate of entropy generation in the flow system drops as the magnitude of the magnetic field increases.

Lagoon Sediment Dynamics: A Coupled Model to Study a Medium-Term Silting of Tidal Channels

Directory of Open Access Journals (Sweden)

Marco Petti

2018-04-01

Full Text Available The silting of tidal channels is a natural process that affects several shallow lagoons and makes it difficult to navigate, requiring regular maintenance interventions. This phenomenon is the result of the complex non-linear interaction between tidal currents and wave motion. In this work, the morphodynamic evolution of the Marano and Grado lagoon is investigated by means of a two-dimensional horizontal (2DH morphological-hydrodynamic and a spectral coupled model. An innovative procedure to reproduce the overall bathymetric changes in the medium term and, in particular, the volumes deposited inside channels, is presented. An average year with a sequence of winds and tides acting over that time was reconstructed, carrying out cross correlation techniques and spectral analyses of measured data. The predicted morphological evolution matches the annual dredged volumes in the lagoon critical branches and shows the distribution of erosion and deposition of cohesive sediments according to spatially variable values of critical shear stress.

A coupled-channels analysis of pion scattering and pion-induced eta production on the nucleon

International Nuclear Information System (INIS)

Pratt, R.K.; Bennhold, C.; Surya, Y.

1995-01-01

Motivated by new, upcoming Brookhaven data, pion scattering and pion-induced eta production on the nucleon in the S 11 (1535) resonance region is studied in an extension of the unitary, relativistic resonance model by Surya and Gross. The Kernel of the relativistic wave equation includes the nucleon, Roper, δ(1232), D 13 (1520) and S 11 (1535) pole terms along with contact σ- and ρ-like exchange terms. The formalism includes a coupling between the πN and ηN channels. The resonance parameters are adjusted to reproduce the experimental πN phase shifts

Multi-channel Kondo necklace

International Nuclear Information System (INIS)

Fazekas, P.; Kee Haeyoung.

1993-06-01

A multi-channel generalization of Doniach's Kondo necklace model is formulated, and its phase diagram studied in the mean-field approximation. Our intention is to introduce the possible simplest model which displays some of the features expected from the overscreened Kondo lattice. The N conduction electron channels are represented by N sets of pseudospins τ J , j = 1 1,..., N which are all antiferromagnetically coupled to a periodic array of modul S = 1/2 spins. Exploiting permutation symmetry in the channel index j allows us to write down the self-consistency equation for general N. For N > 2, we find that the critical temperature is rising with increasing Kondo interaction; we interpret this effect by pointing out that the Kondo coupling creates the composite pseudospin objects which undergo an ordering transition. The relevance of our findings to the underlying fermionic multi-channel problem is discussed. (author). 33 refs, 1 fig

Uplink scheduling and adjacent-channel coupling loss analysis for TD-LTE deployment.

Science.gov (United States)

Yeo, Woon-Young; Moon, Sung Ho; Kim, Jae-Hoon

2014-01-01

TD-LTE, one of the two duplexing modes in LTE, operates in unpaired spectrum and has the advantages of TDD-based technologies. It is expected that TD-LTE will be more rapidly deployed in near future and most of WiMax operators will upgrade their networks to TD-LTE gradually. Before completely upgrading to TD-LTE, WiMax may coexist with TD-LTE in an adjacent frequency band. In addition, multiple TD-LTE operators may deploy their networks in adjacent bands. When more than one TDD network operates in adjacent frequency bands, severe interference may happen due to adjacent channel interference (ACI) and unsynchronized operations. In this paper, coexistence issues between TD-LTE and other systems are analyzed and coexistence requirements are provided. This paper has three research objectives. First, frame synchronization between TD-LTE and WiMax is discussed by investigating possible combinations of TD-LTE and WiMax configurations. Second, an uplink scheduling algorithm is proposed to utilize a leakage pattern of ACI in synchronized operations. Third, minimum requirements for coexistence in unsynchronized operations are analyzed by introducing a concept of adjacent-channel coupling loss. From the analysis and simulation results, we can see that coexistence of TD-LTE with other TDD systems is feasible if the two networks are synchronized. For the unsynchronized case, some special cell-site engineering techniques may be required to reduce the ACI.

Coupled-channel optical calculation of electron-hydrogen scattering: elastic scattering from 0.5 to 30 eV

International Nuclear Information System (INIS)

Bray, I.; Konovalov, D.A.; McCarthy, I.E.

1991-01-01

A coupled-channel optical method for electron-atomic hydrogen scattering is presented in a form that treats both the projectile and the target electrons symmetrically. Elastic differential cross sections are calculated at a range of energies from 0.5 to 30 eV and are found to be in complete agreement with the absolute measurements, previously reported. Total and total ionization cross sections are also presented. 13 refs., 2 tabs., 2 figs

Effects of electric field and Coriolis force on electrohydrodynamic stability of poorly conducting couple stress parallel fluid flow in a channel

International Nuclear Information System (INIS)

Shankar, B.M.; Rudraiah, N.

2013-01-01

The linear stability of electrohydrodynamic poorly conducting couple stress viscous parallel fluid flow in a channel is studied in the presence of a non-uniform transverse electric field and Coriolis force using energy method and supplemented with Galerkin Technique. The sufficient condition for stability is obtained for sufficiently small values of the Reynolds number, R e . From this condition we show that strengthening or weakening of the stability criterion is dictated by the values of the strength of electric field, the coefficient of couple stress fluid and independent of Taylor number. In particular, it is shown that the interaction of electric field with couple stress is more effective in stabilizing the poorly conducting couple stress fluid compared to that in an ordinary Newtonian viscous fluid. (author)

Stability of the Zagreb realization of the Carnegie-Mellon-Berkeley coupled-channels unitary model

International Nuclear Information System (INIS)

Osmanovic, H.; Hadzimehmedovic, M.; Stahov, J.; Ceci, S.; Svarc, A.

2011-01-01

In Hadzimehmedovicet al.[Phys. Rev. C 84, 035204 (2011)] we have used the Zagreb realization of Carnegie-Melon-Berkeley coupled-channel, unitary model as a tool for extracting pole positions from the world collection of partial-wave data, with the aim of eliminating model dependence in pole-search procedures. In order that the method is sensible, we in this paper discuss the stability of the method with respect to the strong variation of different model ingredients. We show that the Zagreb CMB procedure is very stable with strong variation of the model assumptions and that it can reliably predict the pole positions of the fitted partial-wave amplitudes.

Open-channel effects on heavy-quarkonium spectra: a phenomenological study within a one-open-channel approximation

International Nuclear Information System (INIS)

Matsuda, Y.; Kato, K.; Yabusaki, N.; Hirano, M.; Nakanishi, R.; Sakai, M.

1997-01-01

Open-channel effects on charmonium (S- and D-waves) and bottomonium (S-wave) J P = 1 - spectra are investigated within a one-open-channel approximation. Mass shifts and decay widths of these states just above the threshold are obtained by taking into account a coupling between confined quarkonium states and decaying states of the open channel. The final-state interaction (FSI) between the decaying meson and antimeson plays a very important role in producing a reasonable magnitude of coupling; the FSI provides the open-channel poles (R 1 , R 2 ) at the appropriate positions on the complex energy plane. The result is found to be independent of the detailed form of the transition potential and the final-state interaction. (author)

Multi-channel Kondo necklace

Energy Technology Data Exchange (ETDEWEB)

Fazekas, P; Haeyoung, Kee

1993-06-01

A multi-channel generalization of Doniach`s Kondo necklace model is formulated, and its phase diagram studied in the mean-field approximation. Our intention is to introduce the possible simplest model which displays some of the features expected from the overscreened Kondo lattice. The N conduction electron channels are represented by N sets of pseudospins {tau}{sub J}, j = 1 1,..., N which are all antiferromagnetically coupled to a periodic array of modul S = 1/2 spins. Exploiting permutation symmetry in the channel index j allows us to write down the self-consistency equation for general N. For N > 2, we find that the critical temperature is rising with increasing Kondo interaction; we interpret this effect by pointing out that the Kondo coupling creates the composite pseudospin objects which undergo an ordering transition. The relevance of our findings to the underlying fermionic multi-channel problem is discussed. (author). 33 refs, 1 fig.

Oxygen-coupled Redox Regulation of the Skeletal Muscle Ryanodine Receptor/Ca2+ Release Channel (RyR1)

Science.gov (United States)

Sun, Qi-An; Wang, Benlian; Miyagi, Masaru; Hess, Douglas T.; Stamler, Jonathan S.

2013-01-01

In mammalian skeletal muscle, Ca2+ release from the sarcoplasmic reticulum (SR) through the ryanodine receptor/Ca2+-release channel RyR1 can be enhanced by S-oxidation or S-nitrosylation of separate Cys residues, which are allosterically linked. S-Oxidation of RyR1 is coupled to muscle oxygen tension (pO2) through O2-dependent production of hydrogen peroxide by SR-resident NADPH oxidase 4. In isolated SR (SR vesicles), an average of six to eight Cys thiols/RyR1 monomer are reversibly oxidized at high (21% O2) versus low pO2 (1% O2), but their identity among the 100 Cys residues/RyR1 monomer is unknown. Here we use isotope-coded affinity tag labeling and mass spectrometry (yielding 93% coverage of RyR1 Cys residues) to identify 13 Cys residues subject to pO2-coupled S-oxidation in SR vesicles. Eight additional Cys residues are oxidized at high versus low pO2 only when NADPH levels are supplemented to enhance NADPH oxidase 4 activity. pO2-sensitive Cys residues were largely non-overlapping with those identified previously as hyperreactive by administration of exogenous reagents (three of 21) or as S-nitrosylated. Cys residues subject to pO2-coupled oxidation are distributed widely within the cytoplasmic domain of RyR1 in multiple functional domains implicated in RyR1 activity-regulating interactions with the L-type Ca2+ channel (dihydropyridine receptor) and FK506-binding protein 12 as well as in “hot spot” regions containing sites of mutation implicated in malignant hyperthermia and central core disease. pO2-coupled disulfide formation was identified, whereas neither S-glutathionylated nor sulfenamide-modified Cys residues were observed. Thus, physiological redox regulation of RyR1 by endogenously generated hydrogen peroxide is exerted through dynamic disulfide formation involving multiple Cys residues. PMID:23798702

Strongly coupled fluid-particle flows in vertical channels. I. Reynolds-averaged two-phase turbulence statistics

International Nuclear Information System (INIS)

Capecelatro, Jesse; Desjardins, Olivier; Fox, Rodney O.

2016-01-01

Simulations of strongly coupled (i.e., high-mass-loading) fluid-particle flows in vertical channels are performed with the purpose of understanding the fundamental physics of wall-bounded multiphase turbulence. The exact Reynolds-averaged (RA) equations for high-mass-loading suspensions are presented, and the unclosed terms that are retained in the context of fully developed channel flow are evaluated in an Eulerian–Lagrangian (EL) framework for the first time. A key distinction between the RA formulation presented in the current work and previous derivations of multiphase turbulence models is the partitioning of the particle velocity fluctuations into spatially correlated and uncorrelated components, used to define the components of the particle-phase turbulent kinetic energy (TKE) and granular temperature, respectively. The adaptive spatial filtering technique developed in our previous work for homogeneous flows [J. Capecelatro, O. Desjardins, and R. O. Fox, “Numerical study of collisional particle dynamics in cluster-induced turbulence,” J. Fluid Mech. 747, R2 (2014)] is shown to accurately partition the particle velocity fluctuations at all distances from the wall. Strong segregation in the components of granular energy is observed, with the largest values of particle-phase TKE associated with clusters falling near the channel wall, while maximum granular temperature is observed at the center of the channel. The anisotropy of the Reynolds stresses both near the wall and far away is found to be a crucial component for understanding the distribution of the particle-phase volume fraction. In Part II of this paper, results from the EL simulations are used to validate a multiphase Reynolds-stress turbulence model that correctly predicts the wall-normal distribution of the two-phase turbulence statistics.

Strongly coupled fluid-particle flows in vertical channels. I. Reynolds-averaged two-phase turbulence statistics

Science.gov (United States)

Capecelatro, Jesse; Desjardins, Olivier; Fox, Rodney O.

2016-03-01

Simulations of strongly coupled (i.e., high-mass-loading) fluid-particle flows in vertical channels are performed with the purpose of understanding the fundamental physics of wall-bounded multiphase turbulence. The exact Reynolds-averaged (RA) equations for high-mass-loading suspensions are presented, and the unclosed terms that are retained in the context of fully developed channel flow are evaluated in an Eulerian-Lagrangian (EL) framework for the first time. A key distinction between the RA formulation presented in the current work and previous derivations of multiphase turbulence models is the partitioning of the particle velocity fluctuations into spatially correlated and uncorrelated components, used to define the components of the particle-phase turbulent kinetic energy (TKE) and granular temperature, respectively. The adaptive spatial filtering technique developed in our previous work for homogeneous flows [J. Capecelatro, O. Desjardins, and R. O. Fox, "Numerical study of collisional particle dynamics in cluster-induced turbulence," J. Fluid Mech. 747, R2 (2014)] is shown to accurately partition the particle velocity fluctuations at all distances from the wall. Strong segregation in the components of granular energy is observed, with the largest values of particle-phase TKE associated with clusters falling near the channel wall, while maximum granular temperature is observed at the center of the channel. The anisotropy of the Reynolds stresses both near the wall and far away is found to be a crucial component for understanding the distribution of the particle-phase volume fraction. In Part II of this paper, results from the EL simulations are used to validate a multiphase Reynolds-stress turbulence model that correctly predicts the wall-normal distribution of the two-phase turbulence statistics.

Stability of the Zagreb realization of the Carnegie-Mellon-Berkeley coupled-channels unitary model

Science.gov (United States)

Osmanović, H.; Ceci, S.; Švarc, A.; Hadžimehmedović, M.; Stahov, J.

2011-09-01

In Hadžimehmedović [Phys. Rev. CPRVCAN0556-281310.1103/PhysRevC.84.035204 84, 035204 (2011)] we have used the Zagreb realization of Carnegie-Melon-Berkeley coupled-channel, unitary model as a tool for extracting pole positions from the world collection of partial-wave data, with the aim of eliminating model dependence in pole-search procedures. In order that the method is sensible, we in this paper discuss the stability of the method with respect to the strong variation of different model ingredients. We show that the Zagreb CMB procedure is very stable with strong variation of the model assumptions and that it can reliably predict the pole positions of the fitted partial-wave amplitudes.

Search for anomalous Wtb couplings and top FCNC in t-channel single-top-quark events in the CMS experiment

CERN Document Server

Tsirova, Natalia

2015-01-01

Single-top-quark events in the t-channel are used to probe Wtb anomalous couplings and to search for top-quark Flavor-Changing Neutral Current (FCNC) interactions in proton-proton collisions with the CMS experiment. A Bayesian neural network is used to discriminate between signal and backgrounds. The observed event yields are consistent with SM prediction, and exclusion limits at 95\\% C.L. are determined.

Reciprocity relation for multichannel coupling kernels

International Nuclear Information System (INIS)

Cotanch, S.R.; Satchler, G.R.

1981-01-01

Assuming time-reversal invariance of the many-body Hamiltonian, it is proven that the kernels in a general coupled-channels formulation are symmetric, to within a specified spin-dependent phase, under the interchange of channel labels and coordinates. The theorem is valid for both Hermitian and suitably chosen non-Hermitian Hamiltonians which contain complex effective interactions. While of direct practical consequence for nuclear rearrangement reactions, the reciprocity relation is also appropriate for other areas of physics which involve coupled-channels analysis

Measurements of properties of the Higgs boson in the diphoton decay channel with the full 2016 data set

CERN Document Server

CMS Collaboration

2017-01-01

Measurements of properties of the Higgs boson SM(125) in the $\\mathrm{H}\\rightarrow\\gamma\\gamma$ decay channel are reported. The analysis uses the data collected by the CMS experiment in proton-proton collisions during the 2016 LHC running period. The data sample corresponds to an integrated luminosity of $35.9\\,\\text{fb}^\\text{$-$1}$ at ${\\sqrt{s}=13\\,\\text{Te}\\hspace{-.08em}\\text{V}}$. The measured signal strength relative to the standard model prediction is ${1.16^{+0.15}_{-0.14}=1.16\\ ^{+0.11}_{-0.10}\\text{(stat.)}\\ ^{+0.09}_{-0.08}\\text{(syst.)}\\ ^{+0.06}_{-0.05}\\text{(theo.)}}$. Signal strengths associated with the different Higgs boson production mechanisms, coupling modifiers to bosons and fermions, and effective couplings to photons and gluons are also measured.

Climate variability and predictability associated with the Indo-Pacific Oceanic Channel Dynamics in the CCSM4 Coupled System Model

Science.gov (United States)

Yuan, Dongliang; Xu, Peng; Xu, Tengfei

2017-01-01

An experiment using the Community Climate System Model (CCSM4), a participant of the Coupled Model Intercomparison Project phase-5 (CMIP5), is analyzed to assess the skills of this model in simulating and predicting the climate variabilities associated with the oceanic channel dynamics across the Indo-Pacific Oceans. The results of these analyses suggest that the model is able to reproduce the observed lag correlation between the oceanic anomalies in the southeastern tropical Indian Ocean and those in the cold tongue in the eastern equatorial Pacific Ocean at a time lag of 1 year. This success may be largely attributed to the successful simulation of the interannual variations of the Indonesian Throughflow, which carries the anomalies of the Indian Ocean Dipole (IOD) into the western equatorial Pacific Ocean to produce subsurface temperature anomalies, which in turn propagate to the eastern equatorial Pacific to generate ENSO. This connection is termed the "oceanic channel dynamics" and is shown to be consistent with the observational analyses. However, the model simulates a weaker connection between the IOD and the interannual variability of the Indonesian Throughflow transport than found in the observations. In addition, the model overestimates the westerly wind anomalies in the western-central equatorial Pacific in the year following the IOD, which forces unrealistic upwelling Rossby waves in the western equatorial Pacific and downwelling Kelvin waves in the east. This assessment suggests that the CCSM4 coupled climate system has underestimated the oceanic channel dynamics and overestimated the atmospheric bridge processes.

A two-dimensional conjugated aromatic polymer via C-C coupling reaction

Science.gov (United States)

Liu, Wei; Luo, Xin; Bao, Yang; Liu, Yan Peng; Ning, Guo-Hong; Abdelwahab, Ibrahim; Li, Linjun; Nai, Chang Tai; Hu, Zhi Gang; Zhao, Dan; Liu, Bin; Quek, Su Ying; Loh, Kian Ping

2017-06-01

The fabrication of crystalline 2D conjugated polymers with well-defined repeating units and in-built porosity presents a significant challenge to synthetic chemists. Yet they present an appealing target because of their desirable physical and electronic properties. Here we report the preparation of a 2D conjugated aromatic polymer synthesized via C-C coupling reactions between tetrabromopolyaromatic monomers. Pre-arranged monomers in the bulk crystal undergo C-C coupling driven by endogenous solid-state polymerization to produce a crystalline polymer, which can be mechanically exfoliated into micrometre-sized lamellar sheets with a thickness of 1 nm. Isothermal gas-sorption measurements of the bulk material reveal a dominant pore size of ~0.6 nm, which indicates uniform open channels from the eclipsed stacking of the sheets. When employed as an organic anode in an ambient-temperature sodium cell, the material allows a fast charge/discharge of sodium ions, with impressive reversible capacity, rate capability and stability metrics.

Convergence of an L2-approach in the coupled-channels optical potential method for e-H scattering

International Nuclear Information System (INIS)

Bray, I.; Konovalov, D.A.; McCarthy, I.E.

1990-08-01

An L 2 approach to the coupled-channels optical method is studied. The investigation is done for electron-hydrogen elastic scattering at projectile energies of 30, 50, 100 and 200 eV. Weak coupling, free-particle Green's function and no exchange in Q-space are appoximations used to calculate the polarization potential. This model problem is solved exactly using actual hydrogen discrete and continuum functions. The convergence of an L 2 approach with the Laguerre basis to the exact result is investigated. It is found that a basis of 10 Laguerre functions is sufficient for convergence of approximately 5% in the polarization potential matrix elements and 2% in the differential cross sections for non-large angles. The convergence is faster for smaller energies. In general, the convergence to the exact result is slow. 12 refs., 2 tabs., 2 figs

Sinclair and Dyes Inlets Toxicity Study: An Assessment of Copper Bioavailability and Toxicity in Surface Waters Adjacent to the Puget Sound Naval Shipyard and Intermediate Maintenance Facility

Science.gov (United States)

2009-12-01

biblio /92109.html WEF 2004a. “Proposed Research for Developing the Biotic Ligand Model for Establishing Water Quality Criteria. Water Environment...Systems Center, Bremerton, WA. August 2006. Ecology Publication Number 06-10-54 http://www.ecy.wa.gov/ biblio /0610054.html Eriksen, R.S., Mackey

Three-body coupled-channel theory of scattering and breakup of light and heavy ions

International Nuclear Information System (INIS)

Kamimura, M.; Kameyama, H.; Kawai, M.; Sakuragi, Y.; Iseri, Y.; Yahiro, M.; Tanifuji, M.

1986-09-01

It is shown that the method of coupled discretized continuum channels (CDCC) based on the three-body model for direct reactions is very successful in explaining the following, recently developed experiments using deuteron, 6 Li and 7 Li projectiles whose breakup threshold energies are very low: (i) Precise measurement of all the possible analyzing powers in elastic scattering of polarized deuteron at 56 MeV, (ii) scattering of polarized deuteron at intermediate energies, (iii) deuteron projectile breakup at 56 MeV, (iv) scattering of polarized 7 Li at 20 and 44 MeV and (v) projectile breakup of 6 Li at 178 MeV and 7 Li at 70 MeV. The CDCC analyses of those data are made transparently with no adjustable parameters. (author)

COUPLED-CHANNELS FADDEEV CALCULATION OF THE K(-) d SCATTERING LENGTH

Czech Academy of Sciences Publication Activity Database

Shevchenko, Nina V.

2011-01-01

Roč. 26, 3-4 (2011), s. 558-560 ISSN 0217-751X. [11th International Workshop on Meson Production , Properties and Interaction. Krakow, 10.06.2010-15.06.2010] R&D Projects: GA AV ČR KJB100480801 Institutional research plan: CEZ:AV0Z10480505 Keywords : Few-body systems * multichannel scattering * antikaon-baryon interaction Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.053, year: 2011

Coupled-Channel Analysis of the X(3872)

International Nuclear Information System (INIS)

Coito, S.; Rupp, G.; Beveren, E. van

2010-01-01

The X(3872) is studied as an axial-vector charmonium state in the multichannel framework of the Resonance-Spectrum Expansion quark-meson model, previously applied to a variety of other puzzling mesonic resonances. Included are the open-charm pseudoscalar-vector and vector-vector channels, the most important of which is the S-wave D *0 (bar)D 0 + D *0 D 0 (bar) channel, which practically coincides with the X(3872) structure. The two free parameters of the model are tuned so as to roughly reproduce the χ c1 (3511) mass as well as the enhancement just above the D *0 (bar)D 0 /D *0 D 0 threshold. The present model is able to describe the shape of the latter data quite well. However, as no dynamical resonance pole is found, the X(3872) and X(3940) cannot be reproduced simultaneously, at this stage. A possible further improvement is discussed. (author)

Coupling tests of parallel channels to modal neutronic kinetics; Pruebas de acoplamiento de canales paralelos a cinetica neutronica modal

Energy Technology Data Exchange (ETDEWEB)

Cecenas F, M.; Campos G, R.M. [IIE, 62490 Cuernavaca, Morelos (Mexico)]. e-mail: mcf@iie.org.mx

2007-07-01

In this work the initial results of the joining of an arrangement of 36 channels in parallel are studied to a modal neutronic kinetic model to represent the core of a BWR type reactor. The set of channels is obtained group the assemblies of that it consists the core in an arrangement of concentric rings, for later on to subdivide each ring in four parts to assign each segment to a quadrant of the core. The obtained channels are coupled to a modal kinetics model that considers the fundamental way and the first harmonic. The obtained solution represents the radial distribution and power azimuthal, the one which is feedback to the channels to update the thermohydraulic variables. The restriction that the pressure drop is same for each channel it is only imposed as initial condition, like part of the stationary state, and it is allowed that the pressure drop in the assemblies them it is different in each channel during a reactivity interference. For the tests to the system, it is convenient to select a relatively big core and that it operates near their stability frontier, for that the channels are dimensioning according to the case 9 of the Stability Benchmark of the Ringhals Swedish plant, organized by the Nuclear Energy Agency in 1994. In general, they reproduce the results of this benchmark, when reproducing oscillations outside of phase, with the additional results that the quadrants 1 and 2 of the core present oscillations of more width that the quadrants 3 and 4. The set group nuclear-thermohydraulics it is solved numerically by means of the outline master-slave of distributed calculation implemented by means of Parallel Virtual Machine (PVM). (Author)

Experimental characterization of the 192 channel Clear-PEM frontend ASIC coupled to a multi-pixel APD readout of LYSO:Ce crystals

International Nuclear Information System (INIS)

Albuquerque, Edgar; Bexiga, Vasco; Bugalho, Ricardo; Carrico, Bruno; Ferreira, Claudia S.; Ferreira, Miguel; Godinho, Joaquim; Goncalves, Fernando; Leong, Carlos; Lousa, Pedro; Machado, Pedro; Moura, Rui; Neves, Pedro; Ortigao, Catarina; Piedade, Fernando; Pinheiro, Joao F.; Rego, Joel; Rivetti, Angelo; Rodrigues, Pedro; Silva, Jose C.

2009-01-01

In the framework of the Clear-PEM project for the construction of a high-resolution scanner for breast cancer imaging, a very compact and dense frontend electronics system has been developed for readout of multi-pixel S8550 Hamamatsu APDs. The frontend electronics are instrumented with a mixed-signal Application-Specific Integrated Circuit (ASIC), which incorporates 192 low-noise charge pre-amplifiers, shapers, analog memory cells and digital control blocks. Pulses are continuously stored in memory cells at clock frequency. Channels above a common threshold voltage are readout for digitization by off-chip free-sampling ADCs. The ASIC has a size of 7.3x9.8mm 2 and was implemented in a AMS 0.35μm CMOS technology. In this paper the experimental characterization of the Clear-PEM frontend ASIC, reading out multi-pixel APDs coupled to LYSO:Ce crystal matrices, is presented. The chips were mounted on a custom test board connected to six APD arrays and to the data acquisition system. Six 32-pixel LYSO:Ce crystal matrices coupled on both sides to APD arrays were readout by two test boards. All 384 channels were operational. The chip power consumption is 660 mW (3.4 mW per channel). A very stable behavior of the chip was observed, with an estimated ENC of 1200-1300e - at APD gain 100. The inter-channel noise dispersion and mean baseline variation is less than 8% and 0.5%, respectively. The spread in the gain between different channels is found to be 1.5%. Energy resolution of 16.5% at 511 keV and 12.8% at 662 keV has been measured. Timing measurements between the two APDs that readout the same crystal is extracted and compared with detailed Monte Carlo simulations. At 511 keV the measured single photon time RMS resolution is 1.30 ns, in very good agreement with the expected value of 1.34 ns.

Coupled Model of channels in parallel and neutron kinetics in two dimensions; Modelo acoplado de canales en paralelo y cinetica neutronica en dos dimensiones

Energy Technology Data Exchange (ETDEWEB)

Cecenas F, M.; Campos G, R.M. [Instituto de Investigaciones Electricas, Av. Reforma 113, Col. Palmira, 62490 Cuernavaca, Morelos (Mexico)]. E-mail: mcf@iie.org.mx; Valle G, E. del [IPN, ESFM, 07738 Mexico D.F. (Mexico)

2004-07-01

In this work an arrangement of thermohydraulic channels is presented that represent those four quadrants of a nucleus of reactor type BWR. The channels are coupled to a model of neutronic in two dimensions that allow to generate the radial profile of power of the reactor. Nevertheless that the neutronic pattern is of two dimensions, it is supplemented with axial additional information when considering the axial profiles of power for each thermo hydraulic channel. The stationary state is obtained the one it imposes as frontier condition the same pressure drop for all the channels. This condition is satisfied to iterating on the flow of coolant in each channel to equal the pressure drop in all the channels. This stationary state is perturbed later on when modifying the values for the effective sections corresponding to an it assembles. The calculation in parallel of the neutronic and the thermo hydraulic is carried out with Vpm (Virtual parallel machine) by means of an outline teacher-slave in a local net of computers. (Author)

Coupled Landscape and Channel Dynamics in the Ganges-Brahmaputra Tidal Deltaplain, Southwest Bangladesh

Science.gov (United States)

Bomer, J.; Wilson, C.; Hale, R. P.

2017-12-01

In the Ganges-Brahmaputra Delta (GBD) and other tide-dominated systems, periodic flooding of the land surface during the tidal cycle promotes sediment accretion and surface elevation gain over time. However, over the past several decades, anthropogenic modification of the GBD tidal deltaplain through embankment construction has precluded sediment delivery to catchment areas, leading to widespread channel siltation and subsidence in poldered landscapes. Amongst the current discussion on GBD sustainability, the relationship between tidal inundation period and resultant sedimentation in natural and embanked settings remains unclear. Moreover, an evaluation of how riparian sedimentology and stratigraphic architecture changes across the GBD tidal-fluvial spectrum is notably absent, despite its critical importance in assessing geomorphic change in human-impacted transitional environments. To provide local-scale, longitudinal trends of coupled landscape-channel dynamics, an array of surface elevation tables, groundwater piezometers, and sediment traps deployed in natural and embanked settings have been monitored seasonally over a time span of 4 years. This knowledge base will be extended across the GBD tidal-fluvial transition by collecting sediment cores from carefully selected point bars along the Gorai River. Sediments will be analyzed for lithologic, biostratigraphic, and geochemical properties to provide an integrated framework for discerning depositional zones and associated facies assemblages across this complex transitional environment. Preliminary comparisons of accretion and hydroperiod data suggest that inundation duration strongly governs mass accumulation on the intertidal platform, though other factors such as mass extraction from sediment source and vegetation density may play secondary roles.

ψ(3S) and Υ(5S) Originating in Heavy Meson Molecules: A Coupled Channel Analysis Based on an Effective Vector Quark–Quark Interaction

International Nuclear Information System (INIS)

Matsuda, Y.; Sakai, M.; Hirano, M.

2013-01-01

In our previous coupled channel analysis based on the Cornell effective quark–quark interaction, it was indicated that the ψ(3S) solution corresponding to ψ(4040) originates from a D ∗ D¯ ∗ channel state. In this article, we report on a simultaneous analysis of the ψ - and Υ-family states. The most conspicuous outcome is a finding that the Υ(5S) solution corresponding to Υ(10860) originates from a B ∗ B¯ ∗ channel state, very much like ψ(3S). Some other characteristics of the result, including the induced very large S–D mixing and relation of some of the solutions with newly observed heavy quarkonia-like states are discussed. (author)

Measurements of Higgs boson properties in the diphoton decay channel in proton-proton collisions at $\\sqrt{s} = $ 13 TeV

CERN Document Server

Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Grossmann, Johannes; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Pree, Elias; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Seva, Tomislav; Starling, Elizabeth; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; Caudron, Adrien; David, Pieter; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; Fonseca De Souza, Sandro; Malbouisson, Helena; Medina Jaime, Miguel; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Jing; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Abdelalim, Ahmed Ali; Ellithi Kamel, Ali; Mohamed, Amr; Bhowmik, Sandeep; Dewanjee, Ram Krishna; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Charlot, Claude; Granier de Cassagnac, Raphael; Jo, Mihee; Kucher, Inna; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Coubez, Xavier; Drouhin, Frédéric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Juillot, Pierre; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Zhang, Sijing; Khvedelidze, Arsen; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Teyssier, Daniel; Thüer, Sebastian; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Shevchenko, Rostyslav; Stefaniuk, Nazar; Tholen, Heiner; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Peiffer, Thomas; Perieanu, Adrian; Reimers, Arne; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Csanad, Mate; Filipovic, Nicolas; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Vámi, Tamás Álmos; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Iemmi, Fabio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pauwels, Kristof; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Castello, Roberto; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Alexakhin, Vadim; Golunov, Alexander; Golutvin, Igor; Gorbounov, Nikolai; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Savina, Maria; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Bunichev, Viacheslav; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Blinov, Vladimir; Shtol, Dmitry; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Bachiller, Irene; Barrio Luna, Mar; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; Garcia-Ferrero, Juan; García Alonso, Andrea; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Knünz, Valentin; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Neugebauer, Hannes; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Stoye, Markus; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Verweij, Marta; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Casal, Bruno; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Reichmann, Michael; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Candelise, Vieri; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Karapinar, Guler; Ocalan, Kadir; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Auzinger, Georg; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Matsushita, Takashi; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Bunn, Julian; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Wu, Weimin; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Furic, Ivan-Kresimir; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Terentyev, Nikolay; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Joshi, Yagya Raj; Linn, Stephan; Markowitz, Pete; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Royon, Christophe; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Ciesielski, Robert; Goulianos, Konstantin; Mesropian, Christina; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Rekovic, Vladimir; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel

2018-01-01

Measurements of Higgs boson properties in the ${\\mathrm{H}\\to\\gamma\\gamma}$ decay channel are reported. The analysis is based on data collected by the CMS experiment in proton-proton collisions at $\\sqrt{s} = $ 13 TeV during the 2016 LHC running period, corresponding to an integrated luminosity of 35.6 fb$^{-1}$. Allowing the Higgs mass to float, the measurement yields a signal strength relative to the standard model prediction of 1.18$^{+0.17}_{-0.14}$ = 1.18$^{+0.12}_{-0.11}$ (stat) $^{+0.09}_{-0.07}$ (syst) $^{+0.07}_{-0.06}$ (theo), which is largely insensitive to the exact Higgs mass around 125 GeV. Signal strengths associated with the different Higgs boson production mechanisms, couplings to bosons and fermions, and effective couplings to photons and gluons are also measured.

LOCA assessment experiments in a full-elevation, CANDU-typical test facility

International Nuclear Information System (INIS)

Ingham, P.J.; McGee, G.R.; Krishnan, V.S.

1990-01-01

The RD-14 thermal-hydraulics test facility, located at the Whiteshell Nuclear Research Establishment, is a full-elevation model representative of a CANDU primary heat transport system. The facility is scaled to accommodate a single, full-scale (5.0 MW, 21 kg/s), electrically heated channel per pass. The steam generators, pumps, headers, feeders and heated channels are arranged in a typical CANDU figure-of-eight geometry. The loop has an emergency coolant injection system (ECI) that may be operated in several modes, including typical features of the various ECI systems found in CANDU reactors. A series of experiments has been performed in RD-14 to investigate the thermal-hydraulic behaviour during the blowdown and injection phases of a loss-of-coolant accident (LOCA). The tests were designed to cover a full range of break sizes from feeder-sized breaks to guillotine breaks in either an inlet or an outlet header. Breaks resulting in channel flow stagnation were also investigated. This paper reviews the results of some of the LOCA tests carried out in RD-14, and discusses some of the behaviour observed. Plans for future experiments in a multiple-channel RD-14 facility, modified to contain multiple flow channels, are outlined. (orig.)

Alpha Channeling in Open-System Magnetic Devices

International Nuclear Information System (INIS)

Fisch, Nathaniel

2016-01-01

The Grant DE-SC0000736, Alpha Channeling in Open-System Magnetic Devices, is a continuation of the Grant DE-FG02-06ER54851, Alpha Channeling in Mirror Machines. In publications funded by DE-SC0000736, the grant DE-FG02-06ER54851 was actually credited. The key results obtained under Grant DE-SC0000736, Alpha Channeling in Open-System Magnetic Devices, appear in a series of publications. The earlier effort under DE-FG02- 06ER54851 was the subject of a previous Final Report. The theme of this later effort has been unusual confinement effects, or de-confinement effects, in open-field magnetic confinement devices. First, the possibilities in losing axisymmetry were explored. Then a number of issues in rotating plasma were addressed. Most importantly, a spinoff application to plasma separations was recognized, which also resulted in a provisional patent application. (That provisional patent application, however, was not pursued further.) Alpha channeling entails injecting waves into magnetically confined plasma to release energy from one particular ion while ejecting that ion. The ejection of the ion is actually a concomitant effect in releasing energy from the ion to the wave. In rotating plasma, there is the opportunity to store the energy in a radial electric field rather than in waves. In other words, the ejected alpha particle loses its energy to the radial potential, which in turn produces plasma rotation. This is a very useful effect, since producing radial electric fields by other means are technologically more difficult. In fact, one can heat ions, and then eject them, to produce the desired radial field. In each case, there is a separation effect of different ions, which generalizes the original alpha-channeling concept of separating alpha ash from hydrogen. In a further generalization of the separation concept, a double-well filter represents a new way to produce high-throughput separations of ions, potentially useful for nuclear waste remediation.

Analysis of perturbation methods for rearrangement collisions: Comparison of distorted-wave and coupled-channel-wave transition amplitudes

International Nuclear Information System (INIS)

Suck Salk, S.H.

1985-01-01

With the use of projection operators, the formal expressions of distorted-wave and coupled-channel-wave transition amplitudes for rearrangement collisions are derived. Use of projection operators (for the transition amplitudes) sharpens our understanding of the structural differences between the two transition amplitudes. The merit of each representation of the transition amplitudes is discussed. Derived perturbation potentials are found to have different structures. The rigorously derived distorted-wave Born-approximation (DWBA) transition amplitude is shown to be a generalization of the earlier DWBA expression obtained from the assumption of the dominance of elastic scattering in rearrangement collisions

Progress on the RF Coupling Coil Module Design for the MICE Channel

International Nuclear Information System (INIS)

Li, D.; Green, M.A.; Virostek, S.P.; Zisman, M.S.; Lau, W.; White, A.E.; Yang, S.Q.

2005-01-01

We describe the progress on the design of the RF coupling coil (RFCC) module for the international Muon Ionization Cooling Experiment (MICE) at Rutherford Appleton Laboratory (RAL) in the UK. The MICE cooling channel design consists of one SFOFO cell that is similar to that of the US Study-II of a neutrino factory. The MICE RFCC module comprises a superconducting solenoid, mounted around four normal conducting 201.25-MHz RF cavities. Each cavity has a pair of thin curved beryllium windows to close the conventional open beam irises, which allows for independent control of the phase in each cavity and for the RF power to be fed separately. The coil package that surrounds the RF cavities is mounted on a vacuum vessel. The RF vacuum is shared between the cavities and the vacuum vessel around the cavities such that there is no differential pressure on the thin beryllium windows. This paper discusses the design progress of the RFCC module and the fabrication progress of a prototype 201.25-MHz cavity

P-channel differential multiple-time programmable memory cells by laterally coupled floating metal gate fin field-effect transistors

Science.gov (United States)

Wang, Tai-Min; Chien, Wei-Yu; Hsu, Chia-Ling; Lin, Chrong Jung; King, Ya-Chin

2018-04-01

In this paper, we present a new differential p-channel multiple-time programmable (MTP) memory cell that is fully compatible with advanced 16 nm CMOS fin field-effect transistors (FinFET) logic processes. This differential MTP cell stores complementary data in floating gates coupled by a slot contact structure, which make different read currents possible on a single cell. In nanoscale CMOS FinFET logic processes, the gate dielectric layer becomes too thin to retain charges inside floating gates for nonvolatile data storage. By using a differential architecture, the sensing window of the cell can be extended and maintained by an advanced blanket boost scheme. The charge retention problem in floating gate cells can be improved by periodic restoring lost charges when significant read window narrowing occurs. In addition to high programming efficiency, this p-channel MTP cells also exhibit good cycling endurance as well as disturbance immunity. The blanket boost scheme can remedy the charge loss problem under thin gate dielectrics.

Elimination of mode coupling in multimode continuous-variable key distribution

International Nuclear Information System (INIS)

Filip, Radim; Mista, Ladislav; Marek, Petr

2005-01-01

A multimode channel can be utilized to substantially increase the capacity of quantum continuous-variable key distribution. Beyond losses in the channel, an uncontrollable coupling between the modes of the channel typically degrades the capacity of multimode channels. For the key distribution protocol with simultaneous measurement of both complementary quadratures we propose a feasible method to eliminate any undesirable mode coupling by only the receiver's appropriate measurement and data manipulation. It can be used to substantially increase the capacity of the channel, which has an important application in practical continuous-variable quantum cryptography

Discovery of functional monoclonal antibodies targeting G-protein-coupled receptors and ion channels.

Science.gov (United States)

Wilkinson, Trevor C I

2016-06-15

The development of recombinant antibody therapeutics is a significant area of growth in the pharmaceutical industry with almost 50 approved monoclonal antibodies on the market in the US and Europe. Despite this growth, however, certain classes of important molecular targets have remained intractable to therapeutic antibodies due to complexity of the target molecules. These complex target molecules include G-protein-coupled receptors and ion channels which represent a large potential target class for therapeutic intervention with monoclonal antibodies. Although these targets have typically been addressed by small molecule approaches, the exquisite specificity of antibodies provides a significant opportunity to provide selective modulation of these target proteins. Given this opportunity, substantial effort has been applied to address the technical challenges of targeting these complex membrane proteins with monoclonal antibodies. In this review recent progress made in the strategies for discovery of functional monoclonal antibodies for these challenging membrane protein targets is addressed. © 2016 The Author(s). published by Portland Press Limited on behalf of the Biochemical Society.

Voltage-Dependent Gating: Novel Insights from KCNQ1 Channels

Science.gov (United States)

Cui, Jianmin

2016-01-01

Gating of voltage-dependent cation channels involves three general molecular processes: voltage sensor activation, sensor-pore coupling, and pore opening. KCNQ1 is a voltage-gated potassium (Kv) channel whose distinctive properties have provided novel insights on fundamental principles of voltage-dependent gating. 1) Similar to other Kv channels, KCNQ1 voltage sensor activation undergoes two resolvable steps; but, unique to KCNQ1, the pore opens at both the intermediate and activated state of voltage sensor activation. The voltage sensor-pore coupling differs in the intermediate-open and the activated-open states, resulting in changes of open pore properties during voltage sensor activation. 2) The voltage sensor-pore coupling and pore opening require the membrane lipid PIP2 and intracellular ATP, respectively, as cofactors, thus voltage-dependent gating is dependent on multiple stimuli, including the binding of intracellular signaling molecules. These mechanisms underlie the extraordinary KCNE1 subunit modification of the KCNQ1 channel and have significant physiological implications. PMID:26745405

Local calcium signalling is mediated by mechanosensitive ion channels in mesenchymal stem cells

International Nuclear Information System (INIS)

Chubinskiy-Nadezhdin, Vladislav I.; Vasileva, Valeria Y.; Pugovkina, Natalia A.; Vassilieva, Irina O.; Morachevskaya, Elena A.; Nikolsky, Nikolay N.; Negulyaev, Yuri A.

2017-01-01

Mechanical forces are implicated in key physiological processes in stem cells, including proliferation, differentiation and lineage switching. To date, there is an evident lack of understanding of how external mechanical cues are coupled with calcium signalling in stem cells. Mechanical reactions are of particular interest in adult mesenchymal stem cells because of their promising potential for use in tissue remodelling and clinical therapy. Here, single channel patch-clamp technique was employed to search for cation channels involved in mechanosensitivity in mesenchymal endometrial-derived stem cells (hMESCs). Functional expression of native mechanosensitive stretch-activated channels (SACs) and calcium-sensitive potassium channels of different conductances in hMESCs was shown. Single current analysis of stretch-induced channel activity revealed functional coupling of SACs and BK channels in plasma membrane. The combination of cell-attached and inside-out experiments have indicated that highly localized Ca 2+ entry via SACs triggers BK channel activity. At the same time, SK channels are not coupled with SACs despite of high calcium sensitivity as compared to BK. Our data demonstrate novel mechanism controlling BK channel activity in native cells. We conclude that SACs and BK channels are clusterized in functional mechanosensitive domains in the plasma membrane of hMESCs. Co-clustering of ion channels may significantly contribute to mechano-dependent calcium signalling in stem cells. - Highlights: • Stretch-induced channel activity in human mesenchymal stem cells was analyzed. • Functional expression of SACs and Ca 2+ -sensitive BK and SK channels was shown. • Local Ca 2+ influx via stretch-activated channels triggers BK channel activity. • SK channels are not coupled with SACs despite higher sensitivity to [Ca 2+ ] i . • Functional clustering of SACs and BK channels in stem cell membrane is proposed.

Mutual Coupling Effects on Pattern Diversity Antennas for MIMO Femtocells

Directory of Open Access Journals (Sweden)

Yue Gao

2010-01-01

Full Text Available Diversity antennas play an important role in wireless communications. However, mutual coupling between multiple ports of a diversity antenna has significant effects on wireless radio links and channel capacity. In this paper, dual-port pattern diversity antennas for femtocell applications are proposed to cover GSM1800, UMTS, and WLAN frequency bands. The channel capacities of the proposed antennas and two ideal dipoles with different mutual coupling levels are investigated in an indoor environment. The relation between mutual coupling and channel capacity is observed through investigations of these antennas.

Stac gets the skeletal L-type calcium channel unstuck

Czech Academy of Sciences Publication Activity Database

Weiss, Norbert

2015-01-01

Roč. 34, č. 2 (2015), s. 101-103 ISSN 0231-5882 Institutional support: RVO:61388963 Keywords : calcium channel * L-type calcium channel * Ca(v)1.1 channel * Stac adaptor protein * excitation- contraction coupling * trafficking Subject RIV: CE - Biochemistry Impact factor: 0.892, year: 2015

Multi-Channel Capacitive Sensor Arrays

Directory of Open Access Journals (Sweden)

Bingnan Wang

2016-01-01

Full Text Available In this paper, multi-channel capacitive sensor arrays based on microstrip band-stop filters are studied. The sensor arrays can be used to detect the proximity of objects at different positions and directions. Each capacitive sensing structure in the array is connected to an inductive element to form resonance at different frequencies. The resonances are designed to be isolated in the frequency spectrum, such that the change in one channel does not affect resonances at other channels. The inductive element associated with each capacitive sensor can be surface-mounted inductors, integrated microstrip inductors or metamaterial-inspired structures. We show that by using metamaterial split-ring structures coupled to a microstrip line, the quality factor of each resonance can be greatly improved compared to conventional surface-mounted or microstrip meander inductors. With such a microstrip-coupled split-ring design, more sensing elements can be integrated in the same frequency spectrum, and the sensitivity can be greatly improved.

Theory of low-energy electron-molecule collision physics in the coupled-channel method and application to e-CO2 scattering

International Nuclear Information System (INIS)

Morrison, M.A.

1976-08-01

A theory of electron-molecule scattering based on the fixed-nuclei approximation in a body-fixed reference frame is formulated and applied to e-CO 2 collisions in the energy range from 0.07 to 10.0 eV. The procedure used is a single-center coupled-channel method which incorporates a highly accurate static interaction potential, an approximate local exchange potential, and an induced polarization potential. Coupled equations are solved by a modification of the integral equations algorithm; several partial waves are required in the region of space near the nuclei, and a transformation procedure is developed to handle the consequent numerical problems. The potential energy is converged by separating electronic and nuclear contributions in a Legendre-polynomial expansion and including a large number of the latter. Formulas are derived for total elastic, differential, momentum transfer, and rotational excitation cross sections. The Born and asymptotic decoupling approximations are derived and discussed in the context of comparison with the coupled-channel cross sections. Both are found to be unsatisfactory in the energy range under consideration. An extensive discussion of the technical aspects of calculations for electron collisions with highly nonspherical targets is presented, including detailed convergence studies and a discussion of various numerical difficulties. The application to e-CO 2 scattering produces converged results in good agreement with observed cross sections. Various aspects of the physics of this collision are discussed, including the 3.8 eV shape resonance, which is found to possess both p and f character, and the anomalously large low-energy momentum transfer cross sections, which are found to be due to Σ/sub g/ symmetry. Comparison with static and static-exchange approximations are made

C-terminal modulatory domain controls coupling of voltage-sensing to pore opening in Cav1.3 L-type Ca(2+) channels.

Science.gov (United States)

Lieb, Andreas; Ortner, Nadine; Striessnig, Jörg

2014-04-01

Activity of voltage-gated Cav1.3 L-type Ca(2+) channels is required for proper hearing as well as sinoatrial node and brain function. This critically depends on their negative activation voltage range, which is further fine-tuned by alternative splicing. Shorter variants miss a C-terminal regulatory domain (CTM), which allows them to activate at even more negative potentials than C-terminally long-splice variants. It is at present unclear whether this is due to an increased voltage sensitivity of the Cav1.3 voltage-sensing domain, or an enhanced coupling of voltage-sensor conformational changes to the subsequent opening of the activation gate. We studied the voltage-dependence of voltage-sensor charge movement (QON-V) and of current activation (ICa-V) of the long (Cav1.3L) and a short Cav1.3 splice variant (Cav1.342A) expressed in tsA-201 cells using whole cell patch-clamp. Charge movement (QON) of Cav1.3L displayed a much steeper voltage-dependence and a more negative half-maximal activation voltage than Cav1.2 and Cav3.1. However, a significantly higher fraction of the total charge had to move for activation of Cav1.3 half-maximal conductance (Cav1.3: 68%; Cav1.2: 52%; Cav3.1: 22%). This indicated a weaker coupling of Cav1.3 voltage-sensor charge movement to pore opening. However, the coupling efficiency was strengthened in the absence of the CTM in Cav1.342A, thereby shifting ICa-V by 7.2 mV to potentials that were more negative without changing QON-V. We independently show that the presence of intracellular organic cations (such as n-methyl-D-glucamine) induces a pronounced negative shift of QON-V and a more negative activation of ICa-V of all three channels. These findings illustrate that the voltage sensors of Cav1.3 channels respond more sensitively to depolarization than those of Cav1.2 or Cav3.1. Weak coupling of voltage sensing to pore opening is enhanced in the absence of the CTM, allowing short Cav1.342A splice variants to activate at lower voltages

Composite Higgs Models and the tt-bar H Channel

International Nuclear Information System (INIS)

Carmona, A.; Chala, M.; Santiago, J.

2012-01-01

Despite its suppressed couplings to Standard Model particles, a composite Higgs with mass m H = 125 GeV and a moderate degree of compositeness can be consistent with current Higgs searches, including a sizable enhancement in the H → γγ channel. Heavy resonances common to many composite Higgs models can mediate new Higgs production mechanisms. In particular, the tt-bar H channel can be accessible at the LHC in these models through the exchange of colored vector and fermion resonances. In this case, the tt-bar H channel is not a direct measure of the top Yukawa coupling. (authors)

Spin chain model for correlated quantum channels

Energy Technology Data Exchange (ETDEWEB)

Rossini, Davide [International School for Advanced Studies SISSA/ISAS, via Beirut 2-4, I-34014 Trieste (Italy); Giovannetti, Vittorio; Montangero, Simone [NEST-CNR-INFM and Scuola Normale Superiore, Piazza dei Cavalieri 7, I-56126 Pisa (Italy)], E-mail: monta@sns.it

2008-11-15

We analyze the quality of the quantum information transmission along a correlated quantum channel by studying the average fidelity between input and output states and the average output purity, giving bounds for the entropy of the channel. Noise correlations in the channel are modeled by the coupling of each channel use with an element of a one-dimensional interacting quantum spin chain. Criticality of the environment chain is seen to emerge in the changes of the fidelity and of the purity.

Experimental studies of laser guiding and wake excitation in plasma channels

International Nuclear Information System (INIS)

Volfbeyn, P.; Lawrence Berkeley National Lab., CA

1998-06-01

This thesis presents results of experimental investigations of laser guiding in plasma channels. A new technique for plasma channel creation, the Ignitor-Heater scheme was proposed and experimentally tested in hydrogen and nitrogen. It made use of two laser pulses. The Ignitor, an ultrashort ( 17 W/cm 2 , 75fs laser pulse. The guiding properties and transmission and coupling efficiency were studied as a function of relative position of the channel and the injection pulse focus. Whereas entrance coupling efficiency into the channel was lower than expected, channel coupling to continuum losses were found to be in good agreement with analytical predictions. The authors speculate that increased coupling efficiency can be achieved through better mode matching into the channel. Analytic and numerical one dimensional (1-D), nonrelativistic theory of laser pulse propagation in underdense plasma was presented, in the context of laser wakefield acceleration. The relation between the laser pulse energy depletion, longitudinal laser pulse shape distortion, and changes in the group velocity and center wavelength was explored. 1-D theory was extended to treat the case of a laser exciting a wake in a hollow plasma channel, by making use of an energy conservation argument. Based on the results of this theory, a laser wakefield diagnostic was proposed where, by measuring the changes in phase or spectrum of the driving laser pulse, it is possible to infer the amplitude of the plasma wake

Hotels’ dependency on online intermediaries and their chosen distribution channel portfolios: three country insights

OpenAIRE

Stangl, Brigitte; Inversini, Alessandro; Schegg, Roland

2016-01-01

New intermediaries are entering the market, challenging the hospitality industry to find an appropriate\\ud distribution channel portfolio. This research investigates how many channels hotels in Austria, Germany\\ud and Switzerland choose and what role the various channels play. Findings based on 1014 questionnaires\\ud reveal an average mix of 8.06 offline and online channel categories. Traditional channels, such as walk-ins\\ud and telephone, still play a major role; however, about one fifth of...

Strong coupling between a permalloy ferromagnetic contact and helical edge channel in a narrow HgTe quantum well

Energy Technology Data Exchange (ETDEWEB)

Kononov, A.; Egorov, S. V. [Russian Academy Sciences, Institute of Solid State Physics (Russian Federation); Kvon, Z. D.; Mikhailov, N. N.; Dvoretsky, S. A. [Institute of Semiconductor Physics (Russian Federation); Deviatov, E. V., E-mail: dev@issp.ac.ru [Russian Academy Sciences, Institute of Solid State Physics (Russian Federation)

2016-11-15

We experimentally investigate spin-polarized electron transport between a permalloy ferromagnet and the edge of a two-dimensional electron system with band inversion, realized in a narrow, 8 nm wide, HgTe quantum well. In zero magnetic field, we observe strong asymmetry of the edge potential distribution with respect to the ferromagnetic ground lead. This result indicates that the helical edge channel, specific for the structures with band inversion even at the conductive bulk, is strongly coupled to the ferromagnetic side contact, possibly due to the effects of proximity magnetization. This allows selective and spin-sensitive contacting of helical edge states.

Additivity properties of a Gaussian channel

International Nuclear Information System (INIS)

Giovannetti, Vittorio; Lloyd, Seth

2004-01-01

The Amosov-Holevo-Werner conjecture implies the additivity of the minimum Renyi entropies at the output of a channel. The conjecture is proven true for all Renyi entropies of integer order greater than two in a class of Gaussian bosonic channel where the input signal is randomly displaced or where it is coupled linearly to an external environment

From four- to two-channel Kondo effect in junctions of XY spin chains

Energy Technology Data Exchange (ETDEWEB)

Giuliano, Domenico, E-mail: domenico.giuliano@fis.unical.it [Dipartimento di Fisica, Università della Calabria, Arcavacata di Rende I-87036, Cosenza (Italy); INFN, Gruppo collegato di Cosenza, Arcavacata di Rende I-87036, Cosenza (Italy); Sodano, Pasquale, E-mail: pasquale.sodano02@gmail.com [International Institute of Physics, Universidade Federal do Rio Grande do Norte, 59078-400 Natal, RN (Brazil); Departemento de Física Teorica e Experimental, Universidade Federal do Rio Grande do Norte, 59072-970 Natal, RN (Brazil); Tagliacozzo, Arturo, E-mail: arturo.tagliacozzo@na.infn.it [INFN, Gruppo collegato di Cosenza, Arcavacata di Rende I-87036, Cosenza (Italy); Dipartimento di Fisica, Università di Napoli “Federico II”, Monte S. Angelo-Via Cintia, I-80126 Napoli (Italy); CNR-SPIN, Monte S. Angelo-Via Cintia, I-80126 Napoli (Italy); Trombettoni, Andrea, E-mail: andreatr@sissa.it [CNR-IOM DEMOCRITOS Simulation Center, Via Bonomea 265, I-34136 Trieste (Italy); SISSA and INFN, Sezione di Trieste, Via Bonomea 265, I-34136 Trieste (Italy)

2016-08-15

We consider the Kondo effect in Y-junctions of anisotropic XY models in an applied magnetic field along the critical lines characterized by a gapless excitation spectrum. We find that, while the boundary interaction Hamiltonian describing the junction can be recasted in the form of a four-channel, spin-1/2 antiferromagnetic Kondo Hamiltonian, the number of channels effectively participating in the Kondo effect depends on the chain parameters, as well as on the boundary couplings at the junction. The system evolves from an effective four-channel topological Kondo effect for a junction of XX-chains with symmetric boundary couplings into a two-channel one at a junction of three quantum critical Ising chains. The effective number of Kondo channels depends on the properties of the boundary and of the bulk. The XX-line is a “critical” line, where a four-channel topological Kondo effect can be recovered by fine-tuning the boundary parameter, while along the line in parameter space connecting the XX-line and the critical Ising point the junction is effectively equivalent to a two-channel topological Kondo Hamiltonian. Using a renormalization group approach, we determine the flow of the boundary couplings, which allows us to define and estimate the critical couplings and Kondo temperatures of the different Kondo (pair) channels. Finally, we study the local transverse magnetization in the center of the Y-junction, eventually arguing that it provides an effective tool to monitor the onset of the two-channel Kondo effect.

From four- to two-channel Kondo effect in junctions of XY spin chains

International Nuclear Information System (INIS)

Giuliano, Domenico; Sodano, Pasquale; Tagliacozzo, Arturo; Trombettoni, Andrea

2016-01-01

We consider the Kondo effect in Y-junctions of anisotropic XY models in an applied magnetic field along the critical lines characterized by a gapless excitation spectrum. We find that, while the boundary interaction Hamiltonian describing the junction can be recasted in the form of a four-channel, spin-1/2 antiferromagnetic Kondo Hamiltonian, the number of channels effectively participating in the Kondo effect depends on the chain parameters, as well as on the boundary couplings at the junction. The system evolves from an effective four-channel topological Kondo effect for a junction of XX-chains with symmetric boundary couplings into a two-channel one at a junction of three quantum critical Ising chains. The effective number of Kondo channels depends on the properties of the boundary and of the bulk. The XX-line is a “critical” line, where a four-channel topological Kondo effect can be recovered by fine-tuning the boundary parameter, while along the line in parameter space connecting the XX-line and the critical Ising point the junction is effectively equivalent to a two-channel topological Kondo Hamiltonian. Using a renormalization group approach, we determine the flow of the boundary couplings, which allows us to define and estimate the critical couplings and Kondo temperatures of the different Kondo (pair) channels. Finally, we study the local transverse magnetization in the center of the Y-junction, eventually arguing that it provides an effective tool to monitor the onset of the two-channel Kondo effect.

Microscopic approach in Inelastic Heavy-Ions Scattering with Excitation of Nuclear Collective States

International Nuclear Information System (INIS)

Lukyanov, K.V.; Zemlyanya, E.V.; Khtina, I.N.; Lukyanov, V.K; Metawe, Z.; Hanna, K.M.

2008-01-01

In the density distribution of a deformed target-nucleus,the spherical λ = 0 and the deformed λ = 2 parts were considered. On this basis, the corresponding potential parts U 0 and U i nt(2) of a double-folding microscopic nucleus-nucleus optical potential are obtained. Then, for these potentials and by using the coupled- channel technique (ECIS), the elastic and inelastic amplitudes are calculated for 17 O heavy ions scattering on 2 + collective excited stat of various target nuclei. Besides,the same cross-sections are calculated in the frame of an adiabatic approach of the eikonal approximation, where the inelastic amplitude is the linear function of U i nt (2).Both the obtained results are compared with the experimental data, and also discus their efficiency in predicting the deformation parameters of nuclei

AM06: the Associative Memory chip for the Fast TracKer in the upgraded ATLAS detector

International Nuclear Information System (INIS)

Annovi, A.; Beretta, M. M.; Calderini, G.; Crescioli, F.; Frontini, L.; Liberali, V.; Shojaii, S.R.; Stabile, A.

2017-01-01

This paper describes the AM06 chip, which is a highly parallel processor for pattern recognition in the ATLAS high energy physics experiment. The AM06 contains memory banks that store data organized in 18 bit words; a group of 8 words is called 'pattern'. Each AM06 chip can store up to 131 072 patterns. The AM06 is a large chip, designed in 65 nm CMOS, and it combines full-custom memory arrays, standard logic cells and serializer/deserializer IP blocks at 2 Gbit/s for input/output communication. The overall silicon area is 168 mm 2 and the chip contains about 421 million transistors. The AM06 receives the detector data for each event accepted by Level-1 trigger, up to 100 kHz, and it performs a track reconstruction based on hit information from channels of the ATLAS silicon detectors. Thanks to the design of a new associative memory cell and to the layout optimization, the AM06 consumption is only about 1 fJ/bit per comparison. The AM06 has been fabricated and successfully tested with a dedicated test system.

Effective channel approach to nuclear scattering at high energies

International Nuclear Information System (INIS)

Rule, D.W.

1975-01-01

The description of high energy nuclear reactions is considered within the framework of the effective channel approach. A variational procedure is used to obtain an expression for the Green's function in the effective channel, which includes the average fluctuation potential, average energy, and an additional term arising from the non-commutability of the kinetic energy operator and the effective target wave function. The resulting expression for the effective channel, containing one variational parameter, is used to obtain the coupling potential. The resulting formulation is applied to the elastic scattering of 1 GeV protons by 4 He nuclei. A simple Gaussian form is used for the spin--isospin averaged proton--nucleon interaction. The variational parameter in the effective channel wave function is fixed a posteriori via the total p-- 4 He cross section. The effect of the coupling to the effective channel is demonstrated, as well as the effect of each term in the coupled equation for this channel. The calculated elastic cross sections were compared to both the recent data from Saclay and the earlier Brookhaven data for the 1-GeV p-- 4 He elastic scattering cross section. Using proton--nucleus elastic scattering experiments to study the proton--nucleon elastic scattering amplitude is discussed. The main purpose of our study is to investigate the effects on the cross section of varying, within its estimated range of uncertainty, each parameter which enters into the coupled equations. The magnitude of these effects was found to be large enough to conclude that any effects due to dynamical correlations would be obscured by the uncertainties in the input parameters

Voltage-Dependent Gating of hERG Potassium Channels

Science.gov (United States)

Cheng, Yen May; Claydon, Tom W.

2012-01-01

The mechanisms by which voltage-gated channels sense changes in membrane voltage and energetically couple this with opening of the ion conducting pore has been the source of significant interest. In voltage-gated potassium (Kv) channels, much of our knowledge in this area comes from Shaker-type channels, for which voltage-dependent gating is quite rapid. In these channels, activation and deactivation are associated with rapid reconfiguration of the voltage-sensing domain unit that is electromechanically coupled, via the S4–S5 linker helix, to the rate-limiting opening of an intracellular pore gate. However, fast voltage-dependent gating kinetics are not typical of all Kv channels, such as Kv11.1 (human ether-à-go-go related gene, hERG), which activates and deactivates very slowly. Compared to Shaker channels, our understanding of the mechanisms underlying slow hERG gating is much poorer. Here, we present a comparative review of the structure–function relationships underlying activation and deactivation gating in Shaker and hERG channels, with a focus on the roles of the voltage-sensing domain and the S4–S5 linker that couples voltage sensor movements to the pore. Measurements of gating current kinetics and fluorimetric analysis of voltage sensor movement are consistent with models suggesting that the hERG activation pathway contains a voltage independent step, which limits voltage sensor transitions. Constraints upon hERG voltage sensor movement may result from loose packing of the S4 helices and additional intra-voltage sensor counter-charge interactions. More recent data suggest that key amino acid differences in the hERG voltage-sensing unit and S4–S5 linker, relative to fast activating Shaker-type Kv channels, may also contribute to the increased stability of the resting state of the voltage sensor. PMID:22586397

Voltage-dependent gating of hERG potassium channels

Directory of Open Access Journals (Sweden)

Yen May eCheng

2012-05-01

Full Text Available The mechanisms by which voltage-gated channels sense changes in membrane voltage and energetically couple this with opening of the ion conducting pore has been the source of significant interest. In voltage-gated potassium (Kv channels, much of our knowledge in this area comes from Shaker-type channels, for which voltage-dependent gating is quite rapid. In these channels, activation and deactivation are associated with rapid reconfiguration of the voltage-sensing domain unit that is electromechanically coupled, via the S4-S5 linker helix, to the rate-limiting opening of an intracellular pore gate. However, fast voltage-dependent gating kinetics are not typical of all Kv channels, such as Kv11.1 (human ether-a-go-go related gene, hERG, which activates and deactivates very slowly. Compared to Shaker channels, our understanding of the mechanisms underlying slow hERG gating is much poorer. Here, we present a comparative review of the structure-function relationships underlying voltage-dependent gating in Shaker and hERG channels, with a focus on the roles of the voltage sensing domain and the S4-S5 linker that couples voltage sensor movements to the pore. Measurements of gating current kinetics and fluorimetric analysis of voltage sensor movement are consistent with models suggesting that the hERG activation pathway contains a voltage independent step, which limits voltage sensor transitions. Constraints upon hERG voltage sensor movement may result from loose packing of the S4 helices and additional intra-voltage sensor counter charge interactions. More recent data suggest that key amino acid differences in the hERG voltage sensing unit and S4-S5 linker, relative to fast activating Shaker-type Kv channels, may also contribute to the increased stability of the resting state of the voltage sensor.

Recent advances in Multi-Channel Algebraic Scattering

International Nuclear Information System (INIS)

Karataglidis, S.; Fraser, P. R.; Amos, K.; Canton, L.; Pisent, G.; Svenne, J. P.; Knijff, D. van der

2011-01-01

For coupled-channel descriptions of low-energy nucleon-induced interactions involving nuclei with particle-unstable exited states, it is necessary to include the widths of the target states. How those widths may affect the elastic scattering cross sections is examined within the framework of the Multi-Channel Algebraic Scattering (MCAS) method.

Mixed convection in a baffled grooved channel

Indian Academy of Sciences (India)

MS received 16 May 2014; revised 19 October 2014; accepted 06 November 2014. Abstract. In the present numerical work, flow structure and heat transfer charac- teristics are investigated in a baffled grooved channel, differentially heated from the sides. The baffle is placed vertically downward from the top wall of grooved ...

Extension of BEPU methods to Sub-channel Thermal-Hydraulics and to Coupled Three-Dimensional Neutronics/Thermal-Hydraulics Codes

International Nuclear Information System (INIS)

Avramova, M.; Ivanov, K.; Arenas, C.

2013-01-01

The principles that support the risk-informed regulation are to be considered in an integrated decision-making process. Thus, any evaluation of licensing issues supported by a safety analysis would take into account both deterministic and probabilistic aspects of the problem. The deterministic aspects will be addressed using Best Estimate code calculations and considering the associated uncertainties i.e. Plus Uncertainty (BEPU) calculations. In recent years there has been an increasing demand from nuclear research, industry, safety and regulation for best estimate predictions to be provided with their confidence bounds. This applies also to the sub-channel thermal-hydraulic codes, which are used to evaluate local safety parameters. The paper discusses the extension of BEPU methods to the sub-channel thermal-hydraulic codes on the example of the Pennsylvania State University (PSU) version of COBRA-TF (CTF). The use of coupled codes supplemented with uncertainty analysis allows to avoid unnecessary penalties due to incoherent approximations in the traditional decoupled calculations, and to obtain more accurate evaluation of margins regarding licensing limit. This becomes important for licensing power upgrades, improved fuel assembly and control rod designs, higher burn-up and others issues related to operating LWRs as well as to the new Generation 3+ designs being licensed now (ESBWR, AP-1000, EPR-1600 and etc.). The paper presents the application of Generalized Perturbation Theory (GPT) to generate uncertainties associated with the few-group assembly homogenized neutron cross-section data used as input in coupled reactor core calculations. This is followed by a discussion of uncertainty propagation methodologies, being implemented by PSU in cooperation of Technical University of Catalonia (UPC) for reactor core calculations and for comprehensive multi-physics simulations. (authors)

From four- to two-channel Kondo effect in junctions of XY spin chains

Directory of Open Access Journals (Sweden)

Domenico Giuliano

2016-08-01

Full Text Available We consider the Kondo effect in Y-junctions of anisotropic XY models in an applied magnetic field along the critical lines characterized by a gapless excitation spectrum. We find that, while the boundary interaction Hamiltonian describing the junction can be recasted in the form of a four-channel, spin-1/2 antiferromagnetic Kondo Hamiltonian, the number of channels effectively participating in the Kondo effect depends on the chain parameters, as well as on the boundary couplings at the junction. The system evolves from an effective four-channel topological Kondo effect for a junction of XX-chains with symmetric boundary couplings into a two-channel one at a junction of three quantum critical Ising chains. The effective number of Kondo channels depends on the properties of the boundary and of the bulk. The XX-line is a “critical” line, where a four-channel topological Kondo effect can be recovered by fine-tuning the boundary parameter, while along the line in parameter space connecting the XX-line and the critical Ising point the junction is effectively equivalent to a two-channel topological Kondo Hamiltonian. Using a renormalization group approach, we determine the flow of the boundary couplings, which allows us to define and estimate the critical couplings and Kondo temperatures of the different Kondo (pair channels. Finally, we study the local transverse magnetization in the center of the Y-junction, eventually arguing that it provides an effective tool to monitor the onset of the two-channel Kondo effect.

Program package for calculation of cross sections of neutron scattering on deformed nuclei by the coupled-channel method

International Nuclear Information System (INIS)

Kloss, Yu.Yu.

1985-01-01

Program package and numerical solution of the problem for a system of coupled equations used in optical model to solve a problem on low and mean energy neutron scattering on deformed nuclei, is considered. With these programs differnet scattering cross sections depending on the incident neutron energy on even-even and even-odd nuclei were obtained. The programm permits to obtain different scattering cross sections (elastic, inelastic), excitation cross sections of the first three energy levels of rotational band depending on the energy, angular distributions and neutron polarizations including excited channels. In the program there is possibility for accounting even-even nuclei octupole deformation

Evaluation of a thermal SCWR core with sub-channel analysis

International Nuclear Information System (INIS)

Liu Xiaojing; Cheng Xu

2008-01-01

A previous study shows that the two-row fuel assembly has much more favorable neutron-physical and thermal-hydraulic behaviour than the existing one-row fuel assemblies. With this new developed two-row fuel assembly, a thermal SCWR core design is proposed Assessment of this design is carried out in this paper. The performance of this new core design is investigated with 3-D coupled thermal-hydraulic/neutronic calculations. During the coupling procedure, the thermal-hydraulic behaviour is analyzed using a single-channel code and the neutron-physical performance is computed with a 3-D reactor physical code. This paper presents the main results achieved so far related to the distribution of some neutronic and thermal-hydraulic parameters. Since the power distribution in some fuel assemblies is extremely uneven, sub-channel analysis is applied to the hottest and most non-uniform assembly in the core. The sub-channel analysis is performed with the power and thermal hydraulic parameters from the coupling results. It provides the hot channel factor and the maximal cladding surface temperature more precisely. The power and mass flux distribution in these assemblies are illustrated in detail for the demonstration purpose. The difference of the results evaluated with two different methods, i.e. sub-channel analysis and single-channel analysis, shows the importance of applying sub-channel analysis. A sensitivity analysis of some important parameters is also carried out. (author)

The Role of Canonical Transient Receptor Potential Channels in Seizure and Excitotoxicity

Directory of Open Access Journals (Sweden)

Fang Zheng

2014-04-01

Full Text Available Canonical transient receptor potential (TRPC channels are a family of polymodal cation channels with some degree of Ca2+ permeability. Although initially thought to be channels mediating store-operated Ca2+ influx, TRPC channels can be activated by stimulation of Gq-coupled G-protein coupled receptors, or by an increase in intracellular free Ca2+ concentration. Thus, activation of TRPC channels could be a common downstream event of many signaling pathways that contribute to seizure and excitotoxicity, such as N-methyl-D-aspartate (NMDA receptor-mediated Ca2+ influx, or metabotropic glutamate receptor activation. Recent studies with genetic ablation of various TRPC family members have demonstrated that TRPC channels, in particular heteromeric TRPC1/4 channels and homomeric TRPC5 channels, play a critical role in both pilocarpine-induced acute seizures and neuronal cell death. However, exact underlying mechanisms remain to be fully elucidated, and selective TRPC modulators and antibodies with better specificity are urgently needed for future research.

Intercellular odontoblast communication via ATP mediated by pannexin-1 channel and phospholipase C-coupled receptor activation.

Directory of Open Access Journals (Sweden)

Masaki eSato

2015-11-01

Full Text Available Extracellular ATP released via pannexin-1 channels, in response to the activation of mechanosensitive-TRP channels during odontoblast mechanical stimulation, mediates intercellular communication among odontoblasts in dental pulp slice preparation dissected form rat incisor. Recently, odontoblast cell lines, such as mouse odontoblast lineage cells, have been widely used to investigate physiological/pathological cellular functions. To clarify whether the odontoblast cell lines also communicate with each other by diffusible chemical substance(s, we investigated the chemical intercellular communication among cells from mouse odontoblast cell lines following mechanical stimulation. A single cell was stimulated using a glass pipette filled with standard extracellular solution. We measured intracellular free Ca2+ concentration ([Ca2+]i by fura-2 in stimulated cells, as well as in cells located nearby. Direct mechanical stimulation to a single odontoblast increased [Ca2+]i, which showed sensitivity to capsazepine. In addition, we observed increases in [Ca2+]i not only in the mechanically stimulated odontoblast, but also in nearby odontoblasts. We could observe mechanical stimulation-induced increase in [Ca2+]i in a stimulated human embryo kidney (HEK 293 cell, but not in nearby HEK293 cells. The increase in [Ca2+]i in nearby odontoblasts, but not in the stimulated odontoblast, was inhibited by adenosine triphosphate (ATP release channel (pannexin-1 inhibitor in a concentration- and spatial-dependent manner. Moreover, in the presence of phospholipase C (PLC inhibitor, the increase in [Ca2+]i in nearby odontoblasts, following mechanical stimulation of a single odontoblast, was abolished. We could record some inward currents evoked from odontoblasts near the stimulated odontoblast, but the currents were observed in only 4.8% of the recorded odontoblasts. The results of this study showed that ATP is released via pannexin-1, from a mechanically stimulated

G-protein-coupled inward rectifier potassium current contributes to ventricular repolarization

DEFF Research Database (Denmark)

Liang, Bo; Nissen, Jakob D; Laursen, Morten

2014-01-01

The purpose of this study was to investigate the functional role of G-protein-coupled inward rectifier potassium (GIRK) channels in the cardiac ventricle.......The purpose of this study was to investigate the functional role of G-protein-coupled inward rectifier potassium (GIRK) channels in the cardiac ventricle....

Hyperonic mixing in five-baryon double-strangeness hypernuclei in a two-channel treatment

OpenAIRE

Lanskoy, D. E.; Yamamoto, Y.

2003-01-01

Properties of hypernuclei $_{\\Lambda \\Lambda}^5$H and $_{\\Lambda \\Lambda }^5$He are studied in a two-channel approach with explicit treatment of coupling of channels ^3\\text{Z}+\\Lambda+\\Lambda and \\alpha+\\Xi. Diagonal \\Lambda\\Lambda and coupling \\Lambda\\Lambda-\\Xi N interactions are derived within G-matrix procedure from Nijmegen meson-exchange models. Bond energy \\Delta B_{\\Lambda\\Lambda} in $_{\\Lambda \\Lambda}^5$He exceeds significantly that in $_{\\Lambda \\Lambda}^5$H due to the channel cou...

Nonreciprocal optical tunnelling through evanescently coupled Tamm states in magnetophotonic crystals

Energy Technology Data Exchange (ETDEWEB)

Fang, Yun-Tuan [Jiangsu Univ., Zhenjiang (China). School of Computer Science and Telecommunication Engineering; Han, Ling [The Second Military Medical Univ., Shanghai (China). Dept. of Radiation Medicine; Gao, Yong-Feng [Jiangsu Univ., Zhenjiang (China). School of Mechanical Engineering

2015-07-01

Evanescently coupled Tamm states are achieved through two magnetophotonic crystals (MPCs) with a pair of coupling prisms. At the wavelengths of coupled Tamm states, a double of nonreciprocal optical tunnelling channels is found through the transmission spectra obtained from a developed transfer matrix method. The nonreciprocal tunnelling wavelength and the interval between two nonreciprocal channels can be adjusted depending on the width of the air gap between two MPCs or the scale invariant of a PC. The nonreciprocal tunnelling is demonstrated through electromagnetic field distribution simulations based on finite element software. Such theoretical results may provide a new method to design tunable optical isolators with a double of channels.

Ion channelling in diamond

International Nuclear Information System (INIS)

Derry, T.E.

1978-06-01

Diamond is one of the most extreme cases from a channelling point of view, having the smallest thermal vibration amplitude and the lowest atomic number of commonly-encountered crystals. These are the two parameters most important for determining channelling behaviour. It is of consiberable interest therefore to see how well the theories explaining and predicting the channeling properties of other substance, succeed with diamond. Natural diamond, although the best available form for these experiments, is rather variable in its physical properties. Part of the project was devoted to considering and solving the problem of obtaining reproducible results representative of the ideal crystal. Channelling studies were performed on several good crystals, using the Rutherford backscattering method. Critical angles for proton channelling were measured for incident energies from 0.6 to 4.5 MeV, in the three most open axes and three most open planes of the diamond structure, and for α-particle channelling at 0.7 and 1.0 MeV (He + ) in the same axes and planes. For 1.0 MeV protons, the crystal temperature was varied from 20 degrees Celsius to 700 degrees Celsius. The results are presented as curves of backscattered yield versus angle in the region of each axis or plane, and summarised in the form of tables and graphs. Generally the critical angles, axial minimum yields, and temperature dependence are well predicted by the accepted theories. The most valuable overall conclusion is that the mean thermal vibration amplitude of the atoms in a crytical determines the critical approach distance to the channel walls at which an ion can remain channelled, even when this distance is much smaller than the Thomas-Fermi screening distance of the atomic potential, as is the case in diamond. A brief study was made of the radiation damage caused by α-particle bombardment, via its effect on the channelling phenomenon. It was possible to hold damage down to negligible levels during the

Phosphorylation of rat brain purified mitochondrial Voltage-Dependent Anion Channel by c-Jun N-terminal kinase-3 modifies open-channel noise.

Science.gov (United States)

Gupta, Rajeev

2017-09-02

The drift kinetic energy of ionic flow through single ion channels cause vibrations of the pore walls which are observed as open-state current fluctuations (open-channel noise) during single-channel recordings. Vibration of the pore wall leads to transitions among different conformational sub-states of the channel protein in the open-state. Open-channel noise analysis can provide important information about the different conformational sub-state transitions and how biochemical modifications of ion channels would affect their transport properties. It has been shown that c-Jun N-terminal kinase-3 (JNK3) becomes activated by phosphorylation in various neurodegenerative diseases and phosphorylates outer mitochondrion associated proteins leading to neuronal apoptosis. In our earlier work, JNK3 has been reported to phosphorylate purified rat brain mitochondrial voltage-dependent anion channel (VDAC) in vitro and modify its conductance and opening probability. In this article we have compared the open-state noise profile of the native and the JNK3 phosphorylated VDAC using Power Spectral Density vs frequency plots. Power spectral density analysis of open-state noise indicated power law with average slope value α ≈1 for native VDAC at both positive and negative voltage whereas average α value open-state noise arises due to coupling of ionic transport and conformational sub-states transitions in open-state and this coupling is perturbed as a result of channel phosphorylation. Copyright © 2017 Elsevier Inc. All rights reserved.

EFEKTIFITAS MEKANISME TRANSMISI KEBIJAKAN MONETER PADA JALUR SUKU BUNGA PERIODE 2005:07-2010:06

Directory of Open Access Journals (Sweden)

Muhammad Alfian

2017-11-01

Full Text Available Vector Auto Regression (VAR is an analysis or statistic method which can be used to predict time series variable and to analyst dynamic impact of disturbance factor in the variable system. In addition, VAR analysis is very usefull to assess the interrelationship between economics variable. This research through the following test phases: unit root test, optimal lag test, granger causality test, and form a vector auto regression model (VAR. The data used in this research is the Bank Indonesia Certificate rate data (SBI, interbank offered rate data (PUAB, deposit rate data (DEP, loan rate data (KDRT and credit aggregate data (AGKDRT of Indonesia in the period 2005:07-2010:06. The effectiveness was measured by two indicators. They are: (1. how fast or how many time lag needed since the shock of monetary instruments (rSBI until the realisation of intermediary target of monetary policy (monetary aggregate. (2. How strong the variables of Interest Rate Channel response the shock of SBI interest rate and other variable. This study used secondary data issued by Bank Indonesia. The result of the study shows that response velocity of variable in Interest Rate Channel towards shock instrument of monetary policy (SBI until reach the final target about 4 months. While impulse response function of variables in this channel to the shock instrument of monetary policy (SBI is quiet weak and the main variable in interest rate money market among bank (PUAB able to explain diversity intermediary target of monetary policy (Monetary Aggregate about 2,82%. This result once shows a weak Granger causality and predictive power between PUAB as the operational target with monetary aggregate as the intermediary target of monetary policy. Thus we can conclude that mechanism of monetary policy transmission through Interest Rate Channel is not effective to reach the intermediary target of monetary policy of Indonesia period of 2005:072010:06. Keyword: Vector Auto Regression

Analysis of inelastic neutron scattering cross-sections to 2{sup +} states in even mass palladium nuclides. Final report. Pt. 1

Energy Technology Data Exchange (ETDEWEB)

Meister, A

1994-09-01

Starting from experimental {gamma}-ray emission cross sections, measured recently at IRMM Geel, the (n, n`) cross sections for the isolated states are derived. The neutron energy range is extended from the reaction threshold up to 1.3 MeV, when cascade {gamma}-ray emissions complicate the analysis. In the case of Pd-110 it was possible to deduce the (n, n`) excitation function from the experimental data up to a neutron energy of 3.3 MeV. The experimental cross sections are corrected for anisotropy of {gamma}-ray emission. The analysis of the cross sections is carried out by compound nucleus reaction theory and vibrational excitations. The coupled channels code ECIS88 is used. The theoretical description of the experimental data for the first and second 2+ states is accurate; without doing any special adjustments of parameters. (orig.).

9Be scattering with microscopic wave functions and the continuum-discretized coupled-channel method

Science.gov (United States)

Descouvemont, P.; Itagaki, N.

2018-01-01

We use microscopic 9Be wave functions defined in a α +α +n multicluster model to compute 9Be+target scattering cross sections. The parameter sets describing 9Be are generated in the spirit of the stochastic variational method, and the optimal solution is obtained by superposing Slater determinants and by diagonalizing the Hamiltonian. The 9Be three-body continuum is approximated by square-integral wave functions. The 9Be microscopic wave functions are then used in a continuum-discretized coupled-channel (CDCC) calculation of 9Be+208Pb and of 9Be+27Al elastic scattering. Without any parameter fitting, we obtain a fair agreement with experiment. For a heavy target, the influence of 9Be breakup is important, while it is weaker for light targets. This result confirms previous nonmicroscopic CDCC calculations. One of the main advantages of the microscopic CDCC is that it is based on nucleon-target interactions only; there is no adjustable parameter. The present work represents a first step towards more ambitious calculations involving heavier Be isotopes.

Parametric study of the stability properties of a thermo hydraulic channel coupled to punctual kinetics

International Nuclear Information System (INIS)

Cecenas F, M.; Campos G, R.M.

2005-01-01

The reason of decay is the indicator of stability usually used in the literature to evaluate stability of boiling water reactors, however, in the operation of this type of reactors is considered the length of boiling like an auxiliary parameter for the evaluation of stability. In this work its are studied the variation of these two indicators when modifying a given an operation parameter in a model of a thermo hydraulic channel coupled to punctual kinetics, maintaining all the other input constant variables. The parameters selected for study are the axial profile of power, the subcooling, the flow of coolant and the thermal power. The study is supplemented by means of real data of plant using the one Benchmark of Ringhals, and the results for the case of the ratio of decay its are compared with the decay reasons obtained by means of autoregression models of the local instrumentation of neutron flux. (Author)

Measurement of the heat transfer coefficient in the dimpled channel: effects of dimple arrangement and channel height

International Nuclear Information System (INIS)

Shin, So Min; Lee, Ki Seon; Park, Seoung Duck; Kwak, Jae Su

2009-01-01

Heat transfer coefficients were measured in a channel with one side dimpled surface. The sphere type dimples were fabricated, and the diameter (D) and the depth of dimple was 16 mm and 4 mm, respectively. Two channel heights of about 0.6D and 1.2D, two dimple configurations were tested. The Reynolds number based on the channel hydraulic diameter was varied from 30000 to 50000. The improved hue detection based transient liquid crystal technique was used in the heat transfer measurement. Heat transfer measurement results showed that high heat transfer was induced downstream of the dimples due to flow reattachment. Due to the flow recirculation on the upstream side in the dimple, the heat transfer coefficient was very low. As the Reynolds increased, the overall heat transfer coefficients also increased. With the same dimple arrangement, the heat transfer coefficients and the thermal performance factors were higher for the lower channel height. As the distance between the dimples became smaller, the overall heat transfer coefficient and the thermal performance factors increased

Treatment for the recoil effects of the multi-step heavy-ion nucleon transfers with the orthogonalized coupled-reaction-channel theory

International Nuclear Information System (INIS)

Misono, S.; Imanishi, B.

1997-02-01

We have investigated recoil effects in heavy-ion reactions for the nucleon transfers, and the validity of the spatially local approximation for the non-local transfer interaction defined by the orthogonalized coupled-reaction-channel (OCRC) theory. This approximation makes it easier to treat multi-step transfer processes with the coupled channel method and makes it possible to define the nucleon molecular orbitals with the inclusion of the recoil effects. The transfer interaction is expanded in a power series of the momentum operator, and is approximated by the first order term, i.e., the spatially local term. The numerical calculation for the core-symmetric systems 12 C+ 13 C and 16 O+ 17 O with this approximation shows that the recoil effects are well included in the results at energies lower than a few MeV/nucleon. Furthermore, the OCRC formalism allows us even to employ the complete no-recoil approximation for the calculation of cross sections, even though it is not adequate to use this approximation in the distorted wave Born approximation (DWBA) method. As to polarization, however, the no-recoil approximation is not good even in the OCRC formalism. We discuss the recoil effects on nucleon molecular-orbital states. It is shown that states of the covalent molecular orbitals of the valence (transferred) nucleon are little affected by the recoil effects, as already suggested by Korotky et al. in the full finite-range DWBA analysis of the transfer reaction, 13 C( 13 C, 12 C) 14 C. (author). 59 refs

VAX CAMAC channel

International Nuclear Information System (INIS)

Nelson, D.J.; Breidenbach, M.; Granieri, C.D.; Grund, J.E.; Patrick, J.F.; Weaver, L.J.

1980-10-01

A new generation CAMAC System has been developed for the Mark II Detector at SLAC's PEP storage ring. This flexible system can efficiently transfer data between a host computer and a very large set of CAMAC data acquisition and control modules. A bipolar microprocessor operates as a Channel interface by supervising the CAMAC system and minimizing the host computer's work. This programmable channel couples the host to a set of System Crates; each System Crate houses Branch Drivers that can directly control a set of crates or communicate over differential parallel highways to Branch Receivers for control of distant crates. A coherent software package integrates the high level programs, system driver level programs, and microcode control of the system

Some properties of a channeling model of fracture flow

International Nuclear Information System (INIS)

Tsang, Y.W.; Tsang, C.F.; Neretnieks, I.

1986-12-01

The Gamma distribution and the log-normal distribution were used to describe the density distribution of the apertures within a channel. For every set of parameter values (correlation length, and the parameters of the distributions) 95 different statistically equivalent channels were generated. The aperture distribution along the channels are then used to determine the total channel volume, the hydraulic conductivity and the flow rate and residence time for a given gradient. The volumes of the channels were found to vary little whereas the hydraulic conductivity, which is primarily determined by the smallest aperture along the channels, varies considerably. For a wide density distribution the hydraulic conductivity easily spans several orders of magnitude. The flow rate and the velocity variations are primarily influenced by the conductivity variations and are only to a small extent influenced by the volume variations in the channel. The average specific area of the whole channel exhibits small variations. The hydraulic and transport properties of hypothetical fractures containing several channels are investigated by randomly picking several of the generated channels, coupling them in parallel and subjecting them to the same hydraulic head difference. The flow rate and residence time distribution of the coupled channels is used to investigate the dispersion properties of the fracture. It was found that the dispersion expressed as Peclet numbers was on the order of 1 to 4 for most of the distributions used but could attain very large Peclet numbers for (unrealistically) narrow aperture distributions. Simulations of breakthrough curves for tracers in single fracture flow experiments indicate that when few channels participate and the dispersion in the individual channels is small, the breakthrough curve is expected not to be entirely smooth but to contain distinct plateaus. This property has been noted in several experiments. (orig./HP)

On the domestic fuel channel for BWR

International Nuclear Information System (INIS)

Fukada, Hiroshi

1979-01-01

Kobe Steel Ltd. started the domestic manufacture of fuel channel boxes for BWRs in 1967, and entered the actual production stage four years after that. Since 1976, the mass production system was adopted with the increase of the demand. The requirements about the surface contamination and the dimensional accuracy over whole length are very strict in the fuel channel boxes, moreover, special consideration must be given so as to prevent the deformation in use. The unique working methods such as electron beam welding, high temperature press forming and so on are employed in Kobe Steel Ltd. to satisfy such strict requirements, therefore the quality of the produced fuel channel boxes is superior to imported ones. At present, the fuel channel boxes domestically made by Kobe Steel Ltd. are used for almost all BWRs in Japan. The functions of fuel channel boxes are to flow boiling coolant uniformly upward, to guide control rods, and to increase the rigidity of fuel assembly. The fuel channel boxes are the square tubes of zircaloy 4 of 134.06 mm inside width, 2.03 mm thickness, and 4118 or 4239 mm length. The progress of the development and the features of the fuel channel boxes and the manufacturing processes are described. Zircaloy plates are formed into channels, and two channels are electron beam-welded after the edge preparation, to make a box. Ultrasonic examination and stress relief treatment are applied, and clips and spacers are welded. (Kako, I.)

Electromagnetic Pulse Coupling Analysis of Electronic Equipment

OpenAIRE

Hong Lei; Qingying LI

2017-01-01

High-intensity nuclear explosion caused by high-altitude nuclear electromagnetic pulse through the antenna, metal cables, holes and other channels, coupled with very high energy into the electronic device, and cause serious threats. In this paper, the mechanism, waveform, coupling path and damage effect of nuclear electromagnetic pulse is analyzed, and the coupling mechanism of nuclear electromagnetic pulse is studied.

Effects of pseudoscalar-baryon channels in the dynamically generated vector-baryon resonances

Energy Technology Data Exchange (ETDEWEB)

Garzon, E.J.; Oset, E. [Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Departamento de Fisica Teorica and IFIC, Valencia (Spain)

2012-01-15

We study the interaction of vector mesons with the octet of stable baryons in the framework of the local hidden gauge formalism using a coupled-channels unitary approach, including also the pseudoscalar-baryon channels which couple to the same quantum numbers. We examine the scattering amplitudes and their poles, which can be associated to the known J{sup P}=1/2{sup -}, 3/2{sup -} baryon resonances, and determine the role of the pseudoscalar-baryon channels, changing the width and eventually the mass of the resonances generated with only the basis of vector-baryon states. (orig.)

Modulation of firing and synaptic transmission of serotonergic neurons by intrinsic G protein-coupled receptors and ion channels

Directory of Open Access Journals (Sweden)

Takashi eMaejima

2013-05-01

Full Text Available Serotonergic neurons project to virtually all regions of the CNS and are consequently involved in many critical physiological functions such as mood, sexual behavior, feeding, sleep/wake cycle, memory, cognition, blood pressure regulation, breathing and reproductive success. Therefore serotonin release and serotonergic neuronal activity have to be precisely controlled and modulated by interacting brain circuits to adapt to specific emotional and environmental states. We will review the current knowledge about G protein-coupled receptors and ion channels involved in the regulation of serotonergic system, how their regulation is modulating the intrinsic activity of serotonergic neurons and its transmitter release and will discuss the latest methods for controlling the modulation of serotonin release and intracellular signaling in serotonergic neurons in vitro and in vivo.

Development of therapeutic antibodies to G protein-coupled receptors and ion channels: Opportunities, challenges and their therapeutic potential in respiratory diseases.

Science.gov (United States)

Douthwaite, Julie A; Finch, Donna K; Mustelin, Tomas; Wilkinson, Trevor C I

2017-01-01

The development of recombinant antibody therapeutics continues to be a significant area of growth in the pharmaceutical industry with almost 50 approved monoclonal antibodies on the market in the US and Europe. Therapeutic drug targets such as soluble cytokines, growth factors and single transmembrane spanning receptors have been successfully targeted by recombinant monoclonal antibodies and the development of new product candidates continues. Despite this growth, however, certain classes of important disease targets have remained intractable to therapeutic antibodies due to the complexity of the target molecules. These complex target molecules include G protein-coupled receptors and ion channels which represent a large target class for therapeutic intervention with monoclonal antibodies. Although these targets have typically been addressed by small molecule approaches, the exquisite specificity of antibodies provides a significant opportunity to provide selective modulation of these important regulators of cell function. Given this opportunity, a significant effort has been applied to address the challenges of targeting these complex molecules and a number of targets are linked to the pathophysiology of respiratory diseases. In this review, we provide a summary of the importance of GPCRs and ion channels involved in respiratory disease and discuss advantages offered by antibodies as therapeutics at these targets. We highlight some recent GPCRs and ion channels linked to respiratory disease mechanisms and describe in detail recent progress made in the strategies for discovery of functional antibodies against challenging membrane protein targets such as GPCRs and ion channels. Copyright © 2016 Elsevier Inc. All rights reserved.

Observation of weak coupling effects in Ba0.6 K0.4 Fe2 As2 junctions patterned across a naturally formed grain boundary

International Nuclear Information System (INIS)

Hong, Sung-Hak; Lee, Soon-Gul; Lee, Nam Hoon; Kang, Won Nam

2014-01-01

We have fabricated intergrain nanobridge junctions from a Ba 0.6 K 0.4 Fe 2 As 2 film and observed their weak coupling effects. We prepared the junction by patterning a nanobridge across a natural grain boundary by using a focused ion beam etching technique and studied their superconducting transition properties. The resistive transition showed three steps: the transitions of the bulk, the microbridge, and the junction grain boundary. Current–voltage curves showed typical Josephson junction characteristics, well-matched with the model of a resistively shunted junction incorporated with thermal fluctuations. Fitting data to theory revealed much larger current fluctuations than expected from the Johnson–Nyquist theorem. The junction showed a linear temperature dependence of the critical current and a constant normal-state resistance, indicating that the grain boundary played a role as a tunnel barrier with a very poor conductance. (paper)

Improving radiation hardness in space-based Charge-Coupled Devices through the narrowing of the charge transfer channel

Science.gov (United States)

Hall, D. J.; Skottfelt, J.; Soman, M. R.; Bush, N.; Holland, A.

2017-12-01

Charge-Coupled Devices (CCDs) have been the detector of choice for imaging and spectroscopy in space missions for several decades, such as those being used for the Euclid VIS instrument and baselined for the SMILE SXI. Despite the many positive properties of CCDs, such as the high quantum efficiency and low noise, when used in a space environment the detectors suffer damage from the often-harsh radiation environment. High energy particles can create defects in the silicon lattice which act to trap the signal electrons being transferred through the device, reducing the signal measured and effectively increasing the noise. We can reduce the impact of radiation on the devices through four key methods: increased radiation shielding, device design considerations, optimisation of operating conditions, and image correction. Here, we concentrate on device design operations, investigating the impact of narrowing the charge-transfer channel in the device with the aim of minimising the impact of traps during readout. Previous studies for the Euclid VIS instrument considered two devices, the e2v CCD204 and CCD273, the serial register of the former having a 50 μm channel and the latter having a 20 μm channel. The reduction in channel width was previously modelled to give an approximate 1.6× reduction in charge storage volume, verified experimentally to have a reduction in charge transfer inefficiency of 1.7×. The methods used to simulate the reduction approximated the charge cloud to a sharp-edged volume within which the probability of capture by traps was 100%. For high signals and slow readout speeds, this is a reasonable approximation. However, for low signals and higher readout speeds, the approximation falls short. Here we discuss a new method of simulating and calculating charge storage variations with device design changes, considering the absolute probability of capture across the pixel, bringing validity to all signal sizes and readout speeds. Using this method, we

Synthetic emmprin peptides with chitobiose substitution stimulate MMP-2 production by fibroblasts

Directory of Open Access Journals (Sweden)

Suzumiya Junji

2011-07-01

Full Text Available Abstract Background Emmprin, a glycoprotein containing two Ig domains, is enriched on tumor cell surfaces and stimulates matrix metalloproteinase (MMP production by adjacent stromal cells. Its first Ig domain (ECI contains the biologically active site. The dependence of emmprin activity on N-glycosylation is controversial. We investigated whether synthetic ECI with the shortest sugar is functionally active. Methods The whole ECI peptides carrying sugar chains, a chitobiose unit or N-linked core pentasaccharide, were synthesized by the thioester method and added to fibroblasts to examine whether they stimulate MMP-2 production. Results ECI carrying a chitobiose unit, ECI-(GlcNAc 2, but not ECI without a chitobiose unit or the chitobiose unit alone, dose-dependently stimulated MMP-2 production by fibroblasts. ECI with longer chitobiose units, ECI-[(Man3(GlcNAc2], also stimulated MMP-2 production, but the extent of its stimulation was lower than that of ECI-(GlcNAc2. Conclusions Our results indicate that ECI can mimic emmprin activity when substituted with chitobiose, the disaccharide with which N-glycosylation starts.

Computer modeling of siRNA knockdown effects indicates an essential role of the Ca2+ channel alpha2delta-1 subunit in cardiac excitation-contraction coupling.

Science.gov (United States)

Tuluc, Petronel; Kern, Georg; Obermair, Gerald J; Flucher, Bernhard E

2007-06-26

L-type Ca(2+) currents determine the shape of cardiac action potentials (AP) and the magnitude of the myoplasmic Ca(2+) signal, which regulates the contraction force. The auxiliary Ca(2+) channel subunits alpha(2)delta-1 and beta(2) are important regulators of membrane expression and current properties of the cardiac Ca(2+) channel (Ca(V)1.2). However, their role in cardiac excitation-contraction coupling is still elusive. Here we addressed this question by combining siRNA knockdown of the alpha(2)delta-1 subunit in a muscle expression system with simulation of APs and Ca(2+) transients by using a quantitative computer model of ventricular myocytes. Reconstitution of dysgenic muscle cells with Ca(V)1.2 (GFP-alpha(1C)) recapitulates key properties of cardiac excitation-contraction coupling. Concomitant depletion of the alpha(2)delta-1 subunit did not perturb membrane expression or targeting of the pore-forming GFP-alpha(1C) subunit into junctions between the outer membrane and the sarcoplasmic reticulum. However, alpha(2)delta-1 depletion shifted the voltage dependence of Ca(2+) current activation by 9 mV to more positive potentials, and it slowed down activation and inactivation kinetics approximately 2-fold. Computer modeling revealed that the altered voltage dependence and current kinetics exert opposing effects on the function of ventricular myocytes that in total cause a 60% prolongation of the AP and a 2-fold increase of the myoplasmic Ca(2+) concentration during each contraction. Thus, the Ca(2+) channel alpha(2)delta-1 subunit is not essential for normal Ca(2+) channel targeting in muscle but is a key determinant of normal excitation and contraction of cardiac muscle cells, and a reduction of alpha(2)delta-1 function is predicted to severely perturb normal heart function.

Consistent analysis of peripheral reaction channels and fusion for the 16,18O+58Ni systems

International Nuclear Information System (INIS)

Alves, J.J.S.; Gomes, P.R.S.; Lubian, J.; Chamon, L.C.; Pereira, D.; Anjos, R.M.; Rossi, E.S.; Silva, C.P.; Alvarez, M.A.G.; Nobre, G.P.A.; Gasques, L.R.

2005-01-01

We have measured elastic scattering and peripheral reaction channel cross sections for the 16,18 O+ 58 Ni systems at ELab=46 MeV. The data were analyzed through extensive coupled-channel calculations. It was investigated the consistency of the present analysis with a previous one at sub-barrier energies. Experimental fusion cross sections for these systems are also compared with the corresponding predictions of the coupled-channel calculations

Toxicity evaluation of the effluent of the ammonium diuranate process proceeding from the Uranium Reconversion Cycle (IPEN/CNEN-SP)

International Nuclear Information System (INIS)

Osti, Silvio Cesar de

2001-01-01

This project was developed with the objective to evaluate the acute and chronic toxicity of the ammonium diuranate proceeding from the process used to obtain uranium hexafluoride (UF 6 ), substance which is necessary to produce fuel used by the IEA-R1-IPEN reactor. Five acute toxicity tests were done with Daphnia similis in which concentration values of EC(I)50;48h, between 0,39% and 0,57% of the effluent were determined, and other five with Danio rerio in which concentration values of EC(I)50;48h, between 0,06% and 0,07% of the effluent were determined. Three chronic toxicity tests with Selenastrum capricornutum were done, having found NOEC values for concentrations below 0,12% of the effluents. To determine the ion fluoride toxicity in the Daphnia similis, five acute toxicity tests were done in which values of EC(I)50;48h, between 263.90 mgL -1 and 292.82 mgL -1 were found. The acute toxicity tests done with D. similis demonstrated that the effluent toxicity persisted during its storage period. The acute toxicity test with D.rerio and chronic ones with S. capricornutum using the effluents after the ionic-replace treatment, which objective is to recover uranium for reuse, demonstrated the effluent toxicity persistency. (author)

Textural analyses of carbon fiber materials by 2D-FFT of complex images obtained by high frequency eddy current imaging (HF-ECI)

Science.gov (United States)

Schulze, Martin H.; Heuer, Henning

2012-04-01

Carbon fiber based materials are used in many lightweight applications in aeronautical, automotive, machine and civil engineering application. By the increasing automation in the production process of CFRP laminates a manual optical inspection of each resin transfer molding (RTM) layer is not practicable. Due to the limitation to surface inspection, the quality parameters of multilayer 3 dimensional materials cannot be observed by optical systems. The Imaging Eddy- Current (EC) NDT is the only suitable inspection method for non-resin materials in the textile state that allows an inspection of surface and hidden layers in parallel. The HF-ECI method has the capability to measure layer displacements (misaligned angle orientations) and gap sizes in a multilayer carbon fiber structure. EC technique uses the variation of the electrical conductivity of carbon based materials to obtain material properties. Beside the determination of textural parameters like layer orientation and gap sizes between rovings, the detection of foreign polymer particles, fuzzy balls or visualization of undulations can be done by the method. For all of these typical parameters an imaging classification process chain based on a high resolving directional ECimaging device named EddyCus® MPECS and a 2D-FFT with adapted preprocessing algorithms are developed.

Channel Planform Dynamics Monitoring and Channel Stability Assessment in Two Sediment-Rich Rivers in Taiwan

Directory of Open Access Journals (Sweden)

Cheng-Wei Kuo

2017-01-01

Full Text Available Recurrent flood events induced by typhoons are powerful agents to modify channel morphology in Taiwan’s rivers. Frequent channel migrations reflect highly sensitive valley floors and increase the risk to infrastructure and residents along rivers. Therefore, monitoring channel planforms is essential for analyzing channel stability as well as improving river management. This study analyzed annual channel changes along two sediment-rich rivers, the Zhuoshui River and the Gaoping River, from 2008 to 2015 based on satellite images of FORMOSAT-2. Channel areas were digitized from mid-catchment to river mouth (~90 km. Channel stability for reaches was assessed through analyzing the changes of river indices including braid index, active channel width, and channel activity. In general, the valley width plays a key role in braided degree, active channel width, and channel activity. These indices increase as the valley width expands whereas the braid index decreases slightly close to the river mouth due to the change of river types. This downstream pattern in the Zhuoshui River was interrupted by hydraulic construction which resulted in limited changes downstream from the weir, due to the lack of water and sediment supply. A 200-year flood, Typhoon Morakot in 2009, induced significant changes in the two rivers. The highly active landscape in Taiwan results in very sensitive channels compared to other regions. An integrated Sensitivity Index was proposed for identifying unstable reaches, which could be a useful reference for river authorities when making priorities in river regulation strategy. This study shows that satellite image monitoring coupled with river indices analysis could be an effective tool to evaluate spatial and temporal changes in channel stability in highly dynamic river systems.

Spinal Gap Junction Channels in Neuropathic Pain

OpenAIRE

Jeon, Young Hoon; Youn, Dong Ho

2015-01-01

Damage to peripheral nerves or the spinal cord is often accompanied by neuropathic pain, which is a complex, chronic pain state. Increasing evidence indicates that alterations in the expression and activity of gap junction channels in the spinal cord are involved in the development of neuropathic pain. Thus, this review briefly summarizes evidence that regulation of the expression, coupling, and activity of spinal gap junction channels modulates pain signals in neuropathic pain states induced...

A coupled channel study on a binding mechanism of positronic alkali atoms

International Nuclear Information System (INIS)

Kubota, Yoshihiro; Kino, Yasushi

2008-01-01

In order to investigate the binding mechanism of weakly bound states of positronic alkali atoms, we calculate the energies and wavefunctions using the Gaussian expansion method (GEM) where a positronium (Ps)-alkali ion channel and a positron-alkali atom channel are explicitly introduced. The energies of the bound states are updated using a model potential that reproduces well the observed energy levels of alkali atoms. The binding mechanism of the positronic alkali atom is analyzed by the wavefunctions obtained. The structure of the positronic alkali atom has been regarded as a Ps cluster orbiting the alkali ion, which is described by the Ps-alkali ion channel. We point out that the fraction having the positron-alkali atom configuration is small but plays an indispensable role for the weakly bound system

Physics and numerical methods of OPTMAN. A coupled-channels method based on soft-rotator model for a description of collective nuclear structure and excitations

International Nuclear Information System (INIS)

Soukhovitskii, Efrem Sh.; Morogovskii, Gennadij B.; Chiba, Satoshi; Iwamoto, Osamu; Fukahori, Tokio

2004-03-01

This report gives a detailed description of the theory and computational algorithms of modernized coupled-channels optical model code OPTMAN based on the soft-rotator model for the collective nuclear structure and excitations. This work was performed under the Project Agreement B-521 with the International Science and Technology Center (Moscow), financing party of which is Japan. As a result of this work, the computational method of OPTMAN was totally updated, and an user-friendly interface was attached. (author)

Unsteady coupling of Navier-Stokes and radiative heat transfer solvers applied to an anisothermal multicomponent turbulent channel flow

International Nuclear Information System (INIS)

Amaya, J.; Cabrit, O.; Poitou, D.; Cuenot, B.; El Hafi, M.

2010-01-01

Direct numerical simulations (DNS) of an anisothermal reacting turbulent channel flow with and without radiative source terms have been performed to study the influence of the radiative heat transfer on the optically non-homogeneous boundary layer structure. A methodology for the study of the emitting/absorbing turbulent boundary layer (TBL) is presented. Details on the coupling strategy and the parallelization techniques are exposed. An analysis of the first order statistics is then carried out. It is shown that, in the studied configuration, the global structure of the thermal boundary layer is not significantly modified by radiation. However, the radiative transfer mechanism is not negligible and contributes to the heat losses at the walls. The classical law-of-the-wall for temperature can thus be improved for RANS/LES simulations taking into account the radiative contribution.

Holomorphic Yukawa couplings in heterotic string theory

Energy Technology Data Exchange (ETDEWEB)

Blesneag, Stefan [Rudolf Peierls Centre for Theoretical Physics, Oxford University,1 Keble Road, Oxford, OX1 3NP (United Kingdom); Buchbinder, Evgeny I. [The University of Western Australia,35 Stirling Highway, Crawley WA 6009 (Australia); Candelas, Philip [Mathematical Institute, University of Oxford,Andrew Wiles Building, Radcliffe Observatory Quarter, Woodstock Road, Oxford, OX2 6GG (United Kingdom); Lukas, Andre [Rudolf Peierls Centre for Theoretical Physics, Oxford University,1 Keble Road, Oxford, OX1 3NP (United Kingdom)

2016-01-26

We develop techniques, based on differential geometry, to compute holomorphic Yukawa couplings for heterotic line bundle models on Calabi-Yau manifolds defined as complete intersections in projective spaces. It is shown explicitly how these techniques relate to algebraic methods for computing holomorphic Yukawa couplings. We apply our methods to various examples and evaluate the holomorphic Yukawa couplings explicitly as functions of the complex structure moduli. It is shown that the rank of the Yukawa matrix can decrease at specific loci in complex structure moduli space. In particular, we compute the up Yukawa coupling and the singlet-Higgs-lepton trilinear coupling in the heterotic standard model described in ref. http://dx.doi.org/10.1007/JHEP06(2014)100.

Measurement of the top-Yukawa coupling and the search for ttH production

CERN Document Server

Vasquez, Jared; The ATLAS collaboration

2015-01-01

To test whether the observed Higgs boson follows the predictions of the SM, careful study and measurement of its properties are necessary. Due to the top quark's large mass, a measurement of the top-Yukawa coupling (Y_t) is paramount to an understanding of EWSB and could provide a viable probe for new physics. While most production processes provide only an indirect measurement of Y_t via loop effects, the ttH and tH production allow for a direct tree-level measurement of the coupling strength (which could differ due to new physics contamination). The ttH process is probed through various Higgs decay channels with several advantages. The H->bb channel allows for a coupling measurement of both 3rd generation quarks while profiting from the largest Higgs branching ratio. The h->γγ channel has a much smaller branching ratio but benefits from a fine diphoton mass resolution. The process is also probed in the multilepton channel, which is targeted at the off-shell Higgs coupling of H->WW* and H->ZZ* as well as t...

Majorana bound states in two-channel time-reversal-symmetric nanowire systems

DEFF Research Database (Denmark)

Gaidamauskas, Erikas; Paaske, Jens; Flensberg, Karsten

2014-01-01

We consider time-reversal-symmetric two-channel semiconducting quantum wires proximity coupled to a conventional s-wave superconductor. We analyze the requirements for a non-trivial topological phase, and find that necessary conditions are 1) the determinant of the pairing matrix in channel space...

CONTRIBUTIONS OF INTRACELLULAR IONS TO Kv CHANNEL VOLTAGE SENSOR DYNAMICS.

Directory of Open Access Journals (Sweden)

Samuel eGoodchild

2012-06-01

Full Text Available Voltage sensing domains of Kv channels control ionic conductance through coupling of the movement of charged residues in the S4 segment to conformational changes at the cytoplasmic region of the pore domain, that allow K+ ions to flow. Conformational transitions within the voltage sensing domain caused by changes in the applied voltage across the membrane field are coupled to the conducting pore region and the gating of ionic conductance. However, several other factors not directly linked to the voltage dependent movement of charged residues within the voltage sensor impact the dynamics of the voltage sensor, such as inactivation, ionic conductance, intracellular ion identity and block of the channel by intracellular ligands. The effect of intracellular ions on voltage sensor dynamics is of importance in the interpretation of gating current measurements and the physiology of pore/voltage sensor coupling. There is a significant amount of variability in the reported kinetics of voltage sensor deactivation kinetics of Kv channels attributed to different mechanisms such as open state stabilization, immobilization and relaxation processes of the voltage sensor. Here we separate these factors and focus on the causal role that intracellular ions can play in allosterically modulating the dynamics of Kv voltage sensor deactivation kinetics. These considerations are of critical importance in understanding the molecular determinants of the complete channel gating cycle from activation to deactivation.

Superconductivity in three-dimensional spin-orbit coupled semimetals

Science.gov (United States)

Savary, Lucile; Ruhman, Jonathan; Venderbos, Jörn W. F.; Fu, Liang; Lee, Patrick A.

2017-12-01

Motivated by the experimental detection of superconductivity in the low-carrier density half-Heusler compound YPtBi, we study the pairing instabilities of three-dimensional strongly spin-orbit coupled semimetals with a quadratic band touching point. In these semimetals the electronic structure at the Fermi energy is described by spin j =3/2 quasiparticles, which are fundamentally different from those in ordinary metals with spin j =1/2 . For both local and nonlocal pairing channels in j =3/2 materials we develop a general approach to analyzing pairing instabilities, thereby providing the computational tools needed to investigate the physics of these systems beyond phenomenological considerations. Furthermore, applying our method to a generic density-density interaction, we establish that: (i) The pairing strengths in the different symmetry channels uniquely encode the j =3/2 nature of the Fermi surface band structure—a manifestation of the fundamental difference with ordinary metals. (ii) The leading odd-parity pairing instabilities are different for electron doping and hole doping. Finally, we argue that polar phonons, i.e., Coulomb interactions mediated by the long-ranged electric polarization of the optical phonon modes, provide a coupling strength large enough to account for a Kelvin-range transition temperature in the s -wave channel, and are likely to play an important role in the overall attraction in non-s -wave channels. Moreover, the explicit calculation of the coupling strengths allows us to conclude that the two largest non-s -wave contributions occur in nonlocal channels, in contrast with what has been commonly assumed.

Three-body ΛNN force due to Λ-Σ coupling

International Nuclear Information System (INIS)

Myint, Khin Swe; Akaishi, Yoshinori

2003-01-01

The ΛNN three - body force due to coherent Λ - Σ Coupling effect was derived from realistic Nijmegen model D potential. Repulsive and attractive three - body ΛNN forces were reconcilably accounted. For 5 He, within one - channel description, ΛNN force is largely repulsive and its origin comes from Pauli forbidden terms. Within two - channel description, attractive Pauli allowed terms exist and resulting three - body force is always attractive. Large attractive ΛNN force effect due to coherent Λ - Σ coupling effect is predicted in neutron - rich nuclei. The attractive coherent Λ - Σ coupling effect is largely enhanced at high density neutron matter. The attractive three - body ΛNN force effect is essential dynamics of Λ - Σ coupling while the repulsive Nogami three - body effect arises from Pauli forbidden diagrams. (Y. Kazumata)

New signatures of flavor violating Higgs couplings

Energy Technology Data Exchange (ETDEWEB)

Buschmann, Malte; Kopp, Joachim; Liu, Jia; Wang, Xiao-Ping [PRISMA Cluster of Excellence and Mainz Institute for Theoretical Physics,Johannes Gutenberg University, 55099 Mainz (Germany)

2016-06-24

We explore several novel LHC signatures arising from quark or lepton flavor violating couplings in the Higgs sector, and we constrain such couplings using LHC data. Since the largest signals are possible in channels involving top quarks or tau leptons, we consider in particular the following flavor violating processes: (1) pp→thh (top plus di-Higgs final state) arising from a dimension six coupling of up-type quarks to three insertions of the Higgs field. We develop a search strategy for this final state and demonstrate that detection is possible at the high luminosity LHC if flavor violating top-up-Higgs couplings are not too far below the current limit. (2) pp→tH{sup 0}, where H{sup 0} is the heavy neutral CP-even Higgs boson in a two Higgs doublet model (2HDM). We consider the decay channels H{sup 0}→tu,WW,ZZ,hh and use existing LHC data to constrain the first three of them. For the fourth, we adapt our search for the thh final state, and we demonstrate that in large regions of the parameter space, it is superior to other searches, including searches for flavor violating top quark decays (t→hq). (3) H{sup 0}→τμ, again in the context of a 2HDM. This channel is particularly well motivated by the recent CMS excess in h→τμ, and we use the data from this search to constrain the properties of H{sup 0}.

Opposite effects of the S4-S5 linker and PIP2 on voltage-gated channel function: KCNQ1/KCNE1 and other channels

Directory of Open Access Journals (Sweden)

Frank S Choveau

2012-07-01

Full Text Available Voltage-gated potassium (Kv channels are tetramers, each subunit presenting six transmembrane segments (S1-S6, with each S1-S4 segments forming a voltage-sensing domain (VSD and the four S5-S6 forming both the conduction pathway and its gate. S4 segments control the opening of the intracellular activation gate in response to changes in membrane potential. Crystal structures of several voltage-gated ion channels in combination with biophysical and mutagenesis studies highlighted the critical role of the S4-S5 linker (S4S5L and of the S6 C-terminal part (S6T in the coupling between the VSD and the activation gate. Several mechanisms have been proposed to describe the coupling at a molecular scale. This review summarizes the mechanisms suggested for various voltage-gated ion channels, including a mechanism that we described for KCNQ1, in which S4S5L is acting like a ligand binding to S6T to stabilize the channel in a closed state. As discussed in this review, this mechanism may explain the reverse response to depolarization in HCN-like channels. As opposed to S4S5L, the phosphoinositide, phosphatidylinositol 4,5-bisphosphate (PIP2, stabilizes KCNQ1 channel in an open state. Many other ion channels (not only voltage-gated require PIP2 to function properly, confirming its crucial importance as an ion channel co-factor. This is highlighted in cases in which an altered regulation of ion channels by PIP2 leads to channelopathies, as observed for KCNQ1. This review summarizes the state of the art on the two regulatory mechanisms that are critical for KCNQ1 and other voltage-gated channels function (PIP2 and S4-S5L, and assesses their potential physiological and pathophysiological roles.

Distribution of small channels on the Martian surface

Science.gov (United States)

Pieri, D.

1976-01-01

The distribution of small channels on Mars has been mapped from Mariner 9 images at the 1:5,000,000 scale. The small channels referred to here are small valleys ranging in width from the resolution limit of the Mariner 9 wide-angle images (about 1 km) to about 10 km. The greatest density of small channels occurs in dark cratered terrain. This dark zone forms a broad subequatorial band around the planet. The observed distribution may be the result of decreased small-channel visibility in bright areas due to obscuration by a high albedo dust or sediment mantle. Crater densities within two small-channel segments show crater size-frequency distributions consistent with those of the oldest of the heavily cratered plains units. Such crater densities coupled with the almost exclusive occurrence of small channels in old cratered terrain and the generally degraded appearance of small channels in the high-resolution images (about 100 m) imply a major episode of small-channel formation early in Martian geologic history.

Turbine component having surface cooling channels and method of forming same

Science.gov (United States)

Miranda, Carlos Miguel; Trimmer, Andrew Lee; Kottilingam, Srikanth Chandrudu

2017-09-05

A component for a turbine engine includes a substrate that includes a first surface, and an insert coupled to the substrate proximate the substrate first surface. The component also includes a channel. The channel is defined by a first channel wall formed in the substrate and a second channel wall formed by at least one coating disposed on the substrate first surface. The component further includes an inlet opening defined in flow communication with the channel. The inlet opening is defined by a first inlet wall formed in the substrate and a second inlet wall defined by the insert.

Biochemical and structural analysis of the hyperpolarization-activated K(+) channel MVP.

Science.gov (United States)

Randich, Amelia M; Cuello, Luis G; Wanderling, Sherry S; Perozo, Eduardo

2014-03-18

In contrast to the majority of voltage-gated ion channels, hyperpolarization-activated channels remain closed at depolarizing potentials and are activated at hyperpolarizing potentials. The basis for this reverse polarity is thought to be a result of differences in the way the voltage-sensing domain (VSD) couples to the pore domain. In the absence of structural data, the molecular mechanism of this reverse polarity coupling remains poorly characterized. Here we report the characterization of the structure and local dynamics of the closed activation gate (lower S6 region) of MVP, a hyperpolarization-activated potassium channel from Methanococcus jannaschii, by electron paramagnetic resonance (EPR) spectroscopy. We show that a codon-optimized version of MVP has high expression levels in Escherichia coli, is purified as a stable tetramer, and exhibits expected voltage-dependent activity when reconstituted in liposomes. EPR analysis of the mid to lower S6 region revealed positions exhibiting strong spin-spin coupling, indicating that the activation gate of MVP is closed at 0 mV. A comparison of local environmental parameters along the activation gate for MVP and KcsA indicates that MVP adopts a different closed conformation. These structural details set the stage for future evaluations of reverse electromechanical coupling in MVP.

Biochemical and Structural Analysis of the Hyperpolarization-Activated K+ Channel MVP

Science.gov (United States)

2015-01-01

In contrast to the majority of voltage-gated ion channels, hyperpolarization-activated channels remain closed at depolarizing potentials and are activated at hyperpolarizing potentials. The basis for this reverse polarity is thought to be a result of differences in the way the voltage-sensing domain (VSD) couples to the pore domain. In the absence of structural data, the molecular mechanism of this reverse polarity coupling remains poorly characterized. Here we report the characterization of the structure and local dynamics of the closed activation gate (lower S6 region) of MVP, a hyperpolarization-activated potassium channel from Methanococcus jannaschii, by electron paramagnetic resonance (EPR) spectroscopy. We show that a codon-optimized version of MVP has high expression levels in Escherichia coli, is purified as a stable tetramer, and exhibits expected voltage-dependent activity when reconstituted in liposomes. EPR analysis of the mid to lower S6 region revealed positions exhibiting strong spin–spin coupling, indicating that the activation gate of MVP is closed at 0 mV. A comparison of local environmental parameters along the activation gate for MVP and KcsA indicates that MVP adopts a different closed conformation. These structural details set the stage for future evaluations of reverse electromechanical coupling in MVP. PMID:24490868

Steady-State Anderson Accelerated Coupling of Lattice Boltzmann and Navier–Stokes Solvers

KAUST Repository

Atanasov, Atanas

2016-10-17

We present an Anderson acceleration-based approach to spatially couple three-dimensional Lattice Boltzmann and Navier–Stokes (LBNS) flow simulations. This allows to locally exploit the computational features of both fluid flow solver approaches to the fullest extent and yields enhanced control to match the LB and NS degrees of freedom within the LBNS overlap layer. Designed for parallel Schwarz coupling, the Anderson acceleration allows for the simultaneous execution of both Lattice Boltzmann and Navier–Stokes solver. We detail our coupling methodology, validate it, and study convergence and accuracy of the Anderson accelerated coupling, considering three steady-state scenarios: plane channel flow, flow around a sphere and channel flow across a porous structure. We find that the Anderson accelerated coupling yields a speed-up (in terms of iteration steps) of up to 40% in the considered scenarios, compared to strictly sequential Schwarz coupling.

Modulation of CaV1.2 calcium channel by neuropeptide W regulates vascular myogenic tone via G protein-coupled receptor 7.

Science.gov (United States)

Ji, Li; Zhu, Huayuan; Chen, Hong; Fan, Wenyong; Chen, Junjie; Chen, Jing; Zhu, Guoqing; Wang, Juejin

2015-12-01

Neuropeptide W (NPW), an endogenous ligand for the G protein-coupled receptor 7 (GPR7), was first found to make important roles in central nerve system. In periphery, NPW was also present and regulated intracellular calcium homeostasis by L-type calcium channels. This study was designed to discover the effects of NPW-GPR7 on the function of CaV1.2 calcium channels in the vascular smooth muscle cells (VSMCs) and vasotone of arterial vessels. By whole-cell patch clamp, we studied the effects of NPW-23, the active form of NPW, on the CaV1.2 channels in the heterologously transfected human embryonic kidney 293 cells and VSMCs isolated from rat. Living system was used to explore the physiological function of NPW-23 in arterial myogenic tone. To investigate the pathological relevance, NPW mRNA level of mesenteric arteries was measured in the hypertensive and normotensive rats. NPW's receptor GPR7 was coexpressed with CaV1.2 channels in arterial smooth muscle. NPW-23 increased the ICa,L in transfected human embryonic kidney 293 cells and VSMCs via GPR7, which could be abrogated by phospholipase C (PLC)/protein kinase C (PKC) inhibitors, not protein kinase A or protein kinase G inhibitor. After NPW-23 application, the expression of pan phospho-PKC was increased; moreover, intracellular diacylglycerol level, the second messenger catalyzed by PLC, was increased 1.5-2-fold. Application with NPW-23 increased pressure-induced vasotone of the rat mesenteric arteries. Importantly, the expression of NPW was decreased in the hypertensive rats. NPW-23 regulates ICa,L via GPR7, which is mediated by PLC/PKC signaling, and such a mechanism plays a role in modulating vascular myogenic tone, which may involve in the development of vascular hypertension.

An improved coupled-states approximation including the nearest neighbor Coriolis couplings for diatom-diatom inelastic collision

Science.gov (United States)

Yang, Dongzheng; Hu, Xixi; Zhang, Dong H.; Xie, Daiqian

2018-02-01

Solving the time-independent close coupling equations of a diatom-diatom inelastic collision system by using the rigorous close-coupling approach is numerically difficult because of its expensive matrix manipulation. The coupled-states approximation decouples the centrifugal matrix by neglecting the important Coriolis couplings completely. In this work, a new approximation method based on the coupled-states approximation is presented and applied to time-independent quantum dynamic calculations. This approach only considers the most important Coriolis coupling with the nearest neighbors and ignores weaker Coriolis couplings with farther K channels. As a result, it reduces the computational costs without a significant loss of accuracy. Numerical tests for para-H2+ortho-H2 and para-H2+HD inelastic collision were carried out and the results showed that the improved method dramatically reduces the errors due to the neglect of the Coriolis couplings in the coupled-states approximation. This strategy should be useful in quantum dynamics of other systems.

Proton radiography of petawatt-driven channel formation in a plasma gradient

Science.gov (United States)

Hill, Matthew; Sircombe, Nathan; Ramsay, Martin; Brown, Colin; Hobbs, Lauren; Allan, Peter; James, Steven; Norreys, Peter; Ratan, Naren; Ceurvorst, Luke

2015-11-01

Channel formation by ultra-intense laser pulses in underdense plasmas is a challenging simulation problem with direct relevance to many areas of current research. Recent experiments at the Orion laser facility have used high-energy proton radiography (>40 MeV) driven by a 1 ω petawatt beam to directly probe the interaction of another petawatt beam with a well-characterized plasma density gradient. The interaction plasma was generated using a 3 ω long-pulse beam and diagnosed using a 2 ω optical probe, simultaneously imaged onto four gated optical imagers and two streak cameras. The unique capabilities of the Orion facility allowed a comparison of the channels generated by intense 1 ω (1 μm, 100-500 J, 0.6 ps, 1021 W/cm2, f/3 parabola) and 2 ω (0.5 μm, 100 J, 0.6 ps, 1020 W/cm2, f/6 parabola) pulses. Proton radiographs of these channels are presented along with PIC simulations performed using the EPOCH code, supported by K- α measurements of hot electron beam divergence and magnetic spectrometer data. Together these provide a solid foundation for improvements to hydrodynamic and PIC simulations, further developing the predictive capabilities required to optimize future experiments.

[Multi-channel in vivo recording techniques: analysis of phase coupling between spikes and rhythmic oscillations of local field potentials].

Science.gov (United States)

Wang, Ce-Qun; Chen, Qiang; Zhang, Lu; Xu, Jia-Min; Lin, Long-Nian

2014-12-25

The purpose of this article is to introduce the measurements of phase coupling between spikes and rhythmic oscillations of local field potentials (LFPs). Multi-channel in vivo recording techniques allow us to record ensemble neuronal activity and LFPs simultaneously from the same sites in the brain. Neuronal activity is generally characterized by temporal spike sequences, while LFPs contain oscillatory rhythms in different frequency ranges. Phase coupling analysis can reveal the temporal relationships between neuronal firing and LFP rhythms. As the first step, the instantaneous phase of LFP rhythms can be calculated using Hilbert transform, and then for each time-stamped spike occurred during an oscillatory epoch, we marked instantaneous phase of the LFP at that time stamp. Finally, the phase relationships between the neuronal firing and LFP rhythms were determined by examining the distribution of the firing phase. Phase-locked spikes are revealed by the non-random distribution of spike phase. Theta phase precession is a unique phase relationship between neuronal firing and LFPs, which is one of the basic features of hippocampal place cells. Place cells show rhythmic burst firing following theta oscillation within a place field. And phase precession refers to that rhythmic burst firing shifted in a systematic way during traversal of the field, moving progressively forward on each theta cycle. This relation between phase and position can be described by a linear model, and phase precession is commonly quantified with a circular-linear coefficient. Phase coupling analysis helps us to better understand the temporal information coding between neuronal firing and LFPs.

Modelling of supercritical turbulent flow over transversal ribs in an open channel

Czech Academy of Sciences Publication Activity Database

Příhoda, Jaromír; Šulc, J.; Sedlář, M.; Zubík, P.

2009-01-01

Roč. 16, č. 1 (2009), s. 65-74 ISSN 1802-1484 R&D Projects: GA ČR GA103/06/0461 Institutional research plan: CEZ:AV0Z20760514 Keywords : turbulent flow in open channels * flow over obstacles Subject RIV: BK - Fluid Dynamics

Mechanosensitive Piezo Channels in the Gastrointestinal Tract.

Science.gov (United States)

Alcaino, C; Farrugia, G; Beyder, A

2017-01-01

Sensation of mechanical forces is critical for normal function of the gastrointestinal (GI) tract and abnormalities in mechanosensation are linked to GI pathologies. In the GI tract there are several mechanosensitive cell types-epithelial enterochromaffin cells, intrinsic and extrinsic enteric neurons, smooth muscle cells and interstitial cells of Cajal. These cells use mechanosensitive ion channels that respond to mechanical forces by altering transmembrane ionic currents in a process called mechanoelectrical coupling. Several mechanosensitive ionic conductances have been identified in the mechanosensory GI cells, ranging from mechanosensitive voltage-gated sodium and calcium channels to the mechanogated ion channels, such as the two-pore domain potassium channels K2P (TREK-1) and nonselective cation channels from the transient receptor potential family. The recently discovered Piezo channels are increasingly recognized as significant contributors to cellular mechanosensitivity. Piezo1 and Piezo2 are nonselective cationic ion channels that are directly activated by mechanical forces and have well-defined biophysical and pharmacologic properties. The role of Piezo channels in the GI epithelium is currently under investigation and their role in the smooth muscle syncytium and enteric neurons is still not known. In this review, we outline the current state of knowledge on mechanosensitive ion channels in the GI tract, with a focus on the known and potential functions of the Piezo channels. Copyright © 2017 Elsevier Inc. All rights reserved.

Information geometry of Gaussian channels

International Nuclear Information System (INIS)

Monras, Alex; Illuminati, Fabrizio

2010-01-01

We define a local Riemannian metric tensor in the manifold of Gaussian channels and the distance that it induces. We adopt an information-geometric approach and define a metric derived from the Bures-Fisher metric for quantum states. The resulting metric inherits several desirable properties from the Bures-Fisher metric and is operationally motivated by distinguishability considerations: It serves as an upper bound to the attainable quantum Fisher information for the channel parameters using Gaussian states, under generic constraints on the physically available resources. Our approach naturally includes the use of entangled Gaussian probe states. We prove that the metric enjoys some desirable properties like stability and covariance. As a by-product, we also obtain some general results in Gaussian channel estimation that are the continuous-variable analogs of previously known results in finite dimensions. We prove that optimal probe states are always pure and bounded in the number of ancillary modes, even in the presence of constraints on the reduced state input in the channel. This has experimental and computational implications. It limits the complexity of optimal experimental setups for channel estimation and reduces the computational requirements for the evaluation of the metric: Indeed, we construct a converging algorithm for its computation. We provide explicit formulas for computing the multiparametric quantum Fisher information for dissipative channels probed with arbitrary Gaussian states and provide the optimal observables for the estimation of the channel parameters (e.g., bath couplings, squeezing, and temperature).

Inter-subunit interactions across the upper voltage sensing-pore domain interface contribute to the concerted pore opening transition of Kv channels.

Directory of Open Access Journals (Sweden)

Tzilhav Shem-Ad

Full Text Available The tight electro-mechanical coupling between the voltage-sensing and pore domains of Kv channels lies at the heart of their fundamental roles in electrical signaling. Structural data have identified two voltage sensor pore inter-domain interaction surfaces, thus providing a framework to explain the molecular basis for the tight coupling of these domains. While the contribution of the intra-subunit lower domain interface to the electro-mechanical coupling that underlies channel opening is relatively well understood, the contribution of the inter-subunit upper interface to channel gating is not yet clear. Relying on energy perturbation and thermodynamic coupling analyses of tandem-dimeric Shaker Kv channels, we show that mutation of upper interface residues from both sides of the voltage sensor-pore domain interface stabilizes the closed channel state. These mutations, however, do not affect slow inactivation gating. We, moreover, find that upper interface residues form a network of state-dependent interactions that stabilize the open channel state. Finally, we note that the observed residue interaction network does not change during slow inactivation gating. The upper voltage sensing-pore interaction surface thus only undergoes conformational rearrangements during channel activation gating. We suggest that inter-subunit interactions across the upper domain interface mediate allosteric communication between channel subunits that contributes to the concerted nature of the late pore opening transition of Kv channels.

Inter-subunit interactions across the upper voltage sensing-pore domain interface contribute to the concerted pore opening transition of Kv channels.

Science.gov (United States)

Shem-Ad, Tzilhav; Irit, Orr; Yifrach, Ofer

2013-01-01

The tight electro-mechanical coupling between the voltage-sensing and pore domains of Kv channels lies at the heart of their fundamental roles in electrical signaling. Structural data have identified two voltage sensor pore inter-domain interaction surfaces, thus providing a framework to explain the molecular basis for the tight coupling of these domains. While the contribution of the intra-subunit lower domain interface to the electro-mechanical coupling that underlies channel opening is relatively well understood, the contribution of the inter-subunit upper interface to channel gating is not yet clear. Relying on energy perturbation and thermodynamic coupling analyses of tandem-dimeric Shaker Kv channels, we show that mutation of upper interface residues from both sides of the voltage sensor-pore domain interface stabilizes the closed channel state. These mutations, however, do not affect slow inactivation gating. We, moreover, find that upper interface residues form a network of state-dependent interactions that stabilize the open channel state. Finally, we note that the observed residue interaction network does not change during slow inactivation gating. The upper voltage sensing-pore interaction surface thus only undergoes conformational rearrangements during channel activation gating. We suggest that inter-subunit interactions across the upper domain interface mediate allosteric communication between channel subunits that contributes to the concerted nature of the late pore opening transition of Kv channels.

Instabilities simulations with wideband feedback systems: CMAD, HEADTAIL, WARP

International Nuclear Information System (INIS)

Li, Kevin; Cesaratto, J; Fox, J D; Pivi, M; Rivetta, C; Rumolo, G

2013-01-01

Transverse mode coupling (TMCI) and electron cloud instabilities (ECI) pose fundamental limitations on the acceptable beam intensities in the SPS at CERN. This in turn limits the ultimate achievable luminosity in the LHC. Therefore, future luminosity upgrades foresee methods for evading TMCI as well as ECI. Proposed approaches within the LHC Injector Upgrade (LIU) project include new optics with reduced transition energy as well as vacuum chamber coating techniques. As a complementary option, high bandwidth feedback systems may provide instability mitigation by actively damping the intra-bunch motion of unstable modes. In an effort to evaluate the potentials and limitations of such feedback systems and to characterise some of the specifications, a numerical model of a realistic feedback system has been developed and integrated into available instabilities simulation codes. Together with the implementation of this new feedback system model, CMAD and HEADTAIL have been used to investigate the impact of different wideband feedback systems on ECI in the SPS. In this paper, we present some details on the numerical model of the realistic feedback system and its implementation as well as the results obtained from the simulation study using this model together with the instability codes. (author)

Computer simulations of channel meandering and the formation of point bars: Linking channel dynamics to the preserved stratigraphy

Science.gov (United States)

Sun, T.; Covault, J. A.; Pyrcz, M.; Sullivan, M.

2012-12-01

Meandering rivers are probably one of the most recognizable geomorphic features on earth. As they meander across alluvial and delta plains, channels migrate laterally and develop point bars, splays, levees and other geomorphic and sedimentary features that compose substantial portions of the fill within many sedimentary basins. These basins can include hydrocarbon producing fields. Therefore, a good understanding of the processes of meandering channels and their associated deposits is critical for exploiting these reservoirs in the subsurface. In the past couple of decades, significant progress has been made in our understanding of the morphodynamics of channel meandering. Basic fluid dynamics and sediment transport (Ikeda and Parker, 1981; Howard, 1992) has shown that many characteristic features of meandering rivers, such as the meandering wavelength, growth rate and downstream migration rate, can be predicted quantitatively. As a result, a number of variations and improvement of the theory have emerged (e.g., Blondeaux and Seminara, 1985; Parker and Andrews, 1985, 1986; and Sun et al., 2001a, b).The main improvements include the recognition of so called "bar-bend" interactions, where the development of bars on the channel bed and their interactions with the channel bend is recognized as a primary cause for meandering channels to develop greater complexity than the classic goose-neck meander bend shapes, such as compound bend. Recently, Sun and others have shown that the spatial patterns of width variations in meandering channels can be explained by an extrinsic periodic flow variations coupled with the intrinsic bend instability dynamics. In contrast to the significant improvement of our understanding of channel meandering, little work has been done to link the geomorphic features of meandering channels to the geometry and heterogeneity of the deposits they form and ultimately preserves. A computer simulation model based on the work of Sun and others (1996, 2001

Channel estimation in few mode fiber mode division multiplexing transmission system

Science.gov (United States)

Hei, Yongqiang; Li, Li; Li, Wentao; Li, Xiaohui; Shi, Guangming

2018-03-01

It is abundantly clear that obtaining the channel state information (CSI) is of great importance for the equalization and detection in coherence receivers. However, to the best of the authors' knowledge, in most of the existing literatures, CSI is assumed to be perfectly known at the receiver. So far, few literature discusses the effects of imperfect CSI on MDM system performance caused by channel estimation. Motivated by that, in this paper, the channel estimation in few mode fiber (FMF) mode division multiplexing (MDM) system is investigated, in which two classical channel estimation methods, i.e., least square (LS) method and minimum mean square error (MMSE) method, are discussed with the assumption of the spatially white noise lumped at the receiver side of MDM system. Both the capacity and BER performance of MDM system affected by mode-dependent gain or loss (MDL) with different channel estimation errors have been studied. Simulation results show that the capacity and BER performance can be further deteriorated in MDM system by the channel estimation, and an 1e-3 variance of channel estimation error is acceptable in MDM system with 0-6 dB MDL values.

Efficient channel-plasmon excitation by nano-mirrors

DEFF Research Database (Denmark)

Radko, Ilya P.; Stær, Tobias Holmgaard; Han, Zhanghua

2011-01-01

We demonstrate a configuration for efficient channel-plasmon mode excitation using tapered terminations of V-shaped groove waveguides. The plasmon excitation is achieved by directly illuminating tapers of gold V-grooves with a focused laser beam, incident normally onto the sample surface. For near......-infrared wavelengths, we find experimentally as well as numerically, by conducting three-dimensional finite-difference time-domain calculations, that the efficiency of channel-plasmon mode excitation exceeds 10% in the optimum configuration, which is the highest experimentally observed efficiency of coupling from free-propagation...

Modeling water droplet condensation and evaporation in DNS of turbulent channel flow

Energy Technology Data Exchange (ETDEWEB)

Russo, E; Kuerten, J G M; Geld, C W M van der [Department of Mechanical Engineering, Eindhoven University of Technology, PO Box 513, 5600 MB Eindhoven (Netherlands); Geurts, B J, E-mail: e.russo@tue.nl [Faculty EEMCS, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands)

2011-12-22

In this paper a point particle model for two-way coupling in water droplet-laden incompressible turbulent flow of air is proposed. The model is based on conservation laws and semi-empirical correlations. It has been implemented and tested in a DNS code based for turbulent channel flow with an Eulerian-Lagrangian approach. The two-way coupling is investigated in terms of the effects of mass and heat transfer on the droplets distributions along the channel wall-normal direction and by comparison of the droplet temperature statistics with respect to the case without evaporation and condensation. A remarkable conclusion is that the presence of evaporating and condensing droplets results in an increase in the non-dimensional heat transfer coefficient of the channel flow represented by the Nusselt number.

Consequences assessment for fuel channel failure with consequential moderator drain

International Nuclear Information System (INIS)

Wahba, N.N.; Bayoumi, M.H.

2002-01-01

This paper documents the consequences of spontaneous pressure tube/consequential calandria tube rupture followed by the ejection of end fittings (as a result of guillotine failure of pressure tube) leading to the drain of the moderator. The event is postulated to occur in conjunction with an independent failure of Emergency Coolant Injection System (ECIS). The results of the detailed consequence assessments are used to propose a course of action to mitigate the consequences of such an event. A methodology based on a lumped-parameter model was developed to assess the consequences of the postulated event. (author)

Opening of K+ channels by capacitive stimulation from silicon chip

Science.gov (United States)

Ulbrich, M. H.; Fromherz, P.

2005-10-01

The development of stable neuroelectronic systems requires a stimulation of nerve cells from semiconductor devices without electrochemical effects at the electrolyte/solid interface and without damage of the cell membrane. The interaction must rely on a reversible opening of voltage-gated ion channels by capacitive coupling. In a proof-of-principle experiment, we demonstrate that Kv1.3 potassium channels expressed in HEK293 cells can be opened from an electrolyte/oxide/silicon (EOS) capacitor. A sufficient strength of electrical coupling is achieved by insulating silicon with a thin film of TiO2 to achieve a high capacitance and by removing NaCl from the electrolyte to enhance the resistance of the cell-chip contact. When a decaying voltage ramp is applied to the EOS capacitor, an outward current through the attached cell membrane is observed that is specific for Kv1.3 channels. An open probability up to fifty percent is estimated by comparison with a numerical simulation of the cell-chip contact.

Measurement of the Higgs boson coupling properties in the H → ZZ ∗ → 4ℓ decay channel at √{s}=13 TeV with the ATLAS detector

Science.gov (United States)

Aaboud, M.; Aad, G.; Abbott, B.; Abdinov, O.; Abeloos, B.; Abidi, S. H.; AbouZeid, O. S.; Abraham, N. L.; Abramowicz, H.; Abreu, H.; Abreu, R.; Abulaiti, Y.; Acharya, B. S.; Adachi, S.; Adamczyk, L.; Adelman, J.; Adersberger, M.; Adye, T.; Affolder, A. A.; Afik, Y.; Agatonovic-Jovin, T.; Agheorghiesei, C.; Aguilar-Saavedra, J. A.; Ahlen, S. P.; Ahmadov, F.; Aielli, G.; Akatsuka, S.; Akerstedt, H.; Åkesson, T. P. A.; Akilli, E.; Akimov, A. V.; Alberghi, G. L.; Albert, J.; Albicocco, P.; Alconada Verzini, M. J.; Alderweireldt, S. C.; Aleksa, M.; Aleksandrov, I. N.; Alexa, C.; Alexander, G.; Alexopoulos, T.; Alhroob, M.; Ali, B.; Aliev, M.; Alimonti, G.; Alison, J.; Alkire, S. P.; Allbrooke, B. M. M.; Allen, B. W.; Allport, P. P.; Aloisio, A.; Alonso, A.; Alonso, F.; Alpigiani, C.; Alshehri, A. A.; Alstaty, M. I.; Alvarez Gonzalez, B.; Álvarez Piqueras, D.; Alviggi, M. G.; Amadio, B. T.; Amaral Coutinho, Y.; Amelung, C.; Amidei, D.; Amor Dos Santos, S. P.; Amoroso, S.; Amundsen, G.; Anastopoulos, C.; Ancu, L. S.; Andari, N.; Andeen, T.; Anders, C. F.; Anders, J. K.; Anderson, K. J.; Andreazza, A.; Andrei, V.; Angelidakis, S.; Angelozzi, I.; Angerami, A.; Anisenkov, A. V.; Anjos, N.; Annovi, A.; Antel, C.; Antonelli, M.; Antonov, A.; Antrim, D. J.; Anulli, F.; Aoki, M.; Aperio Bella, L.; Arabidze, G.; Arai, Y.; Araque, J. P.; Araujo Ferraz, V.; Arce, A. T. H.; Ardell, R. E.; Arduh, F. A.; Arguin, J.-F.; Argyropoulos, S.; Arik, M.; Armbruster, A. J.; Armitage, L. J.; Arnaez, O.; Arnold, H.; Arratia, M.; Arslan, O.; Artamonov, A.; Artoni, G.; Artz, S.; Asai, S.; Asbah, N.; Ashkenazi, A.; Asquith, L.; Assamagan, K.; Astalos, R.; Atkinson, M.; Atlay, N. B.; Augsten, K.; Avolio, G.; Axen, B.; Ayoub, M. K.; Azuelos, G.; Baas, A. E.; Baca, M. J.; Bachacou, H.; Bachas, K.; Backes, M.; Bagnaia, P.; Bahmani, M.; Bahrasemani, H.; Baines, J. T.; Bajic, M.; Baker, O. K.; Bakker, P. J.; Baldin, E. M.; Balek, P.; Balli, F.; Balunas, W. K.; Banas, E.; Bandyopadhyay, A.; Banerjee, Sw.; Bannoura, A. A. E.; Barak, L.; Barberio, E. L.; Barberis, D.; Barbero, M.; Barillari, T.; Barisits, M.-S.; Barkeloo, J. T.; Barklow, T.; Barlow, N.; Barnes, S. L.; Barnett, B. M.; Barnett, R. M.; Barnovska-Blenessy, Z.; Baroncelli, A.; Barone, G.; Barr, A. J.; Barranco Navarro, L.; Barreiro, F.; Barreiro Guimarães da Costa, J.; Bartoldus, R.; Barton, A. E.; Bartos, P.; Basalaev, A.; Bassalat, A.; Bates, R. L.; Batista, S. J.; Batley, J. R.; Battaglia, M.; Bauce, M.; Bauer, F.; Bawa, H. S.; Beacham, J. B.; Beattie, M. D.; Beau, T.; Beauchemin, P. H.; Bechtle, P.; Beck, H. P.; Beck, H. C.; Becker, K.; Becker, M.; Becot, C.; Beddall, A. J.; Beddall, A.; Bednyakov, V. A.; Bedognetti, M.; Bee, C. P.; Beermann, T. A.; Begalli, M.; Begel, M.; Behr, J. K.; Bell, A. S.; Bella, G.; Bellagamba, L.; Bellerive, A.; Bellomo, M.; Belotskiy, K.; Beltramello, O.; Belyaev, N. L.; Benary, O.; Benchekroun, D.; Bender, M.; Benekos, N.; Benhammou, Y.; Benhar Noccioli, E.; Benitez, J.; Benjamin, D. P.; Benoit, M.; Bensinger, J. R.; Bentvelsen, S.; Beresford, L.; Beretta, M.; Berge, D.; Bergeaas Kuutmann, E.; Berger, N.; Bergsten, L. J.; Beringer, J.; Berlendis, S.; Bernard, N. R.; Bernardi, G.; Bernius, C.; Bernlochner, F. U.; Berry, T.; Berta, P.; Bertella, C.; Bertoli, G.; Bertram, I. A.; Bertsche, C.; Besjes, G. J.; Bessidskaia Bylund, O.; Bessner, M.; Besson, N.; Bethani, A.; Bethke, S.; Betti, A.; Bevan, A. J.; Beyer, J.; Bianchi, R. M.; Biebel, O.; Biedermann, D.; Bielski, R.; Bierwagen, K.; Biesuz, N. V.; Biglietti, M.; Billoud, T. R. V.; Bilokon, H.; Bindi, M.; Bingul, A.; Bini, C.; Biondi, S.; Bisanz, T.; Bittrich, C.; Bjergaard, D. M.; Black, J. E.; Black, K. M.; Blair, R. E.; Blazek, T.; Bloch, I.; Blocker, C.; Blue, A.; Blumenschein, U.; Blunier, S.; Bobbink, G. J.; Bobrovnikov, V. S.; Bocchetta, S. S.; Bocci, A.; Bock, C.; Boehler, M.; Boerner, D.; Bogavac, D.; Bogdanchikov, A. G.; Bohm, C.; Boisvert, V.; Bokan, P.; Bold, T.; Boldyrev, A. S.; Bolz, A. E.; Bomben, M.; Bona, M.; Boonekamp, M.; Borisov, A.; Borissov, G.; Bortfeldt, J.; Bortoletto, D.; Bortolotto, V.; Boscherini, D.; Bosman, M.; Bossio Sola, J. D.; Boudreau, J.; Bouhova-Thacker, E. V.; Boumediene, D.; Bourdarios, C.; Boutle, S. K.; Boveia, A.; Boyd, J.; Boyko, I. R.; Bozson, A. J.; Bracinik, J.; Brandt, A.; Brandt, G.; Brandt, O.; Braren, F.; Bratzler, U.; Brau, B.; Brau, J. E.; Breaden Madden, W. D.; Brendlinger, K.; Brennan, A. J.; Brenner, L.; Brenner, R.; Bressler, S.; Briglin, D. L.; Bristow, T. M.; Britton, D.; Britzger, D.; Brochu, F. M.; Brock, I.; Brock, R.; Brooijmans, G.; Brooks, T.; Brooks, W. K.; Brosamer, J.; Brost, E.; Broughton, J. H.; Bruckman de Renstrom, P. A.; Bruncko, D.; Bruni, A.; Bruni, G.; Bruni, L. S.; Bruno, S.; Brunt, BH; Bruschi, M.; Bruscino, N.; Bryant, P.; Bryngemark, L.; Buanes, T.; Buat, Q.; Buchholz, P.; Buckley, A. G.; Budagov, I. A.; Buehrer, F.; Bugge, M. K.; Bulekov, O.; Bullock, D.; Burch, T. J.; Burdin, S.; Burgard, C. D.; Burger, A. M.; Burghgrave, B.; Burka, K.; Burke, S.; Burmeister, I.; Burr, J. T. P.; Büscher, D.; Büscher, V.; Bussey, P.; Butler, J. M.; Buttar, C. M.; Butterworth, J. M.; Butti, P.; Buttinger, W.; Buzatu, A.; Buzykaev, A. R.; Cabrera Urbán, S.; Caforio, D.; Cai, H.; Cairo, V. M.; Cakir, O.; Calace, N.; Calafiura, P.; Calandri, A.; Calderini, G.; Calfayan, P.; Callea, G.; Caloba, L. P.; Calvente Lopez, S.; Calvet, D.; Calvet, S.; Calvet, T. P.; Camacho Toro, R.; Camarda, S.; Camarri, P.; Cameron, D.; Caminal Armadans, R.; Camincher, C.; Campana, S.; Campanelli, M.; Camplani, A.; Campoverde, A.; Canale, V.; Cano Bret, M.; Cantero, J.; Cao, T.; Capeans Garrido, M. D. M.; Caprini, I.; Caprini, M.; Capua, M.; Carbone, R. M.; Cardarelli, R.; Cardillo, F.; Carli, I.; Carli, T.; Carlino, G.; Carlson, B. T.; Carminati, L.; Carney, R. M. D.; Caron, S.; Carquin, E.; Carrá, S.; Carrillo-Montoya, G. D.; Casadei, D.; Casado, M. P.; Casha, A. F.; Casolino, M.; Casper, D. W.; Castelijn, R.; Castillo Gimenez, V.; Castro, N. F.; Catinaccio, A.; Catmore, J. R.; Cattai, A.; Caudron, J.; Cavaliere, V.; Cavallaro, E.; Cavalli, D.; Cavalli-Sforza, M.; Cavasinni, V.; Celebi, E.; Ceradini, F.; Cerda Alberich, L.; Cerqueira, A. S.; Cerri, A.; Cerrito, L.; Cerutti, F.; Cervelli, A.; Cetin, S. A.; Chafaq, A.; Chakraborty, D.; Chan, S. K.; Chan, W. S.; Chan, Y. L.; Chang, P.; Chapman, J. D.; Charlton, D. G.; Chau, C. C.; Chavez Barajas, C. A.; Che, S.; Cheatham, S.; Chegwidden, A.; Chekanov, S.; Chekulaev, S. V.; Chelkov, G. A.; Chelstowska, M. A.; Chen, C.; Chen, C.; Chen, H.; Chen, J.; Chen, S.; Chen, S.; Chen, X.; Chen, Y.; Cheng, H. C.; Cheng, H. J.; Cheplakov, A.; Cheremushkina, E.; Cherkaoui El Moursli, R.; Cheu, E.; Cheung, K.; Chevalier, L.; Chiarella, V.; Chiarelli, G.; Chiodini, G.; Chisholm, A. S.; Chitan, A.; Chiu, Y. H.; Chizhov, M. V.; Choi, K.; Chomont, A. R.; Chouridou, S.; Chow, Y. S.; Christodoulou, V.; Chu, M. C.; Chudoba, J.; Chuinard, A. J.; Chwastowski, J. J.; Chytka, L.; Ciftci, A. K.; Cinca, D.; Cindro, V.; Cioara, I. A.; Ciocio, A.; Cirotto, F.; Citron, Z. H.; Citterio, M.; Ciubancan, M.; Clark, A.; Clark, B. L.; Clark, M. R.; Clark, P. J.; Clarke, R. N.; Clement, C.; Coadou, Y.; Cobal, M.; Coccaro, A.; Cochran, J.; Colasurdo, L.; Cole, B.; Colijn, A. P.; Collot, J.; Colombo, T.; Conde Muiño, P.; Coniavitis, E.; Connell, S. H.; Connelly, I. A.; Constantinescu, S.; Conti, G.; Conventi, F.; Cooke, M.; Cooper-Sarkar, A. M.; Cormier, F.; Cormier, K. J. R.; Corradi, M.; Corriveau, F.; Cortes-Gonzalez, A.; Costa, G.; Costa, M. J.; Costanzo, D.; Cottin, G.; Cowan, G.; Cox, B. E.; Cranmer, K.; Crawley, S. J.; Creager, R. A.; Cree, G.; Crépé-Renaudin, S.; Crescioli, F.; Cribbs, W. A.; Cristinziani, M.; Croft, V.; Crosetti, G.; Cueto, A.; Cuhadar Donszelmann, T.; Cukierman, A. R.; Cummings, J.; Curatolo, M.; Cúth, J.; Czekierda, S.; Czodrowski, P.; D'amen, G.; D'Auria, S.; D'eramo, L.; D'Onofrio, M.; Da Cunha Sargedas De Sousa, M. J.; Da Via, C.; Dabrowski, W.; Dado, T.; Dai, T.; Dale, O.; Dallaire, F.; Dallapiccola, C.; Dam, M.; Dandoy, J. R.; Daneri, M. F.; Dang, N. P.; Daniells, A. C.; Dann, N. S.; Danninger, M.; Dano Hoffmann, M.; Dao, V.; Darbo, G.; Darmora, S.; Dassoulas, J.; Dattagupta, A.; Daubney, T.; Davey, W.; David, C.; Davidek, T.; Davis, D. R.; Davison, P.; Dawe, E.; Dawson, I.; De, K.; de Asmundis, R.; De Benedetti, A.; De Castro, S.; De Cecco, S.; De Groot, N.; de Jong, P.; De la Torre, H.; De Lorenzi, F.; De Maria, A.; De Pedis, D.; De Salvo, A.; De Sanctis, U.; De Santo, A.; De Vasconcelos Corga, K.; De Vivie De Regie, J. B.; Debbe, R.; Debenedetti, C.; Dedovich, D. V.; Dehghanian, N.; Deigaard, I.; Del Gaudio, M.; Del Peso, J.; Delgove, D.; Deliot, F.; Delitzsch, C. M.; Dell'Acqua, A.; Dell'Asta, L.; Dell'Orso, M.; Della Pietra, M.; della Volpe, D.; Delmastro, M.; Delporte, C.; Delsart, P. A.; DeMarco, D. A.; Demers, S.; Demichev, M.; Demilly, A.; Denisov, S. P.; Denysiuk, D.; Derendarz, D.; Derkaoui, J. E.; Derue, F.; Dervan, P.; Desch, K.; Deterre, C.; Dette, K.; Devesa, M. R.; Deviveiros, P. O.; Dewhurst, A.; Dhaliwal, S.; Di Bello, F. A.; Di Ciaccio, A.; Di Ciaccio, L.; Di Clemente, W. K.; Di Donato, C.; Di Girolamo, A.; Di Girolamo, B.; Di Micco, B.; Di Nardo, R.; Di Petrillo, K. F.; Di Simone, A.; Di Sipio, R.; Di Valentino, D.; Diaconu, C.; Diamond, M.; Dias, F. A.; Diaz, M. A.; Diehl, E. B.; Dietrich, J.; Díez Cornell, S.; Dimitrievska, A.; Dingfelder, J.; Dita, P.; Dita, S.; Dittus, F.; Djama, F.; Djobava, T.; Djuvsland, J. I.; do Vale, M. A. B.; Dobos, D.; Dobre, M.; Dodsworth, D.; Doglioni, C.; Dolejsi, J.; Dolezal, Z.; Donadelli, M.; Donati, S.; Dondero, P.; Donini, J.; Dopke, J.; Doria, A.; Dova, M. T.; Doyle, A. T.; Drechsler, E.; Dris, M.; Du, Y.; Duarte-Campderros, J.; Dubinin, F.; Dubreuil, A.; Duchovni, E.; Duckeck, G.; Ducourthial, A.; Ducu, O. A.; Duda, D.; Dudarev, A.; Dudder, A. Chr.; Duffield, E. M.; Duflot, L.; Dührssen, M.; Dulsen, C.; Dumancic, M.; Dumitriu, A. E.; Duncan, A. K.; Dunford, M.; Duperrin, A.; Duran Yildiz, H.; Düren, M.; Durglishvili, A.; Duschinger, D.; Dutta, B.; Duvnjak, D.; Dyndal, M.; Dziedzic, B. S.; Eckardt, C.; Ecker, K. M.; Edgar, R. C.; Eifert, T.; Eigen, G.; Einsweiler, K.; Ekelof, T.; El Kacimi, M.; El Kosseifi, R.; Ellajosyula, V.; Ellert, M.; Elles, S.; Ellinghaus, F.; Elliot, A. A.; Ellis, N.; Elmsheuser, J.; Elsing, M.; Emeliyanov, D.; Enari, Y.; Ennis, J. S.; Epland, M. B.; Erdmann, J.; Ereditato, A.; Ernst, M.; Errede, S.; Escalier, M.; Escobar, C.; Esposito, B.; Estrada Pastor, O.; Etienvre, A. I.; Etzion, E.; Evans, H.; Ezhilov, A.; Ezzi, M.; Fabbri, F.; Fabbri, L.; Fabiani, V.; Facini, G.; Fakhrutdinov, R. M.; Falciano, S.; Falla, R. J.; Faltova, J.; Fang, Y.; Fanti, M.; Farbin, A.; Farilla, A.; Farina, C.; Farina, E. M.; Farooque, T.; Farrell, S.; Farrington, S. M.; Farthouat, P.; Fassi, F.; Fassnacht, P.; Fassouliotis, D.; Faucci Giannelli, M.; Favareto, A.; Fawcett, W. J.; Fayard, L.; Fedin, O. L.; Fedorko, W.; Feigl, S.; Feligioni, L.; Feng, C.; Feng, E. J.; Fenton, M. J.; Fenyuk, A. B.; Feremenga, L.; Fernandez Martinez, P.; Ferrando, J.; Ferrari, A.; Ferrari, P.; Ferrari, R.; Ferreira de Lima, D. E.; Ferrer, A.; Ferrere, D.; Ferretti, C.; Fiedler, F.; Filipčič, A.; Filipuzzi, M.; Filthaut, F.; Fincke-Keeler, M.; Finelli, K. D.; Fiolhais, M. C. N.; Fiorini, L.; Fischer, A.; Fischer, C.; Fischer, J.; Fisher, W. C.; Flaschel, N.; Fleck, I.; Fleischmann, P.; Fletcher, R. R. M.; Flick, T.; Flierl, B. M.; Flores Castillo, L. R.; Flowerdew, M. J.; Forcolin, G. T.; Formica, A.; Förster, F. A.; Forti, A.; Foster, A. G.; Fournier, D.; Fox, H.; Fracchia, S.; Francavilla, P.; Franchini, M.; Franchino, S.; Francis, D.; Franconi, L.; Franklin, M.; Frate, M.; Fraternali, M.; Freeborn, D.; Fressard-Batraneanu, S. M.; Freund, B.; Froidevaux, D.; Frost, J. A.; Fukunaga, C.; Fusayasu, T.; Fuster, J.; Gabizon, O.; Gabrielli, A.; Gabrielli, A.; Gach, G. P.; Gadatsch, S.; Gadomski, S.; Gagliardi, G.; Gagnon, L. G.; Galea, C.; Galhardo, B.; Gallas, E. J.; Gallop, B. J.; Gallus, P.; Galster, G.; Gan, K. K.; Ganguly, S.; Gao, Y.; Gao, Y. S.; Garay Walls, F. M.; García, C.; García Navarro, J. E.; García Pascual, J. A.; Garcia-Sciveres, M.; Gardner, R. W.; Garelli, N.; Garonne, V.; Gascon Bravo, A.; Gasnikova, K.; Gatti, C.; Gaudiello, A.; Gaudio, G.; Gavrilenko, I. L.; Gay, C.; Gaycken, G.; Gazis, E. N.; Gee, C. N. P.; Geisen, J.; Geisen, M.; Geisler, M. P.; Gellerstedt, K.; Gemme, C.; Genest, M. H.; Geng, C.; Gentile, S.; Gentsos, C.; George, S.; Gerbaudo, D.; Geßner, G.; Ghasemi, S.; Ghneimat, M.; Giacobbe, B.; Giagu, S.; Giangiacomi, N.; Giannetti, P.; Gibson, S. M.; Gignac, M.; Gilchriese, M.; Gillberg, D.; Gilles, G.; Gingrich, D. M.; Giordani, M. P.; Giorgi, F. M.; Giraud, P. F.; Giromini, P.; Giugliarelli, G.; Giugni, D.; Giuli, F.; Giuliani, C.; Giulini, M.; Gjelsten, B. K.; Gkaitatzis, S.; Gkialas, I.; Gkougkousis, E. L.; Gkountoumis, P.; Gladilin, L. K.; Glasman, C.; Glatzer, J.; Glaysher, P. C. F.; Glazov, A.; Goblirsch-Kolb, M.; Godlewski, J.; Goldfarb, S.; Golling, T.; Golubkov, D.; Gomes, A.; Gonçalo, R.; Goncalves Gama, R.; Goncalves Pinto Firmino Da Costa, J.; Gonella, G.; Gonella, L.; Gongadze, A.; Gonski, J. L.; González de la Hoz, S.; Gonzalez-Sevilla, S.; Goossens, L.; Gorbounov, P. A.; Gordon, H. A.; Gorelov, I.; Gorini, B.; Gorini, E.; Gorišek, A.; Goshaw, A. T.; Gössling, C.; Gostkin, M. I.; Gottardo, C. A.; Goudet, C. R.; Goujdami, D.; Goussiou, A. G.; Govender, N.; Gozani, E.; Grabowska-Bold, I.; Gradin, P. O. J.; Gramling, J.; Gramstad, E.; Grancagnolo, S.; Gratchev, V.; Gravila, P. M.; Gray, C.; Gray, H. M.; Greenwood, Z. D.; Grefe, C.; Gregersen, K.; Gregor, I. M.; Grenier, P.; Grevtsov, K.; Griffiths, J.; Grillo, A. A.; Grimm, K.; Grinstein, S.; Gris, Ph.; Grivaz, J.-F.; Groh, S.; Gross, E.; Grosse-Knetter, J.; Grossi, G. C.; Grout, Z. J.; Grummer, A.; Guan, L.; Guan, W.; Guenther, J.; Guescini, F.; Guest, D.; Gueta, O.; Gui, B.; Guido, E.; Guillemin, T.; Guindon, S.; Gul, U.; Gumpert, C.; Guo, J.; Guo, W.; Guo, Y.; Gupta, R.; Gurbuz, S.; Gustavino, G.; Gutelman, B. J.; Gutierrez, P.; Gutierrez Ortiz, N. G.; Gutschow, C.; Guyot, C.; Guzik, M. P.; Gwenlan, C.; Gwilliam, C. B.; Haas, A.; Haber, C.; Hadavand, H. K.; Haddad, N.; Hadef, A.; Hageböck, S.; Hagihara, M.; Hakobyan, H.; Haleem, M.; Haley, J.; Halladjian, G.; Hallewell, G. D.; Hamacher, K.; Hamal, P.; Hamano, K.; Hamilton, A.; Hamity, G. N.; Hamnett, P. G.; Han, L.; Han, S.; Hanagaki, K.; Hanawa, K.; Hance, M.; Handl, D. M.; Haney, B.; Hanke, P.; Hansen, J. B.; Hansen, J. D.; Hansen, M. C.; Hansen, P. H.; Hara, K.; Hard, A. S.; Harenberg, T.; Hariri, F.; Harkusha, S.; Harrison, P. F.; Hartmann, N. M.; Hasegawa, Y.; Hasib, A.; Hassani, S.; Haug, S.; Hauser, R.; Hauswald, L.; Havener, L. B.; Havranek, M.; Hawkes, C. M.; Hawkings, R. J.; Hayakawa, D.; Hayden, D.; Hays, C. P.; Hays, J. M.; Hayward, H. S.; Haywood, S. J.; Head, S. J.; Heck, T.; Hedberg, V.; Heelan, L.; Heer, S.; Heidegger, K. K.; Heim, S.; Heim, T.; Heinemann, B.; Heinrich, J. J.; Heinrich, L.; Heinz, C.; Hejbal, J.; Helary, L.; Held, A.; Hellman, S.; Helsens, C.; Henderson, R. C. W.; Heng, Y.; Henkelmann, S.; Henriques Correia, A. M.; Henrot-Versille, S.; Herbert, G. H.; Herde, H.; Herget, V.; Hernández Jiménez, Y.; Herr, H.; Herten, G.; Hertenberger, R.; Hervas, L.; Herwig, T. C.; Hesketh, G. G.; Hessey, N. P.; Hetherly, J. W.; Higashino, S.; Higón-Rodriguez, E.; Hildebrand, K.; Hill, E.; Hill, J. C.; Hiller, K. H.; Hillier, S. J.; Hils, M.; Hinchliffe, I.; Hirose, M.; Hirschbuehl, D.; Hiti, B.; Hladik, O.; Hlaluku, D. R.; Hoad, X.; Hobbs, J.; Hod, N.; Hodgkinson, M. C.; Hodgson, P.; Hoecker, A.; Hoeferkamp, M. R.; Hoenig, F.; Hohn, D.; Holmes, T. R.; Homann, M.; Honda, S.; Honda, T.; Hong, T. M.; Hooberman, B. H.; Hopkins, W. H.; Horii, Y.; Horton, A. J.; Hostachy, J.-Y.; Hostiuc, A.; Hou, S.; Hoummada, A.; Howarth, J.; Hoya, J.; Hrabovsky, M.; Hrdinka, J.; Hristova, I.; Hrivnac, J.; Hryn'ova, T.; Hrynevich, A.; Hsu, P. J.; Hsu, S.-C.; Hu, Q.; Hu, S.; Huang, Y.; Hubacek, Z.; Hubaut, F.; Huegging, F.; Huffman, T. B.; Hughes, E. W.; Huhtinen, M.; Hunter, R. F. H.; Huo, P.; Huseynov, N.; Huston, J.; Huth, J.; Hyneman, R.; Iacobucci, G.; Iakovidis, G.; Ibragimov, I.; Iconomidou-Fayard, L.; Idrissi, Z.; Iengo, P.; Igonkina, O.; Iizawa, T.; Ikegami, Y.; Ikeno, M.; Ilchenko, Y.; Iliadis, D.; Ilic, N.; Iltzsche, F.; Introzzi, G.; Ioannou, P.; Iodice, M.; Iordanidou, K.; Ippolito, V.; Isacson, M. F.; Ishijima, N.; Ishino, M.; Ishitsuka, M.; Issever, C.; Istin, S.; Ito, F.; Iturbe Ponce, J. M.; Iuppa, R.; Iwasaki, H.; Izen, J. M.; Izzo, V.; Jabbar, S.; Jackson, P.; Jacobs, R. M.; Jain, V.; Jakobi, K. B.; Jakobs, K.; Jakobsen, S.; Jakoubek, T.; Jamin, D. O.; Jana, D. K.; Jansky, R.; Janssen, J.; Janus, M.; Janus, P. A.; Jarlskog, G.; Javadov, N.; Javůrek, T.; Javurkova, M.; Jeanneau, F.; Jeanty, L.; Jejelava, J.; Jelinskas, A.; Jenni, P.; Jeske, C.; Jézéquel, S.; Ji, H.; Jia, J.; Jiang, H.; Jiang, Y.; Jiang, Z.; Jiggins, S.; Jimenez Pena, J.; Jin, S.; Jinaru, A.; Jinnouchi, O.; Jivan, H.; Johansson, P.; Johns, K. A.; Johnson, C. A.; Johnson, W. J.; Jon-And, K.; Jones, R. W. L.; Jones, S. D.; Jones, S.; Jones, T. J.; Jongmanns, J.; Jorge, P. M.; Jovicevic, J.; Ju, X.; Juste Rozas, A.; Köhler, M. K.; Kaczmarska, A.; Kado, M.; Kagan, H.; Kagan, M.; Kahn, S. J.; Kaji, T.; Kajomovitz, E.; Kalderon, C. W.; Kaluza, A.; Kama, S.; Kamenshchikov, A.; Kanaya, N.; Kanjir, L.; Kantserov, V. A.; Kanzaki, J.; Kaplan, B.; Kaplan, L. S.; Kar, D.; Karakostas, K.; Karastathis, N.; Kareem, M. J.; Karentzos, E.; Karpov, S. N.; Karpova, Z. M.; Karthik, K.; Kartvelishvili, V.; Karyukhin, A. N.; Kasahara, K.; Kashif, L.; Kass, R. D.; Kastanas, A.; Kataoka, Y.; Kato, C.; Katre, A.; Katzy, J.; Kawade, K.; Kawagoe, K.; Kawamoto, T.; Kawamura, G.; Kay, E. F.; Kazanin, V. F.; Keeler, R.; Kehoe, R.; Keller, J. S.; Kellermann, E.; Kempster, J. J.; Kendrick, J.; Keoshkerian, H.; Kepka, O.; Kerševan, B. P.; Kersten, S.; Keyes, R. A.; Khader, M.; Khalil-zada, F.; Khanov, A.; Kharlamov, A. G.; Kharlamova, T.; Khodinov, A.; Khoo, T. J.; Khovanskiy, V.; Khramov, E.; Khubua, J.; Kido, S.; Kilby, C. R.; Kim, H. Y.; Kim, S. H.; Kim, Y. K.; Kimura, N.; Kind, O. M.; King, B. T.; Kirchmeier, D.; Kirk, J.; Kiryunin, A. E.; Kishimoto, T.; Kisielewska, D.; Kitali, V.; Kivernyk, O.; Kladiva, E.; Klapdor-Kleingrothaus, T.; Klein, M. H.; Klein, M.; Klein, U.; Kleinknecht, K.; Klimek, P.; Klimentov, A.; Klingenberg, R.; Klingl, T.; Klioutchnikova, T.; Klitzner, F. F.; Kluge, E.-E.; Kluit, P.; Kluth, S.; Kneringer, E.; Knoops, E. B. F. G.; Knue, A.; Kobayashi, A.; Kobayashi, D.; Kobayashi, T.; Kobel, M.; Kocian, M.; Kodys, P.; Koffas, T.; Koffeman, E.; Köhler, N. M.; Koi, T.; Kolb, M.; Koletsou, I.; Komar, A. A.; Kondo, T.; Kondrashova, N.; Köneke, K.; König, A. C.; Kono, T.; Konoplich, R.; Konstantinidis, N.; Konya, B.; Kopeliansky, R.; Koperny, S.; Kopp, A. K.; Korcyl, K.; Kordas, K.; Korn, A.; Korol, A. A.; Korolkov, I.; Korolkova, E. V.; Kortner, O.; Kortner, S.; Kosek, T.; Kostyukhin, V. V.; Kotwal, A.; Koulouris, A.; Kourkoumeli-Charalampidi, A.; Kourkoumelis, C.; Kourlitis, E.; Kouskoura, V.; Kowalewska, A. B.; Kowalewski, R.; Kowalski, T. Z.; Kozakai, C.; Kozanecki, W.; Kozhin, A. S.; Kramarenko, V. A.; Kramberger, G.; Krasnopevtsev, D.; Krasny, M. W.; Krasznahorkay, A.; Krauss, D.; Kremer, J. A.; Kretzschmar, J.; Kreutzfeldt, K.; Krieger, P.; Krizka, K.; Kroeninger, K.; Kroha, H.; Kroll, J.; Kroll, J.; Kroseberg, J.; Krstic, J.; Kruchonak, U.; Krüger, H.; Krumnack, N.; Kruse, M. C.; Kubota, T.; Kucuk, H.; Kuday, S.; Kuechler, J. T.; Kuehn, S.; Kugel, A.; Kuger, F.; Kuhl, T.; Kukhtin, V.; Kukla, R.; Kulchitsky, Y.; Kuleshov, S.; Kulinich, Y. P.; Kuna, M.; Kunigo, T.; Kupco, A.; Kupfer, T.; Kuprash, O.; Kurashige, H.; Kurchaninov, L. L.; Kurochkin, Y. A.; Kurth, M. G.; Kuwertz, E. S.; Kuze, M.; Kvita, J.; Kwan, T.; Kyriazopoulos, D.; La Rosa, A.; La Rosa Navarro, J. L.; La Rotonda, L.; La Ruffa, F.; Lacasta, C.; Lacava, F.; Lacey, J.; Lack, D. P. J.; Lacker, H.; Lacour, D.; Ladygin, E.; Lafaye, R.; Laforge, B.; Lagouri, T.; Lai, S.; Lammers, S.; Lampl, W.; Lançon, E.; Landgraf, U.; Landon, M. P. J.; Lanfermann, M. C.; Lang, V. S.; Lange, J. C.; Langenberg, R. J.; Lankford, A. J.; Lanni, F.; Lantzsch, K.; Lanza, A.; Lapertosa, A.; Laplace, S.; Laporte, J. F.; Lari, T.; Lasagni Manghi, F.; Lassnig, M.; Lau, T. S.; Laudrain, A.; Laurelli, P.; Lavrijsen, W.; Law, A. T.; Laycock, P.; Lazovich, T.; Lazzaroni, M.; Le, B.; Le Dortz, O.; Le Guirriec, E.; Le Quilleuc, E. P.; LeBlanc, M.; LeCompte, T.; Ledroit-Guillon, F.; Lee, C. A.; Lee, G. R.; Lee, S. C.; Lee, L.; Lefebvre, B.; Lefebvre, G.; Lefebvre, M.; Legger, F.; Leggett, C.; Lehmann Miotto, G.; Lei, X.; Leight, W. A.; Leite, M. A. L.; Leitner, R.; Lellouch, D.; Lemmer, B.; Leney, K. J. C.; Lenz, T.; Lenzi, B.; Leone, R.; Leone, S.; Leonidopoulos, C.; Lerner, G.; Leroy, C.; Les, R.; Lesage, A. A. J.; Lester, C. G.; Levchenko, M.; Levêque, J.; Levin, D.; Levinson, L. J.; Levy, M.; Lewis, D.; Li, B.; Li, C.-Q.; Li, H.; Li, L.; Li, Q.; Li, Q.; Li, S.; Li, X.; Li, Y.; Liang, Z.; Liberti, B.; Liblong, A.; Lie, K.; Liebal, J.; Liebig, W.; Limosani, A.; Lin, C. Y.; Lin, K.; Lin, S. C.; Lin, T. H.; Linck, R. A.; Lindquist, B. E.; Lionti, A. E.; Lipeles, E.; Lipniacka, A.; Lisovyi, M.; Liss, T. M.; Lister, A.; Litke, A. M.; Liu, B.; Liu, H.; Liu, H.; Liu, J. K. K.; Liu, J.; Liu, J. B.; Liu, K.; Liu, L.; Liu, M.; Liu, Y. L.; Liu, Y.; Livan, M.; Lleres, A.; Llorente Merino, J.; Lloyd, S. L.; Lo, C. Y.; Lo Sterzo, F.; Lobodzinska, E. M.; Loch, P.; Loebinger, F. K.; Loesle, A.; Loew, K. M.; Lohse, T.; Lohwasser, K.; Lokajicek, M.; Long, B. A.; Long, J. D.; Long, R. E.; Longo, L.; Looper, K. A.; Lopez, J. A.; Lopez Paz, I.; Lopez Solis, A.; Lorenz, J.; Lorenzo Martinez, N.; Losada, M.; Lösel, P. J.; Lou, X.; Lounis, A.; Love, J.; Love, P. A.; Lu, H.; Lu, N.; Lu, Y. J.; Lubatti, H. J.; Luci, C.; Lucotte, A.; Luedtke, C.; Luehring, F.; Lukas, W.; Luminari, L.; Lundberg, O.; Lund-Jensen, B.; Lutz, M. S.; Luzi, P. M.; Lynn, D.; Lysak, R.; Lytken, E.; Lyu, F.; Lyubushkin, V.; Ma, H.; Ma, L. L.; Ma, Y.; Maccarrone, G.; Macchiolo, A.; Macdonald, C. M.; Maček, B.; Machado Miguens, J.; Madaffari, D.; Madar, R.; Mader, W. F.; Madsen, A.; Madysa, N.; Maeda, J.; Maeland, S.; Maeno, T.; Maevskiy, A. S.; Magerl, V.; Maiani, C.; Maidantchik, C.; Maier, T.; Maio, A.; Majersky, O.; Majewski, S.; Makida, Y.; Makovec, N.; Malaescu, B.; Malecki, Pa.; Maleev, V. P.; Malek, F.; Mallik, U.; Malon, D.; Malone, C.; Maltezos, S.; Malyukov, S.; Mamuzic, J.; Mancini, G.; Mandić, I.; Maneira, J.; Manhaes de Andrade Filho, L.; Manjarres Ramos, J.; Mankinen, K. H.; Mann, A.; Manousos, A.; Mansoulie, B.; Mansour, J. D.; Mantifel, R.; Mantoani, M.; Manzoni, S.; Mapelli, L.; Marceca, G.; March, L.; Marchese, L.; Marchiori, G.; Marcisovsky, M.; Marin Tobon, C. A.; Marjanovic, M.; Marley, D. E.; Marroquim, F.; Marsden, S. P.; Marshall, Z.; Martensson, M. U. F.; Marti-Garcia, S.; Martin, C. B.; Martin, T. A.; Martin, V. J.; Martin dit Latour, B.; Martinez, M.; Martinez Outschoorn, V. I.; Martin-Haugh, S.; Martoiu, V. S.; Martyniuk, A. C.; Marzin, A.; Masetti, L.; Mashimo, T.; Mashinistov, R.; Masik, J.; Maslennikov, A. L.; Mason, L. H.; Massa, L.; Mastrandrea, P.; Mastroberardino, A.; Masubuchi, T.; Mättig, P.; Maurer, J.; Maxfield, S. J.; Maximov, D. A.; Mazini, R.; Maznas, I.; Mazza, S. M.; Mc Fadden, N. C.; Mc Goldrick, G.; Mc Kee, S. P.; McCarn, A.; McCarthy, R. L.; McCarthy, T. G.; McClymont, L. I.; McDonald, E. F.; Mcfayden, J. A.; Mchedlidze, G.; McKay, M. A.; McMahon, S. J.; McNamara, P. C.; McNicol, C. J.; McPherson, R. A.; Meehan, S.; Megy, T. J.; Mehlhase, S.; Mehta, A.; Meideck, T.; Meier, K.; Meirose, B.; Melini, D.; Mellado Garcia, B. R.; Mellenthin, J. D.; Melo, M.; Meloni, F.; Melzer, A.; Menary, S. B.; Meng, L.; Meng, X. T.; Mengarelli, A.; Menke, S.; Meoni, E.; Mergelmeyer, S.; Merlassino, C.; Mermod, P.; Merola, L.; Meroni, C.; Merritt, F. S.; Messina, A.; Metcalfe, J.; Mete, A. S.; Meyer, C.; Meyer, J.-P.; Meyer, J.; Meyer Zu Theenhausen, H.; Miano, F.; Middleton, R. P.; Miglioranzi, S.; Mijović, L.; Mikenberg, G.; Mikestikova, M.; Mikuž, M.; Milesi, M.; Milic, A.; Millar, D. A.; Miller, D. W.; Mills, C.; Milov, A.; Milstead, D. A.; Minaenko, A. A.; Minami, Y.; Minashvili, I. A.; Mincer, A. I.; Mindur, B.; Mineev, M.; Minegishi, Y.; Ming, Y.; Mir, L. M.; Mirto, A.; Mistry, K. P.; Mitani, T.; Mitrevski, J.; Mitsou, V. A.; Miucci, A.; Miyagawa, P. S.; Mizukami, A.; Mjörnmark, J. U.; Mkrtchyan, T.; Mlynarikova, M.; Moa, T.; Mochizuki, K.; Mogg, P.; Mohapatra, S.; Molander, S.; Moles-Valls, R.; Mondragon, M. C.; Mönig, K.; Monk, J.; Monnier, E.; Montalbano, A.; Montejo Berlingen, J.; Monticelli, F.; Monzani, S.; Moore, R. W.; Morange, N.; Moreno, D.; Moreno Llácer, M.; Morettini, P.; Morgenstern, S.; Mori, D.; Mori, T.; Morii, M.; Morinaga, M.; Morisbak, V.; Morley, A. K.; Mornacchi, G.; Morris, J. D.; Morvaj, L.; Moschovakos, P.; Mosidze, M.; Moss, H. J.; Moss, J.; Motohashi, K.; Mount, R.; Mountricha, E.; Moyse, E. J. W.; Muanza, S.; Mueller, F.; Mueller, J.; Mueller, R. S. P.; Muenstermann, D.; Mullen, P.; Mullier, G. A.; Munoz Sanchez, F. J.; Murray, W. J.; Musheghyan, H.; Muškinja, M.; Myagkov, A. G.; Myska, M.; Nachman, B. P.; Nackenhorst, O.; Nagai, K.; Nagai, R.; Nagano, K.; Nagasaka, Y.; Nagata, K.; Nagel, M.; Nagy, E.; Nairz, A. M.; Nakahama, Y.; Nakamura, K.; Nakamura, T.; Nakano, I.; Naranjo Garcia, R. F.; Narayan, R.; Narrias Villar, D. I.; Naryshkin, I.; Naumann, T.; Navarro, G.; Nayyar, R.; Neal, H. A.; Nechaeva, P. Yu.; Neep, T. J.; Negri, A.; Negrini, M.; Nektarijevic, S.; Nellist, C.; Nelson, A.; Nelson, M. E.; Nemecek, S.; Nemethy, P.; Nessi, M.; Neubauer, M. S.; Neumann, M.; Newman, P. R.; Ng, T. Y.; Ng, Y. S.; Nguyen Manh, T.; Nickerson, R. B.; Nicolaidou, R.; Nielsen, J.; Nikiforou, N.; Nikolaenko, V.; Nikolic-Audit, I.; Nikolopoulos, K.; Nilsson, P.; Ninomiya, Y.; Nisati, A.; Nishu, N.; Nisius, R.; Nitsche, I.; Nitta, T.; Nobe, T.; Noguchi, Y.; Nomachi, M.; Nomidis, I.; Nomura, M. A.; Nooney, T.; Nordberg, M.; Norjoharuddeen, N.; Novgorodova, O.; Nozaki, M.; Nozka, L.; Ntekas, K.; Nurse, E.; Nuti, F.; O'connor, K.; O'Neil, D. C.; O'Rourke, A. A.; O'Shea, V.; Oakham, F. G.; Oberlack, H.; Obermann, T.; Ocariz, J.; Ochi, A.; Ochoa, I.; Ochoa-Ricoux, J. P.; Oda, S.; Odaka, S.; Oh, A.; Oh, S. H.; Ohm, C. C.; Ohman, H.; Oide, H.; Okawa, H.; Okumura, Y.; Okuyama, T.; Olariu, A.; Oleiro Seabra, L. F.; Olivares Pino, S. A.; Oliveira Damazio, D.; Olsson, M. J. R.; Olszewski, A.; Olszowska, J.; Onofre, A.; Onogi, K.; Onyisi, P. U. E.; Oppen, H.; Oreglia, M. J.; Oren, Y.; Orestano, D.; Orlando, N.; Orr, R. S.; Osculati, B.; Ospanov, R.; Otero y Garzon, G.; Otono, H.; Ouchrif, M.; Ould-Saada, F.; Ouraou, A.; Oussoren, K. P.; Ouyang, Q.; Owen, M.; Owen, R. E.; Ozcan, V. E.; Ozturk, N.; Pachal, K.; Pacheco Pages, A.; Pacheco Rodriguez, L.; Padilla Aranda, C.; Pagan Griso, S.; Paganini, M.; Paige, F.; Palacino, G.; Palazzo, S.; Palestini, S.; Palka, M.; Pallin, D.; Panagiotopoulou, E. St.; Panagoulias, I.; Pandini, C. E.; Panduro Vazquez, J. G.; Pani, P.; Panitkin, S.; Pantea, D.; Paolozzi, L.; Papadopoulou, Th. D.; Papageorgiou, K.; Paramonov, A.; Paredes Hernandez, D.; Parker, A. J.; Parker, M. A.; Parker, K. A.; Parodi, F.; Parsons, J. A.; Parzefall, U.; Pascuzzi, V. R.; Pasner, J. M.; Pasqualucci, E.; Passaggio, S.; Pastore, Fr.; Pataraia, S.; Pater, J. R.; Pauly, T.; Pearson, B.; Pedraza Lopez, S.; Pedro, R.; Peleganchuk, S. V.; Penc, O.; Peng, C.; Peng, H.; Penwell, J.; Peralva, B. S.; Perego, M. M.; Perepelitsa, D. V.; Peri, F.; Perini, L.; Pernegger, H.; Perrella, S.; Peschke, R.; Peshekhonov, V. D.; Peters, K.; Peters, R. F. Y.; Petersen, B. A.; Petersen, T. C.; Petit, E.; Petridis, A.; Petridou, C.; Petroff, P.; Petrolo, E.; Petrov, M.; Petrucci, F.; Pettersson, N. E.; Peyaud, A.; Pezoa, R.; Phillips, F. H.; Phillips, P. W.; Piacquadio, G.; Pianori, E.; Picazio, A.; Pickering, M. A.; Piegaia, R.; Pilcher, J. E.; Pilkington, A. D.; Pinamonti, M.; Pinfold, J. L.; Pirumov, H.; Pitt, M.; Plazak, L.; Pleier, M.-A.; Pleskot, V.; Plotnikova, E.; Pluth, D.; Podberezko, P.; Poettgen, R.; Poggi, R.; Poggioli, L.; Pogrebnyak, I.; Pohl, D.; Pokharel, I.; Polesello, G.; Poley, A.; Policicchio, A.; Polifka, R.; Polini, A.; Pollard, C. S.; Polychronakos, V.; Pommès, K.; Ponomarenko, D.; Pontecorvo, L.; Popeneciu, G. A.; Portillo Quintero, D. M.; Pospisil, S.; Potamianos, K.; Potrap, I. N.; Potter, C. J.; Potti, H.; Poulsen, T.; Poveda, J.; Pozo Astigarraga, M. E.; Pralavorio, P.; Pranko, A.; Prell, S.; Price, D.; Primavera, M.; Prince, S.; Proklova, N.; Prokofiev, K.; Prokoshin, F.; Protopopescu, S.; Proudfoot, J.; Przybycien, M.; Puri, A.; Puzo, P.; Qian, J.; Qin, G.; Qin, Y.; Quadt, A.; Queitsch-Maitland, M.; Quilty, D.; Raddum, S.; Radeka, V.; Radescu, V.; Radhakrishnan, S. K.; Radloff, P.; Rados, P.; Ragusa, F.; Rahal, G.; Raine, J. A.; Rajagopalan, S.; Rangel-Smith, C.; Rashid, T.; Raspopov, S.; Ratti, M. G.; Rauch, D. M.; Rauscher, F.; Rave, S.; Ravinovich, I.; Rawling, J. H.; Raymond, M.; Read, A. L.; Readioff, N. P.; Reale, M.; Rebuzzi, D. M.; Redelbach, A.; Redlinger, G.; Reece, R.; Reed, R. G.; Reeves, K.; Rehnisch, L.; Reichert, J.; Reiss, A.; Rembser, C.; Ren, H.; Rescigno, M.; Resconi, S.; Resseguie, E. D.; Rettie, S.; Reynolds, E.; Rezanova, O. L.; Reznicek, P.; Rezvani, R.; Richter, R.; Richter, S.; Richter-Was, E.; Ricken, O.; Ridel, M.; Rieck, P.; Riegel, C. J.; Rieger, J.; Rifki, O.; Rijssenbeek, M.; Rimoldi, A.; Rimoldi, M.; Rinaldi, L.; Ripellino, G.; Ristić, B.; Ritsch, E.; Riu, I.; Rizatdinova, F.; Rizvi, E.; Rizzi, C.; Roberts, R. T.; Robertson, S. H.; Robichaud-Veronneau, A.; Robinson, D.; Robinson, J. E. M.; Robson, A.; Rocco, E.; Roda, C.; Rodina, Y.; Rodriguez Bosca, S.; Rodriguez Perez, A.; Rodriguez Rodriguez, D.; Roe, S.; Rogan, C. S.; Røhne, O.; Roloff, J.; Romaniouk, A.; Romano, M.; Romano Saez, S. M.; Romero Adam, E.; Rompotis, N.; Ronzani, M.; Roos, L.; Rosati, S.; Rosbach, K.; Rose, P.; Rosien, N.-A.; Rossi, E.; Rossi, L. P.; Rosten, J. H. N.; Rosten, R.; Rotaru, M.; Rothberg, J.; Rousseau, D.; Rozanov, A.; Rozen, Y.; Ruan, X.; Rubbo, F.; Rühr, F.; Ruiz-Martinez, A.; Rurikova, Z.; Rusakovich, N. A.; Russell, H. L.; Rutherfoord, J. P.; Ruthmann, N.; Rüttinger, E. M.; Ryabov, Y. F.; Rybar, M.; Rybkin, G.; Ryu, S.; Ryzhov, A.; Rzehorz, G. F.; Saavedra, A. F.; Sabato, G.; Sacerdoti, S.; Sadrozinski, H. F.-W.; Sadykov, R.; Safai Tehrani, F.; Saha, P.; Sahinsoy, M.; Saimpert, M.; Saito, M.; Saito, T.; Sakamoto, H.; Sakurai, Y.; Salamanna, G.; Salazar Loyola, J. E.; Salek, D.; Sales De Bruin, P. H.; Salihagic, D.; Salnikov, A.; Salt, J.; Salvatore, D.; Salvatore, F.; Salvucci, A.; Salzburger, A.; Sammel, D.; Sampsonidis, D.; Sampsonidou, D.; Sánchez, J.; Sanchez Martinez, V.; Sanchez Pineda, A.; Sandaker, H.; Sandbach, R. L.; Sander, C. O.; Sandhoff, M.; Sandoval, C.; Sankey, D. P. C.; Sannino, M.; Sano, Y.; Sansoni, A.; Santoni, C.; Santos, H.; Santoyo Castillo, I.; Sapronov, A.; Saraiva, J. G.; Sarrazin, B.; Sasaki, O.; Sato, K.; Sauvan, E.; Savage, G.; Savard, P.; Savic, N.; Sawyer, C.; Sawyer, L.; Saxon, J.; Sbarra, C.; Sbrizzi, A.; Scanlon, T.; Scannicchio, D. A.; Schaarschmidt, J.; Schacht, P.; Schachtner, B. M.; Schaefer, D.; Schaefer, L.; Schaefer, R.; Schaeffer, J.; Schaepe, S.; Schaetzel, S.; Schäfer, U.; Schaffer, A. C.; Schaile, D.; Schamberger, R. D.; Schegelsky, V. A.; Scheirich, D.; Schenck, F.; Schernau, M.; Schiavi, C.; Schier, S.; Schildgen, L. K.; Schillo, C.; Schioppa, M.; Schlenker, S.; Schmidt-Sommerfeld, K. R.; Schmieden, K.; Schmitt, C.; Schmitt, S.; Schmitz, S.; Schnoor, U.; Schoeffel, L.; Schoening, A.; Schoenrock, B. D.; Schopf, E.; Schott, M.; Schouwenberg, J. F. P.; Schovancova, J.; Schramm, S.; Schuh, N.; Schulte, A.; Schultens, M. J.; Schultz-Coulon, H.-C.; Schulz, H.; Schumacher, M.; Schumm, B. A.; Schune, Ph.; Schwartzman, A.; Schwarz, T. A.; Schweiger, H.; Schwemling, Ph.; Schwienhorst, R.; Schwindling, J.; Sciandra, A.; Sciolla, G.; Scornajenghi, M.; Scuri, F.; Scutti, F.; Searcy, J.; Seema, P.; Seidel, S. C.; Seiden, A.; Seixas, J. M.; Sekhniaidze, G.; Sekhon, K.; Sekula, S. J.; Semprini-Cesari, N.; Senkin, S.; Serfon, C.; Serin, L.; Serkin, L.; Sessa, M.; Seuster, R.; Severini, H.; Sfiligoj, T.; Sforza, F.; Sfyrla, A.; Shabalina, E.; Shaikh, N. W.; Shan, L. Y.; Shang, R.; Shank, J. T.; Shapiro, M.; Shatalov, P. B.; Shaw, K.; Shaw, S. M.; Shcherbakova, A.; Shehu, C. Y.; Shen, Y.; Sherafati, N.; Sherman, A. D.; Sherwood, P.; Shi, L.; Shimizu, S.; Shimmin, C. O.; Shimojima, M.; Shipsey, I. P. J.; Shirabe, S.; Shiyakova, M.; Shlomi, J.; Shmeleva, A.; Shoaleh Saadi, D.; Shochet, M. J.; Shojaii, S.; Shope, D. R.; Shrestha, S.; Shulga, E.; Shupe, M. A.; Sicho, P.; Sickles, A. M.; Sidebo, P. E.; Sideras Haddad, E.; Sidiropoulou, O.; Sidoti, A.; Siegert, F.; Sijacki, Dj.; Silva, J.; Silverstein, S. B.; Simak, V.; Simic, L.; Simion, S.; Simioni, E.; Simmons, B.; Simon, M.; Sinervo, P.; Sinev, N. B.; Sioli, M.; Siragusa, G.; Siral, I.; Sivoklokov, S. Yu.; Sjölin, J.; Skinner, M. B.; Skubic, P.; Slater, M.; Slavicek, T.; Slawinska, M.; Sliwa, K.; Slovak, R.; Smakhtin, V.; Smart, B. H.; Smiesko, J.; Smirnov, N.; Smirnov, S. Yu.; Smirnov, Y.; Smirnova, L. N.; Smirnova, O.; Smith, J. W.; Smith, M. N. K.; Smith, R. W.; Smizanska, M.; Smolek, K.; Snesarev, A. A.; Snyder, I. M.; Snyder, S.; Sobie, R.; Socher, F.; Soffer, A.; Søgaard, A.; Soh, D. A.; Sokhrannyi, G.; Solans Sanchez, C. A.; Solar, M.; Soldatov, E. Yu.; Soldevila, U.; Solodkov, A. A.; Soloshenko, A.; Solovyanov, O. V.; Solovyev, V.; Sommer, P.; Son, H.; Sopczak, A.; Sosa, D.; Sotiropoulou, C. L.; Sottocornola, S.; Soualah, R.; Soukharev, A. M.; South, D.; Sowden, B. C.; Spagnolo, S.; Spalla, M.; Spangenberg, M.; Spanò, F.; Sperlich, D.; Spettel, F.; Spieker, T. M.; Spighi, R.; Spigo, G.; Spiller, L. A.; Spousta, M.; Denis, R. D. St.; Stabile, A.; Stamen, R.; Stamm, S.; Stanecka, E.; Stanek, R. W.; Stanescu, C.; Stanitzki, M. M.; Stapf, B. S.; Stapnes, S.; Starchenko, E. A.; Stark, G. H.; Stark, J.; Stark, S. H.; Staroba, P.; Starovoitov, P.; Stärz, S.; Staszewski, R.; Stegler, M.; Steinberg, P.; Stelzer, B.; Stelzer, H. J.; Stelzer-Chilton, O.; Stenzel, H.; Stevenson, T. J.; Stewart, G. A.; Stockton, M. C.; Stoebe, M.; Stoicea, G.; Stolte, P.; Stonjek, S.; Stradling, A. R.; Straessner, A.; Stramaglia, M. E.; Strandberg, J.; Strandberg, S.; Strauss, M.; Strizenec, P.; Ströhmer, R.; Strom, D. M.; Stroynowski, R.; Strubig, A.; Stucci, S. A.; Stugu, B.; Styles, N. A.; Su, D.; Su, J.; Suchek, S.; Sugaya, Y.; Suk, M.; Sulin, V. V.; Sultan, DMS; Sultansoy, S.; Sumida, T.; Sun, S.; Sun, X.; Suruliz, K.; Suster, C. J. E.; Sutton, M. R.; Suzuki, S.; Svatos, M.; Swiatlowski, M.; Swift, S. P.; Sykora, I.; Sykora, T.; Ta, D.; Tackmann, K.; Taenzer, J.; Taffard, A.; Tafirout, R.; Tahirovic, E.; Taiblum, N.; Takai, H.; Takashima, R.; Takasugi, E. H.; Takeda, K.; Takeshita, T.; Takubo, Y.; Talby, M.; Talyshev, A. A.; Tanaka, J.; Tanaka, M.; Tanaka, R.; Tanaka, S.; Tanioka, R.; Tannenwald, B. B.; Tapia Araya, S.; Tapprogge, S.; Tarem, S.; Tartarelli, G. F.; Tas, P.; Tasevsky, M.; Tashiro, T.; Tassi, E.; Tavares Delgado, A.; Tayalati, Y.; Taylor, A. C.; Taylor, A. J.; Taylor, G. N.; Taylor, P. T. E.; Taylor, W.; Teixeira-Dias, P.; Temple, D.; Ten Kate, H.; Teng, P. K.; Teoh, J. J.; Tepel, F.; Terada, S.; Terashi, K.; Terron, J.; Terzo, S.; Testa, M.; Teuscher, R. J.; Thais, S. J.; Theveneaux-Pelzer, T.; Thiele, F.; Thomas, J. P.; Thomas-Wilsker, J.; Thompson, P. D.; Thompson, A. S.; Thomsen, L. A.; Thomson, E.; Tian, Y.; Tibbetts, M. J.; Ticse Torres, R. E.; Tikhomirov, V. O.; Tikhonov, Yu. A.; Timoshenko, S.; Tipton, P.; Tisserant, S.; Todome, K.; Todorova-Nova, S.; Todt, S.; Tojo, J.; Tokár, S.; Tokushuku, K.; Tolley, E.; Tomlinson, L.; Tomoto, M.; Tompkins, L.; Toms, K.; Tong, B.; Tornambe, P.; Torrence, E.; Torres, H.; Torró Pastor, E.; Toth, J.; Touchard, F.; Tovey, D. R.; Treado, C. J.; Trefzger, T.; Tresoldi, F.; Tricoli, A.; Trigger, I. M.; Trincaz-Duvoid, S.; Tripiana, M. F.; Trischuk, W.; Trocmé, B.; Trofymov, A.; Troncon, C.; Trottier-McDonald, M.; Trovatelli, M.; Truong, L.; Trzebinski, M.; Trzupek, A.; Tsang, K. W.; Tseng, J. C.-L.; Tsiareshka, P. V.; Tsipolitis, G.; Tsirintanis, N.; Tsiskaridze, S.; Tsiskaridze, V.; Tskhadadze, E. G.; Tsukerman, I. I.; Tsulaia, V.; Tsuno, S.; Tsybychev, D.; Tu, Y.; Tudorache, A.; Tudorache, V.; Tulbure, T. T.; Tuna, A. N.; Turchikhin, S.; Turgeman, D.; Turk Cakir, I.; Turra, R.; Tuts, P. M.; Ucchielli, G.; Ueda, I.; Ughetto, M.; Ukegawa, F.; Unal, G.; Undrus, A.; Unel, G.; Ungaro, F. C.; Unno, Y.; Uno, K.; Unverdorben, C.; Urban, J.; Urquijo, P.; Urrejola, P.; Usai, G.; Usui, J.; Vacavant, L.; Vacek, V.; Vachon, B.; Vadla, K. O. H.; Vaidya, A.; Valderanis, C.; Valdes Santurio, E.; Valente, M.; Valentinetti, S.; Valero, A.; Valéry, L.; Valkar, S.; Vallier, A.; Valls Ferrer, J. A.; Van Den Wollenberg, W.; van der Graaf, H.; van Gemmeren, P.; Van Nieuwkoop, J.; van Vulpen, I.; van Woerden, M. C.; Vanadia, M.; Vandelli, W.; Vaniachine, A.; Vankov, P.; Vardanyan, G.; Vari, R.; Varnes, E. W.; Varni, C.; Varol, T.; Varouchas, D.; Vartapetian, A.; Varvell, K. E.; Vasquez, J. G.; Vasquez, G. A.; Vazeille, F.; Vazquez Furelos, D.; Vazquez Schroeder, T.; Veatch, J.; Veeraraghavan, V.; Veloce, L. M.; Veloso, F.; Veneziano, S.; Ventura, A.; Venturi, M.; Venturi, N.; Venturini, A.; Vercesi, V.; Verducci, M.; Verkerke, W.; Vermeulen, A. T.; Vermeulen, J. C.; Vetterli, M. C.; Viaux Maira, N.; Viazlo, O.; Vichou, I.; Vickey, T.; Vickey Boeriu, O. E.; Viehhauser, G. H. A.; Viel, S.; Vigani, L.; Villa, M.; Villaplana Perez, M.; Vilucchi, E.; Vincter, M. G.; Vinogradov, V. B.; Vishwakarma, A.; Vittori, C.; Vivarelli, I.; Vlachos, S.; Vogel, M.; Vokac, P.; Volpi, G.; von der Schmitt, H.; von Toerne, E.; Vorobel, V.; Vorobev, K.; Vos, M.; Voss, R.; Vossebeld, J. H.; Vranjes, N.; Vranjes Milosavljevic, M.; Vrba, V.; Vreeswijk, M.; Vuillermet, R.; Vukotic, I.; Wagner, P.; Wagner, W.; Wagner-Kuhr, J.; Wahlberg, H.; Wahrmund, S.; Wakamiya, K.; Walbrecht, V. M.; Walder, J.; Walker, R.; Walkowiak, W.; Wallangen, V.; Wang, C.; Wang, C.; Wang, F.; Wang, H.; Wang, H.; Wang, J.; Wang, J.; Wang, Q.; Wang, R.-J.; Wang, R.; Wang, S. M.; Wang, T.; Wang, W.; Wang, W.; Wang, Z.; Wanotayaroj, C.; Warburton, A.; Ward, C. P.; Wardrope, D. R.; Washbrook, A.; Watkins, P. M.; Watson, A. T.; Watson, M. F.; Watts, G.; Watts, S.; Waugh, B. M.; Webb, A. F.; Webb, S.; Weber, M. S.; Weber, S. M.; Weber, S. W.; Weber, S. A.; Webster, J. S.; Weidberg, A. R.; Weinert, B.; Weingarten, J.; Weirich, M.; Weiser, C.; Weits, H.; Wells, P. S.; Wenaus, T.; Wengler, T.; Wenig, S.; Wermes, N.; Werner, M. D.; Werner, P.; Wessels, M.; Weston, T. D.; Whalen, K.; Whallon, N. L.; Wharton, A. M.; White, A. S.; White, A.; White, M. J.; White, R.; Whiteson, D.; Whitmore, B. W.; Wickens, F. J.; Wiedenmann, W.; Wielers, M.; Wiglesworth, C.; Wiik-Fuchs, L. A. M.; Wildauer, A.; Wilk, F.; Wilkens, H. G.; Williams, H. H.; Williams, S.; Willis, C.; Willocq, S.; Wilson, J. A.; Wingerter-Seez, I.; Winkels, E.; Winklmeier, F.; Winston, O. J.; Winter, B. T.; Wittgen, M.; Wobisch, M.; Wolf, A.; Wolf, T. M. H.; Wolff, R.; Wolter, M. W.; Wolters, H.; Wong, V. W. S.; Woods, N. L.; Worm, S. D.; Wosiek, B. K.; Wotschack, J.; Wozniak, K. W.; Wu, M.; Wu, S. L.; Wu, X.; Wu, Y.; Wyatt, T. R.; Wynne, B. M.; Xella, S.; Xi, Z.; Xia, L.; Xu, D.; Xu, L.; Xu, T.; Xu, W.; Yabsley, B.; Yacoob, S.; Yamaguchi, D.; Yamaguchi, Y.; Yamamoto, A.; Yamamoto, S.; Yamanaka, T.; Yamane, F.; Yamatani, M.; Yamazaki, T.; Yamazaki, Y.; Yan, Z.; Yang, H.; Yang, H.; Yang, Y.; Yang, Z.; Yao, W.-M.; Yap, Y. C.; Yasu, Y.; Yatsenko, E.; Yau Wong, K. H.; Ye, J.; Ye, S.; Yeletskikh, I.; Yigitbasi, E.; Yildirim, E.; Yorita, K.; Yoshihara, K.; Young, C.; Young, C. J. S.; Yu, J.; Yu, J.; Yuen, S. P. Y.; Yusuff, I.; Zabinski, B.; Zacharis, G.; Zaidan, R.; Zaitsev, A. M.; Zakharchuk, N.; Zalieckas, J.; Zaman, A.; Zambito, S.; Zanzi, D.; Zeitnitz, C.; Zemaityte, G.; Zemla, A.; Zeng, J. C.; Zeng, Q.; Zenin, O.; Ženiš, T.; Zerwas, D.; Zhang, D.; Zhang, D.; Zhang, F.; Zhang, G.; Zhang, H.; Zhang, J.; Zhang, L.; Zhang, L.; Zhang, M.; Zhang, P.; Zhang, R.; Zhang, R.; Zhang, X.; Zhang, Y.; Zhang, Z.; Zhao, X.; Zhao, Y.; Zhao, Z.; Zhemchugov, A.; Zhou, B.; Zhou, C.; Zhou, L.; Zhou, M.; Zhou, M.; Zhou, N.; Zhou, Y.; Zhu, C. G.; Zhu, H.; Zhu, J.; Zhu, Y.; Zhuang, X.; Zhukov, K.; Zibell, A.; Zieminska, D.; Zimine, N. I.; Zimmermann, C.; Zimmermann, S.; Zinonos, Z.; Zinser, M.; Ziolkowski, M.; Živković, L.; Zobernig, G.; Zoccoli, A.; Zou, R.; zur Nedden, M.; Zwalinski, L.

2018-03-01

The coupling properties of the Higgs boson are studied in the four-lepton ( e, μ) decay channel using 36.1 fb-1 of pp collision data from the LHC at a centre-of-mass energy of 13 TeV collected by the ATLAS detector. Cross sections are measured for the main production modes in several exclusive regions of the Higgs boson production phase space and are interpreted in terms of coupling modifiers. The inclusive cross section times branching ratio for H → ZZ ∗ decay and for a Higgs boson absolute rapidity below 2.5 is measured to be 1. 73 - 0.23 + 0.24 (stat.) - 0.08 + 0.10 (exp.) ± 0.04(th.) pb compared to the Standard Model prediction of 1 .34±0 .09 pb. In addition, the tensor structure of the Higgs boson couplings is studied using an effective Lagrangian approach for the description of interactions beyond the Standard Model. Constraints are placed on the non-Standard-Model CP-even and CP-odd couplings to Z bosons and on the CP-odd coupling to gluons. [Figure not available: see fulltext.

Evaluation of the 237Np neutron cross sections in the energy range from 10-5 eV to 5 MeV

International Nuclear Information System (INIS)

Derrien, H.; Fort, E.

1979-01-01

The 237 Np neutron cross-sections have been evaluated in the energy range from thermal to 5 MeV. A set of resonance parameters including a negative level, is recommanded after examination of the available experimental data. This set is used 1) to calculate the cross-sections from the thermal region to 150 ev, and 2) to provide the statistical parameters suitable to the calculations in the unresolved region. At higher energies, the transmission coefficients Te are calculated by the coupled channel optical model code ECIS. They are then used as input in the statistical model code FISINGA. The optical model parameters, including the deformation parameters, are those used by Lagrange for the Pu isotopes, slightly modified to reproduce at 40 KeV the total cross-sections obtained from the pure statistical parameters. The recommendations of Lynn concerning the level density parameters have been used. In this paper we describe the various steps of the evaluation

New singularities in nonrelativistic coupled channel scattering. II. Fourth order

International Nuclear Information System (INIS)

Khuri, N.N.; Tsun Wu, T.

1997-01-01

We consider a two-channel nonrelativistic potential scattering problem, and study perturbation theory in fourth order for the forward amplitude. The main result is that the new singularity demonstrated in second order in the preceding paper I also occurs at the same point in fourth order. Its strength is again that of a pole. copyright 1997 The American Physical Society

Dynamic optical coupled system employing Dammann gratings

Science.gov (United States)

Di, Caihui; Zhou, Changhe; Ru, Huayi

2004-10-01

With the increasing of the number of users in optical fiber communications, fiber-to-home project has a larger market value. Then the need of dynamic optical couplers, especially of N broad-band couplers, becomes greater. Though some advanced fiber fusion techniques have been developed, they still have many shortcomings. In this paper we propose a dynamic optical coupled system employing even-numbered Dammann gratings, which have the characteristic that the phase distribution in the first half-period accurately equals to that in the second-period with π phase inversion. In our experiment, we divide a conventional even-numbered Dammann grating into two identical gratings. The system can achieve the beam splitter and combiner as the switch between them according to the relative shift between two complementary gratings. When there is no shift between the gratings, the demonstrated 1×8 dynamic optical coupler achieves good uniformity of 0.06 and insertion loss of around 10.8 dB for each channel as a splitter. When the two gratings have an accurate shift of a half-period between them, our system has a low insertion loss of 0.46 dB as a combiner at a wavelength of 1550 nm.

Study of a MHEMT heterostructure with an In0.4Ga0.6As channel MBE-grown on a GaAs substrate using reciprocal space mapping

International Nuclear Information System (INIS)

Aleshin, A. N.; Bugaev, A. S.; Ermakova, M. A.; Ruban, O. A.

2015-01-01

The crystallographic characteristics of the design elements of a metamorphic high-electron-mobility (MHEMT) heterostructure with an In 0.4 Ga 0.6 As channel are determined based on reciprocal space mapping. The heterostructure is grown by molecular beam epitaxy on the vicinal surface of a GaAs substrate with a deviation angle from the (001) plane of 2° and consists of a stepped metamorphic buffer containing six layers including an inverse step, a high-temperature buffer layer with constant composition, and active HEMT layers. The InAs content in the layers of the metamorphic buffer is varied from 0.1 to 0.48. Reciprocal space maps are constructed for the (004) symmetric reflection and (224)+ asymmetric reflection. It is found that the heterostructure layers are characterized both by a tilt angle relative to the plane of the (001) substrate and a rotation angle around the [001] axis. The tilt angle of the layer increases as the InAs concentration in the layer increases. It is shown that a high-temperature buffer layer of constant composition has the largest degree of relaxation compared with all other layers of the heterostructure

Approaches to simulate channel and fuel behaviour using CATHENA and ELOCA

International Nuclear Information System (INIS)

Sabourin, G.; Huynh, H.M.

1996-01-01

This paper documents a new approach where the detailed fuel and channel thermalhydraulic calculations are performed by an integrated code. The thermalhydraulic code CATHENA is coupled with the fuel code ELOCA. The scenario used in the simulations is a 100% pump suction break, because its power pulse is large and leads to high sheath temperatures. The results shows that coupling the two codes at each time step can have an important effect on parameters such as the sheath, fuel and pressure tube temperature. In summary, this demonstrates that this original approach can model more adequately the channel and fuel behaviour under postulated large LOCAs. (author)

Linear rate-equilibrium relations arising from ion channel-bilayer energetic coupling

DEFF Research Database (Denmark)

Greisen, Per Junior; Lum, Kevin; Ashrafuzzaman, Md

2011-01-01

Linear rate-equilibrium (RE) relations, also known as linear free energy relations, are widely observed in chemical reactions, including protein folding, enzymatic catalysis, and channel gating. Despite the widespread occurrence of linear RE relations, the principles underlying the linear relatio...

Coupled channel analysis of the 142Ce (α,α)142Ce* reaction: study of a vibrational-rotational transition nucleus

International Nuclear Information System (INIS)

Appoloni, C.R.

1983-01-01

The angular distribution of the elastic and inelastic scattering of a particles corresponding to the excitation of the low-lying collective states of 142 Ce were measured at an incident energy of 18.0 MeV. The angular distribution of the following excited states were obtained: 641, 1.219, 1.450, 1.536, 1.653, 1.742, 2.004, 2.043, 2.114, 2.125, 2.279, 2.364, 2.542, 2.604 e 3.067 MeV. The angular distributions of the ground state and the first six excited states were analysed within the flamework of the Anharmonic Vibrational and Symmetric Rotational Models, with the Coupled Channel Theory. The Anharmonic Vibrational Model gave the best and most complete description of the experimental data. The wave functions and the deformation parameters of the analysed states were determined. (Author) [pt

Effects of quantum coupling on the performance of metal-oxide

Indian Academy of Sciences (India)

Based on the analysis of the three-dimensional Schrödinger equation, the effects of quantum coupling between the transverse and the longitudinal components of channel electron motion on the performance of ballistic MOSFETs have been theoretically investigated by self-consistently solving the coupled ...

MITOCHONDRIAL BKCa CHANNEL

Directory of Open Access Journals (Sweden)

Enrique eBalderas

2015-03-01

Full Text Available Since its discovery in a glioma cell line 15 years ago, mitochondrial BKCa channel (mitoBKCa has been studied in brain cells and cardiomyocytes sharing general biophysical properties such as high K+ conductance (~300 pS, voltage-dependency and Ca2+-sensitivity. Main advances in deciphering the molecular composition of mitoBKCa have included establishing that it is encoded by the Kcnma1 gene, that a C-terminal splice insert confers mitoBKCa ability to be targeted to cardiac mitochondria, and evidence for its potential coassembly with β subunits. Notoriously, β1 subunit directly interacts with cytochrome c oxidase and mitoBKCa can be modulated by substrates of the respiratory chain. mitoBKCa channel has a central role in protecting the heart from ischemia, where pharmacological activation of the channel impacts the generation of reactive oxygen species and mitochondrial Ca2+ preventing cell death likely by impeding uncontrolled opening of the mitochondrial transition pore. Supporting this view, inhibition of mitoBKCa with Iberiotoxin, enhances cytochrome c release from glioma mitochondria. Many tantalizing questions remain. Some of them are: how is mitoBKCa coupled to the respiratory chain? Does mitoBKCa play non-conduction roles in mitochondria physiology? Which are the functional partners of mitoBKCa? What are the roles of mitoBKCa in other cell types? Answers to these questions are essential to define the impact of mitoBKCa channel in mitochondria biology and disease.

Search for anomalous Wtb couplings and flavour-changing neutral currents in $t$-channel single top quark production in pp collisions at $\\sqrt{s}= $ 7 and 8 TeV

CERN Document Server

Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Aşılar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hartl, Christian; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krätschmer, Ilse; Liko, Dietrich; Matsushita, Takashi; Mikulec, Ivan; Rabady, Dinyar; Rad, Navid; Rahbaran, Babak; Rohringer, Herbert; Schieck, Jochen; Strauss, Josef; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; De Wolf, Eddi A; Janssen, Xavier; Lauwers, Jasper; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; Daci, Nadir; De Bruyn, Isabelle; Deroover, Kevin; Heracleous, Natalie; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Olbrechts, Annik; Python, Quentin; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Brun, Hugues; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Léonard, Alexandre; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Randle-conde, Aidan; Seva, Tomislav; Vander Velde, Catherine; Vanlaer, Pascal; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cimmino, Anna; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Garcia, Guillaume; Gul, Muhammad; Poyraz, Deniz; Salva Diblen, Sinem; Schöfbeck, Robert; Tytgat, Michael; Van Driessche, Ward; Yazgan, Efe; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Beluffi, Camille; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caudron, Adrien; Ceard, Ludivine; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Forthomme, Laurent; Francois, Brieuc; Giammanco, Andrea; Jafari, Abideh; Jez, Pavel; Komm, Matthias; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Nuttens, Claude; Piotrzkowski, Krzysztof; Quertenmont, Loic; Selvaggi, Michele; Vidal Marono, Miguel; Wertz, Sébastien; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Matos Figueiredo, Diego; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Dogra, Sunil; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Moon, Chang-Seong; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Vutova, Mariana; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Cheng, Tongguang; Jiang, Chun-Hua; Leggat, Duncan; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; Gomez, Juan Pablo; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Micanovic, Sasa; Sudic, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Elgammal, Sherif; Mohamed, Amr; Mohammed, Yasser; Salama, Elsayed; Calpas, Betty; Kadastik, Mario; Murumaa, Marion; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Pekkanen, Juska; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Peltola, Timo; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Favaro, Carlotta; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Rander, John; Rosowsky, André; Titov, Maksym; Zghiche, Amina; Abdulsalam, Abdulla; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Chapon, Emilien; Charlot, Claude; Davignon, Olivier; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Miné, Philippe; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Regnard, Simon; Salerno, Roberto; Sirois, Yves; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Aubin, Alexandre; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Le Bihan, Anne-Catherine; Merlin, Jeremie Alexandre; Skovpen, Kirill; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Bouvier, Elvire; Carrillo Montoya, Camilo Andres; Chierici, Roberto; Contardo, Didier; Courbon, Benoit; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sabes, David; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Feld, Lutz; Heister, Arno; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Ostapchuk, Andrey; Preuten, Marius; Raupach, Frank; Schael, Stefan; Schomakers, Christian; Schulte, Jan-Frederik; Schulz, Johannes; Verlage, Tobias; Weber, Hendrik; Zhukov, Valery; Brodski, Michael; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Sonnenschein, Lars; Teyssier, Daniel; Thüer, Sebastian; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Lingemann, Joschka; Nehrkorn, Alexander; Nowack, Andreas; Nugent, Ian Michael; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Asawatangtrakuldee, Chayanit; Asin, Ivan; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Dolinska, Ganna; Eckerlin, Guenter; Eckstein, Doris; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Gunnellini, Paolo; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Karacheban, Olena; Kasemann, Matthias; Keaveney, James; Kieseler, Jan; Kleinwort, Claus; Korol, Ievgen; Lange, Wolfgang; Lelek, Aleksandra; Leonard, Jessica; Lipka, Katerina; Lobanov, Artur; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Roland, Benoit; Sahin, Mehmet Özgür; Saxena, Pooja; Schoerner-Sadenius, Thomas; Seitz, Claudia; Spannagel, Simon; Stefaniuk, Nazar; Trippkewitz, Karim Damun; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wissing, Christoph; Blobel, Volker; Centis Vignali, Matteo; Draeger, Arne-Rasmus; Dreyer, Torben; Garutti, Erika; Goebel, Kristin; Gonzalez, Daniel; Haller, Johannes; Hoffmann, Malte; Junkes, Alexandra; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Lapsien, Tobias; Lenz, Teresa; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Ott, Jochen; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Poehlsen, Jennifer; Sander, Christian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Vanhoefer, Annika; Vormwald, Benedikt; Barth, Christian; Baus, Colin; Berger, Joram; Butz, Erik; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Fink, Simon; Friese, Raphael; Giffels, Manuel; Gilbert, Andrew; Haitz, Dominik; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Katkov, Igor; Lobelle Pardo, Patricia; Maier, Benedikt; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Röcker, Steffen; Roscher, Frank; Schröder, Matthias; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Giakoumopoulou, Viktoria Athina; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Agapitos, Antonis; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Loukas, Nikitas; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Filipovic, Nicolas; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bahinipati, Seema; Choudhury, Somnath; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Bhawandeep, Bhawandeep; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kumar, Ramandeep; Mehta, Ankita; Mittal, Monika; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Nishu, Nishu; Ranjan, Kirti; Sharma, Ramkrishna; Sharma, Varun; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy, Debarati; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Kole, Gouranga; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhowmik, Sandeep; Dewanjee, Ram Krishna; Ganguly, Sanmay; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Parida, Bibhuti; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Kapoor, Anshul; Kothekar, Kunal; Rane, Aditee; Sharma, Seema; Behnamian, Hadi; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Fahim, Ali; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Caputo, Claudio; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Chiorboli, Massimiliano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Lo Vetere, Maurizio; Monge, Maria Roberta; Robutti, Enrico; Tosi, Silvano; Brianza, Luca; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Marzocchi, Badder; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; De Nardo, Guglielmo; Di Guida, Salvatore; Esposito, Marco; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lanza, Giuseppe; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Bilei, Gian Mario; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Mantovani, Giancarlo; Menichelli, Mauro; Saha, Anirban; Santocchia, Attilio; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Donato, Silvio; Fedi, Giacomo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; D'imperio, Giulia; Del Re, Daniele; Diemoz, Marcella; Gelli, Simone; Jorda, Clara; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Finco, Linda; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; La Licata, Chiara; Schizzi, Andrea; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Sangeun; Lee, Seh Wook; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Brochero Cifuentes, Javier Andres; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Byounghoon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Oh, Sung Bin; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunchul; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Ryu, Geonmo; Ryu, Min Sang; Choi, Young-Il; Goh, Junghwan; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Komaragiri, Jyothsna Rani; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Hernandez-Almada, Alberto; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Carpinteyro, Severiano; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Khan, Wajid Ali; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Rodrigues Antunes, Joao; Seixas, Joao; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Vischia, Pietro; Golunov, Alexander; Golutvin, Igor; Gorbounov, Nikolai; Kamenev, Alexey; Karjavin, Vladimir; Korenkov, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Mitsyn, Valeri Valentinovitch; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Tikhonenko, Elena; Zarubin, Anatoli; Chtchipounov, Leonid; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Murzin, Victor; Oreshkin, Vadim; Sulimov, Valentin; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Chadeeva, Marina; Danilov, Mikhail; Markin, Oleg; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Bunichev, Viacheslav; Dubinin, Mikhail; Dudko, Lev; Klyukhin, Vyacheslav; Kodolova, Olga; Korneeva, Natalia; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Perfilov, Maxim; Savrin, Viktor; Volkov, Petr; Vorotnikov, George; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Navarro De Martino, Eduardo; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; de Trocóniz, Jorge F; Missiroli, Marino; Moran, Dermot; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Suárez Andrés, Ignacio; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Castiñeiras De Saa, Juan Ramon; Curras, Esteban; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Guio, Federico; De Roeck, Albert; Di Marco, Emanuele; Dobson, Marc; Dordevic, Milos; Dorney, Brian; Du Pree, Tristan; Duggan, Daniel; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Fartoukh, Stephane; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gill, Karl; Girone, Maria; Glege, Frank; Gulhan, Doga; Gundacker, Stefan; Guthoff, Moritz; Hammer, Josef; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Janot, Patrick; Kirschenmann, Henning; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Kousouris, Konstantinos; Krammer, Manfred; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moortgat, Filip; Morovic, Srecko; Mulders, Martijn; Neugebauer, Hannes; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuelle; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Ruan, Manqi; Sakulin, Hannes; Sauvan, Jean-Baptiste; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Sharma, Archana; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Steggemann, Jan; Stoye, Markus; Takahashi, Yuta; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Veres, Gabor Istvan; Wardle, Nicholas; Wöhri, Hermine Katharina; Zagoździńska, Agnieszka; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Eller, Philipp; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Lecomte, Pierre; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Martinez Ruiz del Arbol, Pablo; Masciovecchio, Mario; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Rossini, Marco; Schönenberger, Myriam; Starodumov, Andrei; Takahashi, Maiko; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Wallny, Rainer; Aarrestad, Thea Klaeboe; Amsler, Claude; Caminada, Lea; Canelli, Maria Florencia; Chiochia, Vincenzo; De Cosa, Annapaola; Galloni, Camilla; Hinzmann, Andreas; Hreus, Tomas; Kilminster, Benjamin; Lange, Clemens; Ngadiuba, Jennifer; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Yang, Yong; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Konyushikhin, Maxim; Kuo, Chia-Ming; Lin, Willis; Lu, Yun-Ju; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Dietz, Charles; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Miñano Moya, Mercedes; Paganis, Efstathios; Psallidas, Andreas; Tsai, Jui-fa; Tzeng, Yeng-Ming; Asavapibhop, Burin; Singh, Gurpreet; Srimanobhas, Norraphat; Suwonjandee, Narumon; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Tali, Bayram; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Bilmis, Selcuk; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Yetkin, Elif Asli; Yetkin, Taylan; Cakir, Altan; Cankocak, Kerem; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Sorokin, Pavel; Aggleton, Robin; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Flacher, Henning; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Jacob, Jeson; Kreczko, Lukasz; Lucas, Chris; Newbold, Dave M; Paramesvaran, Sudarshan; Poll, Anthony; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Baber, Mark; Bainbridge, Robert; Buchmuller, Oliver; Bundock, Aaron; Burton, Darren; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Dunne, Patrick; Elwood, Adam; Futyan, David; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; Lane, Rebecca; Laner, Christian; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Penning, Bjoern; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Seez, Christopher; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Berry, Edmund; Cutts, David; Garabedian, Alex; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Jesus, Orduna; Laird, Edward; Landsberg, Greg; Mao, Zaixing; Narain, Meenakshi; Piperov, Stefan; Sagir, Sinan; Spencer, Eric; Syarif, Rizki; Breedon, Richard; Breto, Guillermo; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Shalhout, Shalhout; Smith, John; Squires, Michael; Stolp, Dustin; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Cousins, Robert; Everaerts, Pieter; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Saltzberg, David; Takasugi, Eric; Valuev, Vyacheslav; Weber, Matthias; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Jandir, Pawandeep; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Malberti, Martina; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Shrinivas, Amithabh; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Holzner, André; Klein, Daniel; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Welke, Charles; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Flowers, Kristen; Franco Sevilla, Manuel; Geffert, Paul; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Mccoll, Nickolas; Mullin, Sam Daniel; Ovcharova, Ana; Richman, Jeffrey; Stuart, David; Suarez, Indara; West, Christopher; Yoo, Jaehyeok; Anderson, Dustin; Apresyan, Artur; Bendavid, Joshua; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Duarte, Javier; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Azzolini, Virginia; Carlson, Benjamin; Ferguson, Thomas; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Apollinari, Giorgio; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Cremonesi, Matteo; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hare, Daryl; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Maruyama, Sho; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; Newman-Holmes, Catherine; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Das, Souvik; Field, Richard D; Furic, Ivan-Kresimir; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Milenovic, Predrag; Mitselmakher, Guenakh; Rank, Douglas; Shchutska, Lesya; Sperka, David; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Jordon Rowe; Adams, Todd; Askew, Andrew; Bein, Samuel; Diamond, Brendan; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Khatiwada, Ajeeta; Prosper, Harrison; Santra, Arka; Weinberg, Marc; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Bucinskaite, Inga; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Kurt, Pelin; O'Brien, Christine; Sandoval Gonzalez, Irving Daniel; Turner, Paul; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zakaria, Mohammed; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Anderson, Ian; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Osherson, Marc; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; Xin, Yongjie; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Bowen, James; Bruner, Christopher; Castle, James; Kenny III, Raymond Patrick; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Sanders, Stephen; Stringer, Robert; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Lange, David; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Ferraioli, Charles; Gomez, Jaime; Hadley, Nicholas John; Jabeen, Shabnam; Kellogg, Richard G; Kolberg, Ted; Kunkle, Joshua; Lu, Ying; Mignerey, Alice; Shin, Young Ho; Skuja, Andris; Tonjes, Marguerite; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Apyan, Aram; Barbieri, Richard; Baty, Austin; Bi, Ran; Bierwagen, Katharina; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; Demiragli, Zeynep; Di Matteo, Leonardo; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Krajczar, Krisztian; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Varma, Mukund; Velicanu, Dragos; Veverka, Jan; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Yang, Mingming; Zhukova, Victoria; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Finkel, Alexey; Gude, Alexander; Hansen, Peter; Kalafut, Sean; Kao, Shih-Chuan; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bartek, Rachel; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Knowlton, Dan; Kravchenko, Ilya; Malta Rodrigues, Alan; Meier, Frank; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Alyari, Maral; Dolen, James; George, Jimin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kaisen, Josh; Kharchilava, Avto; Kumar, Ashish; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Nash, David; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wang, Ren-Jie; Wood, Darien; Bhattacharya, Saptaparna; Hahn, Kristan Allan; Kubik, Andrew; Low, Jia Fu; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Brinson, Jessica; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Hughes, Richard; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Puigh, Darren; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Luo, Jingyu; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Tully, Christopher; Zuranski, Andrzej; Malik, Sudhir; Barker, Anthony; Barnes, Virgil E; Benedetti, Daniele; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Jung, Kurt; Miller, David Harry; Neumeister, Norbert; Radburn-Smith, Benjamin Charles; Shi, Xin; Sun, Jian; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Parashar, Neeti; Stupak, John; Adair, Antony; Akgun, Bora; Chen, Zhenyu; Ecklund, Karl Matthew; Geurts, Frank JM; Guilbaud, Maxime; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Rorie, Jamal; Tu, Zhoudunming; Zabel, James; Betchart, Burton; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Chou, John Paul; Contreras-Campana, Emmanuel; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hidas, Dean; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Nash, Kevin; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Juska, Evaldas; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Rose, Anthony; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Faulkner, James; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Sun, Xin; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Clarke, Christopher; Harr, Robert; Karchin, Paul Edmund; Lamichhane, Pramod; Sturdy, Jared; Belknap, Donald; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Sharma, Archana; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel

2017-02-07

Single top quark events produced in the $t$ channel are used to set limits on anomalous Wtb couplings and to search for top quark flavour-changing neutral current (FCNC) interactions. The data taken with the CMS detector at the LHC in proton-proton collisions at $\\sqrt{s}=$ 7 and 8 TeV correspond to integrated luminosities of 5.0 and 19.7 fb$^{-1}$, respectively. The analysis is performed using events with one muon and two or three jets. A Bayesian neural network technique, used to discriminate between the signal and backgrounds, is found to be consistent with the standard model prediction. The 95% confidence level (CL) exclusion limits on anomalous right-handed vector, and left- and right-handed tensor Wtb couplings are measured to be $|f_{\\rm V}^{\\rm R}|< 0.16$, $|f_{\\rm T}^{\\rm L}|<0.057$, and $-0.049couplings $\\kappa_{\\rm tug}$ and $\\kappa_{\\rm tcg}$, the 95% CL upper limits on coupling strengths are $|\\kappa_{\\rm tug}|/\\Lambda < 4.1 \\ti...

Thermodynamic coupling between activation and inactivation gating in potassium channels revealed by free energy molecular dynamics simulations.

Science.gov (United States)

Pan, Albert C; Cuello, Luis G; Perozo, Eduardo; Roux, Benoît

2011-12-01

The amount of ionic current flowing through K(+) channels is determined by the interplay between two separate time-dependent processes: activation and inactivation gating. Activation is concerned with the stimulus-dependent opening of the main intracellular gate, whereas inactivation is a spontaneous conformational transition of the selectivity filter toward a nonconductive state occurring on a variety of timescales. A recent analysis of multiple x-ray structures of open and partially open KcsA channels revealed the mechanism by which movements of the inner activation gate, formed by the inner helices from the four subunits of the pore domain, bias the conformational changes at the selectivity filter toward a nonconductive inactivated state. This analysis highlighted the important role of Phe103, a residue located along the inner helix, near the hinge position associated with the opening of the intracellular gate. In the present study, we use free energy perturbation molecular dynamics simulations (FEP/MD) to quantitatively elucidate the thermodynamic basis for the coupling between the intracellular gate and the selectivity filter. The results of the FEP/MD calculations are in good agreement with experiments, and further analysis of the repulsive, van der Waals dispersive, and electrostatic free energy contributions reveals that the energetic basis underlying the absence of inactivation in the F103A mutation in KcsA is the absence of the unfavorable steric interaction occurring with the large Ile100 side chain in a neighboring subunit when the intracellular gate is open and the selectivity filter is in a conductive conformation. Macroscopic current analysis shows that the I100A mutant indeed relieves inactivation in KcsA, but to a lesser extent than the F103A mutant.

A portable cell-based impedance sensor for toxicity testing of drinking water.

Science.gov (United States)

Curtis, Theresa M; Widder, Mark W; Brennan, Linda M; Schwager, Steven J; van der Schalie, William H; Fey, Julien; Salazar, Noe

2009-08-07

A major limitation to using mammalian cell-based biosensors for field testing of drinking water samples is the difficulty of maintaining cell viability and sterility without an on-site cell culture facility. This paper describes a portable automated bench-top mammalian cell-based toxicity sensor that incorporates enclosed fluidic biochips containing endothelial cells monitored by Electric Cell-substrate Impedance Sensing (ECIS) technology. Long-term maintenance of cells on the biochips is made possible by using a compact, self-contained disposable media delivery system. The toxicity sensor monitors changes in impedance of cell monolayers on the biochips after the introduction of water samples. The fluidic biochip includes an ECIS electronic layer and a polycarbonate channel layer, which together reduce initial impedance disturbances seen in commercially available open well ECIS chips caused by the mechanics of pipetting while maintaining the ability of the cells to respond to toxicants. A curve discrimination program was developed that compares impedance values over time between the control and treatment channels on the fluidic biochip and determines if they are significantly different. Toxicant responses of bovine pulmonary artery endothelial cells grown on fluidic biochips are similar to cells on commercially-available open well chips, and these cells can be maintained in the toxicity sensor device for at least nine days using an automated media delivery system. Longer-term cell storage is possible; bovine lung microvessel endothelial cells survive for up to four months on the fluidic biochips and remain responsive to a model toxicant. This is the first demonstration of a portable bench top system capable of both supporting cell health over extended periods of time and obtaining impedance measurements from endothelial cell monolayers after toxicant exposure.

Coupled-reaction-channel analysis of the (d,6Li) reaction on 24Mg and 26Mg to low-lying states

International Nuclear Information System (INIS)

Oelert, W.

1986-01-01

Experimental spectroscopic factors of the alpha-transfer reaction on nuclei of the sd-shell show rather strong inconsistencies and scatter much more strongly than explainable by the quoted errors. The poorer the quality of agreement between experimental and theoretical angular distribution shapes, the more inconsistent the comparison of spectroscopic factors either between different experiments or between theory and experiment. In view of the strong deformation of nuclei in the lower part of the sd-shell, higher-order reaction mechanisms are expected. A coupled-reaction-channel analysis for the transitions to the 0 + , 2 + , and 4 + states of the ground-state bands in 20 Ne and 22 Ne excited via the (d, 6 Li) reaction yields good agreement between experimental and theoretical angular distribution shapes as well as spectroscopic information. (orig.)

Robustness of spin-coupling distributions for perfect quantum state transfer

International Nuclear Information System (INIS)

Zwick, Analia; Alvarez, Gonzalo A.; Stolze, Joachim; Osenda, Omar

2011-01-01

The transmission of quantum information between different parts of a quantum computer is of fundamental importance. Spin chains have been proposed as quantum channels for transferring information. Different configurations for the spin couplings were proposed in order to optimize the transfer. As imperfections in the creation of these specific spin-coupling distributions can never be completely avoided, it is important to find out which systems are optimally suited for information transfer by assessing their robustness against imperfections or disturbances. We analyze different spin coupling distributions of spin chain channels designed for perfect quantum state transfer. In particular, we study the transfer of an initial state from one end of the chain to the other end. We quantify the robustness of different coupling distributions against perturbations and we relate it to the properties of the energy eigenstates and eigenvalues. We find that the localization properties of the systems play an important role for robust quantum state transfer.

Distribution of cardiac sodium channels in clusters potentiates ephaptic interactions in the intercalated disc.

Science.gov (United States)

Hichri, Echrak; Abriel, Hugues; Kucera, Jan P

2018-02-15

It has been proposed that ephaptic conduction, relying on interactions between the sodium (Na + ) current and the extracellular potential in intercalated discs, might contribute to cardiac conduction when gap junctional coupling is reduced, but this mechanism is still controversial. In intercalated discs, Na + channels form clusters near gap junction plaques, but the functional significance of these clusters has never been evaluated. In HEK cells expressing cardiac Na + channels, we show that restricting the extracellular space modulates the Na + current, as predicted by corresponding simulations accounting for ephaptic effects. In a high-resolution model of the intercalated disc, clusters of Na + channels that face each other across the intercellular cleft facilitate ephaptic impulse transmission when gap junctional coupling is reduced. Thus, our simulations reveal a functional role for the clustering of Na + channels in intercalated discs, and suggest that rearrangement of these clusters in disease may influence cardiac conduction. It has been proposed that ephaptic interactions in intercalated discs, mediated by extracellular potentials, contribute to cardiac impulse propagation when gap junctional coupling is reduced. However, experiments demonstrating ephaptic effects on the cardiac Na + current (I Na ) are scarce. Furthermore, Na + channels form clusters around gap junction plaques, but the electrophysiological significance of these clusters has never been investigated. In patch clamp experiments with HEK cells stably expressing human Na v 1.5 channels, we examined how restricting the extracellular space modulates I Na elicited by an activation protocol. In parallel, we developed a high-resolution computer model of the intercalated disc to investigate how the distribution of Na + channels influences ephaptic interactions. Approaching the HEK cells to a non-conducting obstacle always increased peak I Na at step potentials near the threshold of I Na activation

Minimally coupled N-particle scattering integral equations

International Nuclear Information System (INIS)

Kowalski, K.L.

1977-01-01

A concise formalism is developed which permits the efficient representation and generalization of several known techniques for deriving connected-kernel N-particle scattering integral equations. The methods of Kouri, Levin, and Tobocman and Bencze and Redish which lead to minimally coupled integral equations are of special interest. The introduction of channel coupling arrays is characterized in a general manner and the common base of this technique and that of the so-called channel coupling scheme is clarified. It is found that in the Bencze-Redish formalism a particular coupling array has a crucial function but one different from that of the arrays employed by Kouri, Levin, and Tobocman. The apparent dependence of the proof of the minimality of the Bencze-Redish integral equations upon the form of the inhomogeneous term in these equations is eliminated. This is achieved by an investigation of the full (nonminimal) Bencze-Redish kernel. It is shown that the second power of this operator is connected, a result which is needed for the full applicability of the Bencze-Redish formalism. This is used to establish the relationship between the existence of solutions to the homogeneous form of the minimal equations and eigenvalues of the full Bencze-Redish kernel

Le Chatelier's principle with multiple relaxation channels

Science.gov (United States)

Gilmore, R.; Levine, R. D.

1986-05-01

Le Chatelier's principle is discussed within the constrained variational approach to thermodynamics. The formulation is general enough to encompass systems not in thermal (or chemical) equilibrium. Particular attention is given to systems with multiple constraints which can be relaxed. The moderation of the initial perturbation increases as additional constraints are removed. This result is studied in particular when the (coupled) relaxation channels have widely different time scales. A series of inequalities is derived which describes the successive moderation as each successive relaxation channel opens up. These inequalities are interpreted within the metric-geometry representation of thermodynamics.

Voltage-gated sodium channels as targets for pyrethroid insecticides.

Science.gov (United States)

Field, Linda M; Emyr Davies, T G; O'Reilly, Andrias O; Williamson, Martin S; Wallace, B A

2017-10-01

The pyrethroid insecticides are a very successful group of compounds that have been used extensively for the control of arthropod pests of agricultural crops and vectors of animal and human disease. Unfortunately, this has led to the development of resistance to the compounds in many species. The mode of action of pyrethroids is known to be via interactions with the voltage-gated sodium channel. Understanding how binding to the channel is affected by amino acid substitutions that give rise to resistance has helped to elucidate the mode of action of the compounds and the molecular basis of their selectivity for insects vs mammals and between insects and other arthropods. Modelling of the channel/pyrethroid interactions, coupled with the ability to express mutant channels in oocytes and study function, has led to knowledge of both how the channels function and potentially how to design novel insecticides with greater species selectivity.

Aberration compensation of an ultrasound imaging instrument with a reduced number of channels.

Science.gov (United States)

Jiang, Wei; Astheimer, Jeffrey P; Waag, Robert C

2012-10-01

Focusing and imaging qualities of an ultrasound imaging system that uses aberration correction were experimentally investigated as functions of the number of parallel channels. Front-end electronics that consolidate signals from multiple physical elements can be used to lower hardware and computational costs by reducing the number of parallel channels. However, the signals from sparse arrays of synthetic elements yield poorer aberration estimates. In this study, aberration estimates derived from synthetic arrays of varying element sizes are evaluated by comparing compensated receive focuses, compensated transmit focuses, and compensated b-scan images of a point target and a cyst phantom. An array of 80 x 80 physical elements with a pitch of 0.6 x 0.6 mm was used for all of the experiments and the aberration was produced by a phantom selected to mimic propagation through abdominal wall. The results show that aberration correction derived from synthetic arrays with pitches that have a diagonal length smaller than 70% of the correlation length of the aberration yield focuses and images of approximately the same quality. This connection between correlation length of the aberration and synthetic element size provides a guideline for determining the number of parallel channels that are required when designing imaging systems that employ aberration correction.

Coupled neutronics/thermal-hydraulics for analysis of molten salt reactor

International Nuclear Information System (INIS)

Guo, Zhangpeng; Zhou, Jianjun; Zhang, Dalin; Chaudri, Khurrum Saleem; Tian, Wenxi; Su, Guanghui; Qiu, Suizheng

2013-01-01

Highlights: ► A multiple-channel analysis code (MAC) is developed to be coupled with MCNP. ► 1/8 of core is simulated in MCNP and thermal-hydraulic code. ► The coupling calculation can achieve stable state after a few iterations. ► The coupling calculation results are in reasonable agreement with the analytic solutions of the ORNL. ► Parametric studies of MSR are performed to provide valuable information for future design MSR. -- Abstract: The Generation IV International Forum (GIF) selected molten salt reactor (MSR) among six advanced reactor types. It is characterized by a liquid circulating fuel that also serves as coolant. In this study, a multiple-channel analysis code (MAC) is developed and it is coupled with MCNP4c to analyze the neutronics/thermal-hydraulics behavior of molten salt reactor experiment (MSRE). The MAC calculates thermal-hydraulic parameters, such as temperature distribution, flow distribution and pressure drop. MCNP4c performs the analysis of effective multiplication factor, neutron flux and power distribution. A linkage code is developed to exchange data between MAC and MCNP to implement coupling iteration process until the power convergence is achieved. The coupling calculation can achieve converged solution after a few iterations. The results are in reasonable agreement with the analytic solutions from the ORNL. For further design analysis, parametric studies are performed to provide valuable information for new design of MSR. The effect of inlet temperature, graphite to molten salt volume ratio (G/Ms) from varying channel diameter and different power levels on the effective multiplication factor, neutron flux, graphite lifetime and temperature distribution are discussed in detail

40 CFR 425.06 - Monitoring requirements.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Monitoring requirements. 425.06 Section 425.06 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS LEATHER TANNING AND FINISHING POINT SOURCE CATEGORY General Provisions § 425.06...

The cooperative voltage sensor motion that gates a potassium channel.

Science.gov (United States)

Pathak, Medha; Kurtz, Lisa; Tombola, Francesco; Isacoff, Ehud

2005-01-01

The four arginine-rich S4 helices of a voltage-gated channel move outward through the membrane in response to depolarization, opening and closing gates to generate a transient ionic current. Coupling of voltage sensing to gating was originally thought to operate with the S4s moving independently from an inward/resting to an outward/activated conformation, so that when all four S4s are activated, the gates are driven to open or closed. However, S4 has also been found to influence the cooperative opening step (Smith-Maxwell et al., 1998a), suggesting a more complex mechanism of coupling. Using fluorescence to monitor structural rearrangements in a Shaker channel mutant, the ILT channel (Ledwell and Aldrich, 1999), that energetically isolates the steps of activation from the cooperative opening step, we find that opening is accompanied by a previously unknown and cooperative movement of S4. This gating motion of S4 appears to be coupled to the internal S6 gate and to two forms of slow inactivation. Our results suggest that S4 plays a direct role in gating. While large transmembrane rearrangements of S4 may be required to unlock the gating machinery, as proposed before, it appears to be the gating motion of S4 that drives the gates to open and close.

ON SCALAR MESONS FROM THE COMBINED ANALYSIS OF MULTI-CHANNEL pi pi SCATTERING AND J/psi DECAYS

Czech Academy of Sciences Publication Activity Database

Surovtsev, Yu .S.; Bydžovský, Petr; Gutsche, T.; Lyubovitskij, V. E.

2011-01-01

Roč. 26, 3-4 (2011), s. 610-612 ISSN 0217-751X. [11th International Workshop on Meson Production , Properties and Interaction. Krakow, 10.06.2010-15.06.2010] R&D Projects: GA ČR GA202/08/0984 Institutional research plan: CEZ:AV0Z10480505 Keywords : Multi-channel pion-pion scattering * scalar-isoscalar resonances * multichannel analysis Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.053, year: 2011

Coupled heat transfer in high temperature transporting system with semitransparent/opaque material

International Nuclear Information System (INIS)

Du Shenghua; Xia Xinjin

2010-01-01

The heat transfer model of the aerodynamic heating coupled with radiative cooling was developed. The thermal protect system includes the higher heat flux region with high temperature semitransparent material, the heat transporting channel and the lower heat flux region with metal. The control volume method was combined with the Monte Carlo method to calculate the coupled heat transfer of the transporting system, and the thermal equilibrium equation for the transporting channel was solved simultaneously. The effect of the aeroheating flux radio, the area ratio of radiative surfaces, the convective heat transfer coefficient of the heat transporting channel on the radiative surface temperature and the fluid temperature in the heat transporting channel were analyzed. The effect of radiation and conduction in the semitransparent material was discussed. The result shows that to increase the convective heat transfer coefficient in heat flux channel can enhance the heat transporting ability of the system, but the main parameter to effect on the temperature of the heat transporting system is the area ratio of radiative surfaces. (authors)

Voltage-Gated Potassium Channels: A Structural Examination of Selectivity and Gating

Science.gov (United States)

Kim, Dorothy M.; Nimigean, Crina M.

2016-01-01

Voltage-gated potassium channels play a fundamental role in the generation and propagation of the action potential. The discovery of these channels began with predictions made by early pioneers, and has culminated in their extensive functional and structural characterization by electrophysiological, spectroscopic, and crystallographic studies. With the aid of a variety of crystal structures of these channels, a highly detailed picture emerges of how the voltage-sensing domain reports changes in the membrane electric field and couples this to conformational changes in the activation gate. In addition, high-resolution structural and functional studies of K+ channel pores, such as KcsA and MthK, offer a comprehensive picture on how selectivity is achieved in K+ channels. Here, we illustrate the remarkable features of voltage-gated potassium channels and explain the mechanisms used by these machines with experimental data. PMID:27141052

Computational Tools for Interpreting Ion Channel pH-Dependence.

Science.gov (United States)

Sazanavets, Ivan; Warwicker, Jim

2015-01-01

Activity in many biological systems is mediated by pH, involving proton titratable groups with pKas in the relevant pH range. Experimental analysis of pH-dependence in proteins focusses on particular sidechains, often with mutagenesis of histidine, due to its pKa near to neutral pH. The key question for algorithms that predict pKas is whether they are sufficiently accurate to effectively narrow the search for molecular determinants of pH-dependence. Through analysis of inwardly rectifying potassium (Kir) channels and acid-sensing ion channels (ASICs), mutational effects on pH-dependence are probed, distinguishing between groups described as pH-coupled or pH-sensor. Whereas mutation can lead to a shift in transition pH between open and closed forms for either type of group, only for pH-sensor groups does mutation modulate the amplitude of the transition. It is shown that a hybrid Finite Difference Poisson-Boltzmann (FDPB) - Debye-Hückel continuum electrostatic model can filter mutation candidates, providing enrichment for key pH-coupled and pH-sensor residues in both ASICs and Kir channels, in comparison with application of FDPB alone.

Computational Tools for Interpreting Ion Channel pH-Dependence.

Directory of Open Access Journals (Sweden)

Ivan Sazanavets

Full Text Available Activity in many biological systems is mediated by pH, involving proton titratable groups with pKas in the relevant pH range. Experimental analysis of pH-dependence in proteins focusses on particular sidechains, often with mutagenesis of histidine, due to its pKa near to neutral pH. The key question for algorithms that predict pKas is whether they are sufficiently accurate to effectively narrow the search for molecular determinants of pH-dependence. Through analysis of inwardly rectifying potassium (Kir channels and acid-sensing ion channels (ASICs, mutational effects on pH-dependence are probed, distinguishing between groups described as pH-coupled or pH-sensor. Whereas mutation can lead to a shift in transition pH between open and closed forms for either type of group, only for pH-sensor groups does mutation modulate the amplitude of the transition. It is shown that a hybrid Finite Difference Poisson-Boltzmann (FDPB - Debye-Hückel continuum electrostatic model can filter mutation candidates, providing enrichment for key pH-coupled and pH-sensor residues in both ASICs and Kir channels, in comparison with application of FDPB alone.

Ultracompact multiway beam splitters using multiple coupled photonic crystal waveguides

International Nuclear Information System (INIS)

Yu Tianbao; Zhou Haifeng; Yang Jianyi; Jiang Xiaoqing; Wang Minghua; Gong Zhao

2008-01-01

Ultracompact 1 x N (N > 2) beam splitters based on coupling of multiple photonic crystal waveguides (PCWs) are numerically demonstrated. The operation of the devices is on the basis of the self-imaging phenomenon. Variation of the effective index of modified rods induces the transverse redistribution of the N-fold images with the same coupling length, and uniform or free splitting can be achieved. The devices with three and four output channels are discussed in details as examples. Results show that this kind of beam splitters are very short. At the operating wavelength of 1.55 μm, the splitting length of the devices is only 35 μm even if the output channel number reaches 20. It provides a new method and a compact model to export freely the beam to N channels in PCW devices and can find practical applications in future photonic integrated circuits

Ultracompact multiway beam splitters using multiple coupled photonic crystal waveguides

Energy Technology Data Exchange (ETDEWEB)

Yu Tianbao; Zhou Haifeng; Yang Jianyi; Jiang Xiaoqing; Wang Minghua [Department of Information Science and Electronic Engineering, Zhejiang University, 310027 Hangzhou (China); Gong Zhao [Zhejiang University City College, 310027 Hangzhou (China)

2008-05-07

Ultracompact 1 x N (N > 2) beam splitters based on coupling of multiple photonic crystal waveguides (PCWs) are numerically demonstrated. The operation of the devices is on the basis of the self-imaging phenomenon. Variation of the effective index of modified rods induces the transverse redistribution of the N-fold images with the same coupling length, and uniform or free splitting can be achieved. The devices with three and four output channels are discussed in details as examples. Results show that this kind of beam splitters are very short. At the operating wavelength of 1.55 {mu}m, the splitting length of the devices is only 35 {mu}m even if the output channel number reaches 20. It provides a new method and a compact model to export freely the beam to N channels in PCW devices and can find practical applications in future photonic integrated circuits.

Intermediate vector bosons in the muon channel

International Nuclear Information System (INIS)

Smith, D.A.

1989-12-01

Description of the W ± and Z 0 mass measurement in the muon decay channel, using 4.4 pb -1 of proton-antiproton collision data from the Fermilab Tevatron and CDF. A preliminary result of M w = 79.9 ± 0.4 ± 0.6 GeV/c 2 is presented, and the published values of M z = 90.9 ± 0.3 ± 0.2 GeV/c 2 and Γ z = 3.8 ± 1.1 ± 1.0 GeV/c 2 are described. 8 refs., 5 figs., 6 tabs

A stability analysis of ventilated boiling channels

International Nuclear Information System (INIS)

Taleyarkhan, R.P.; Podowski, M.Z.; Lahey, R.T. Jr.

1986-01-01

A mathematical model has been developed for the linear stability analysis of a system of ventilated parallel boiling channels. This model accounts for subcooled boiling, an arbitrary heat flux distribution, distributed and local hydraulic losses, heated wall dynamics, slip flow, turbulent mixing and arbitrary flow paths for transverse ventilation. The digital computer program MAZDA-NF was written for numerical evaluation of the mathematical model. Comparison of MAZDA-NF results with those obtained form both a closed form analytical solution and experiment, showed good agreement. A parametric study revealed that such phenomena as subcooled boiling, the transverse coupling between channels (due to cross-flow and mixing) and power skewing can have a significant impact on predicted stability margins. An analysis of an advanced BWR fuel, of the ASEA-ATOM SVEA design, has indicated that transverse ventilation may considerably improve channel stability. (orig.)

Anomalous high photoconductivity in short channel indium-zinc-oxide photo-transistors

International Nuclear Information System (INIS)

Choi, Hyun-Sik; Jeon, Sanghun

2015-01-01

Upon light exposure, an indium-zinc-oxide (IZO) thin-film transistor (TFT) presents higher photoconductivity by several orders of magnitude at the negative gate bias region. Among various device geometrical factors, scaling down the channel length of the photo-transistor results in an anomalous increase in photoconductivity. To probe the origin of this high photoconductivity in short-channel device, we measured transient current, current–voltage, and capacitance–voltage characteristics of IZO–TFTs with various channel lengths and widths before and after illumination. Under the illumination, the equilibrium potential region which lies far from front interface exists only in short-channel devices, forming the un-depleted conducting back channel. This region plays an important role in carrier transport under the illumination, leading to high photoconductivity in short-channel devices. Photon exposure coupled with gate-modulated band bending for short-channel devices leads to the accumulation of V o ++ at the front channel and screening negative gate bias, thereby generating high current flow in the un-depleted back-channel region

A dispersive optical model potential for nucleon induced reactions on 238U and 232Th nuclei with full coupling

Directory of Open Access Journals (Sweden)

Chiba Satoshi

2013-03-01

Full Text Available A dispersive coupled-channel optical model potential (DCCOMP that couples the ground-state rotational and low-lying vibrational bands of 238U and 232Th nuclei is studied. The derived DCCOMP couples almost all excited levels below 1 MeV of excitation energy of the corresponding even-even actinides. The ground state, octupole, beta, gamma, and non-axial bands are coupled. The first two isobar analogue states (IAS populated in the quasi-elastic (p,n reaction are also coupled in the proton induced calculation, making the potential approximately Lane consistent. The coupled-channel potential is based on a soft-rotor description of the target nucleus structure, where dynamic vibrations are considered as perturbations of the rigid rotor underlying structure. Matrix elements required to use the proposed structure model in Tamura coupled-channel scheme are derived. Calculated ratio R(U238/Th232 of the total cross-section difference to the averaged σT for 238U and 232Th nuclei is shown to be in excellent agreement with measured data.

A numerical model for meltwater channel evolution in glaciers

Directory of Open Access Journals (Sweden)

A. H. Jarosch

2012-04-01

Full Text Available Meltwater channels form an integral part of the hydrological system of a glacier. Better understanding of how meltwater channels develop and evolve is required to fully comprehend supraglacial and englacial meltwater drainage. Incision of supraglacial stream channels and subsequent roof closure by ice deformation has been proposed in recent literature as a possible englacial conduit formation process. Field evidence for supraglacial stream incision has been found in Svalbard and Nepal. In Iceland, where volcanic activity provides meltwater with temperatures above 0 °C, rapid enlargement of supraglacial channels has been observed. Supraglacial channels provide meltwater through englacial passages to the subglacial hydrological systems of big ice sheets, which in turn affects ice sheet motion and their contribution to eustatic sea level change. By coupling, for the first time, a numerical ice dynamic model to a hydraulic model which includes heat transfer, we investigate the evolution of meltwater channels and their incision behaviour. We present results for different, constant meltwater fluxes, different channel slopes, different meltwater temperatures, different melt rate distributions in the channel as well as temporal variations in meltwater flux. The key parameters governing incision rate and depth are channel slope, meltwater temperature loss to the ice and meltwater flux. Channel width and geometry are controlled by melt rate distribution along the channel wall. Calculated Nusselt numbers suggest that turbulent mixing is the main heat transfer mechanism in the meltwater channels studied.

The Inductive Coupling of the Magnets in MICE and its Effect on Quench Protection

International Nuclear Information System (INIS)

Green, Michael A.; Witte, Holger

2005-01-01

The inductive coupling between various MICE magnet circuits is described. The consequences of this coupling on magnet charging and quenching are discussed. Magnet quench protection is achieved through the use of quench-back. Calculations of the quenching of a magnet due to quench-back resulting from circulating currents induced in the magnet mandrel due to quenching of an adjacent magnet are discussed. This report describes how the MICE magnet channel will react when magnets in that channel are quenched

Dual Channel Pulse Coupled Neural Network Algorithm for Fusion of Multimodality Brain Images with Quality Analysis

Directory of Open Access Journals (Sweden)

Kavitha SRINIVASAN

2014-09-01

Full Text Available Background: In the review of medical imaging techniques, an important fact that emerged is that radiologists and physicians still are in a need of high-resolution medical images with complementary information from different modalities to ensure efficient analysis. This requirement should have been sorted out using fusion techniques with the fused image being used in image-guided surgery, image-guided radiotherapy and non-invasive diagnosis. Aim: This paper focuses on Dual Channel Pulse Coupled Neural Network (PCNN Algorithm for fusion of multimodality brain images and the fused image is further analyzed using subjective (human perception and objective (statistical measures for the quality analysis. Material and Methods: The modalities used in fusion are CT, MRI with subtypes T1/T2/PD/GAD, PET and SPECT, since the information from each modality is complementary to one another. The objective measures selected for evaluation of fused image were: Information Entropy (IE - image quality, Mutual Information (MI – deviation in fused to the source images and Signal to Noise Ratio (SNR – noise level, for analysis. Eight sets of brain images with different modalities (T2 with T1, T2 with CT, PD with T2, PD with GAD, T2 with GAD, T2 with SPECT-Tc, T2 with SPECT-Ti, T2 with PET are chosen for experimental purpose and the proposed technique is compared with existing fusion methods such as the Average method, the Contrast pyramid, the Shift Invariant Discrete Wavelet Transform (SIDWT with Harr and the Morphological pyramid, using the selected measures to ascertain relative performance. Results: The IE value and SNR value of the fused image derived from dual channel PCNN is higher than other fusion methods, shows that the quality is better with less noise. Conclusion: The fused image resulting from the proposed method retains the contrast, shape and texture as in source images without false information or information loss.

Partial wave analysis of the reaction πN→Nππ and coupled channel analyses of the reactions πN in the CM energy range 1.38-1.74GeV

International Nuclear Information System (INIS)

Dolbeau, Jean.

1976-01-01

The partial wave analysis of 91314 π + -p→Nππ events at nine CM energies between 1.38 and 1.74GeV was performed using the generalized isobar model and assuming the coherent production of Δ, rho and sigma in the final state. A coupled channel analysis (K-matrix formalism) led to the determination of the arbitrary phase at each energy and to smooth the partial wave amplitudes. The paramaters (mass, total and partial widths, signs of coupling constants) of sixteen resonances, among which two new ones, are determined by two different methods. Those results help in classifying the lower-mass excited states of the nucleon in the frame of unitary symmetries, as SU6 [fr

Electron collisions with phenol: Total, integral, differential, and momentum transfer cross sections and the role of multichannel coupling effects on the elastic channel

Energy Technology Data Exchange (ETDEWEB)

Costa, Romarly F. da [Instituto de Física “Gleb Wataghin,” Universidade Estadual de Campinas, 13083-859 Campinas, São Paulo (Brazil); Centro de Ciências Naturais e Humanas, Universidade Federal do ABC, 09210-580 Santo André, São Paulo (Brazil); Oliveira, Eliane M. de; Lima, Marco A. P. [Instituto de Física “Gleb Wataghin,” Universidade Estadual de Campinas, 13083-859 Campinas, São Paulo (Brazil); Bettega, Márcio H. F. [Departamento de Física, Universidade Federal do Paraná, CP 19044, 81531-990 Curitiba, Paraná (Brazil); Varella, Márcio T. do N. [Instituto de Física, Universidade de São Paulo, CP 66318, 05315-970 São Paulo, São Paulo (Brazil); Jones, Darryl B. [School of Chemical and Physical Sciences, Flinders University, GPO Box 2100, Adelaide SA 5001 (Australia); Brunger, Michael J. [School of Chemical and Physical Sciences, Flinders University, GPO Box 2100, Adelaide SA 5001 (Australia); Institute of Mathematical Sciences, University of Malaya, 50603 Kuala Lumpur (Malaysia); Blanco, Francisco [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad Complutense de Madrid, Ciudad Universitaria, 2840 Madrid (Spain); Colmenares, Rafael [Hospital Ramón y Cajal, 28034 Madrid (Spain); and others

2015-03-14

We report theoretical and experimental total cross sections for electron scattering by phenol (C{sub 6}H{sub 5}OH). The experimental data were obtained with an apparatus based in Madrid and the calculated cross sections with two different methodologies, the independent atom method with screening corrected additivity rule (IAM-SCAR), and the Schwinger multichannel method with pseudopotentials (SMCPP). The SMCPP method in the N{sub open}-channel coupling scheme, at the static-exchange-plus-polarization approximation, is employed to calculate the scattering amplitudes at impact energies ranging from 5.0 eV to 50 eV. We discuss the multichannel coupling effects in the calculated cross sections, in particular how the number of excited states included in the open-channel space impacts upon the convergence of the elastic cross sections at higher collision energies. The IAM-SCAR approach was also used to obtain the elastic differential cross sections (DCSs) and for correcting the experimental total cross sections for the so-called forward angle scattering effect. We found a very good agreement between our SMCPP theoretical differential, integral, and momentum transfer cross sections and experimental data for benzene (a molecule differing from phenol by replacing a hydrogen atom in benzene with a hydroxyl group). Although some discrepancies were found for lower energies, the agreement between the SMCPP data and the DCSs obtained with the IAM-SCAR method improves, as expected, as the impact energy increases. We also have a good agreement among the present SMCPP calculated total cross section (which includes elastic, 32 inelastic electronic excitation processes and ionization contributions, the latter estimated with the binary-encounter-Bethe model), the IAM-SCAR total cross section, and the experimental data when the latter is corrected for the forward angle scattering effect [Fuss et al., Phys. Rev. A 88, 042702 (2013)].

Early Career Investigator Opportunities in Geophysics with IRIS

Science.gov (United States)

Colella, H.; Sumy, D. F.; Schutt, D.

2016-12-01

Early career geoscientists face many challenges as they transition from senior level graduate students into postdoctoral researchers, tenure-track faculty positions, or the vast array of employment opportunities outside of academia. However, few receive adequate mentoring or guidance on how to successfully make the leap from graduate school to a fulfilling career. In recognition of these hurdles and challenges, the Incorporated Research Institutions for Seismology (IRIS) created an early-career investigator (ECI) program in 2011 to help reduce barriers for newly minted scientists, researchers, and educators on their path to success. The core mission of the ECI program is to organize practical resources and professional development opportunities for ECIs. The initiative has encouraged and supported collaboration between ECIs and senior scientists through colloquium lectureships and visiting scientist collaborations, which aimed to increase the visibility of ECIs and their research and to promote interaction between junior and senior scientists outside of their home institutions. Additionally, ECI-centric events are held at various national meetings to showcase the range of career paths available in geophysics, openly discuss the challenges ECIs face (e.g., work-life balance, job search difficulties, teaching challenges), expose participants to the ECI program's initiatives and resources, and better inform IRIS about the needs of the community. Post-workshop evaluations reveal ECIs are eager to have exposure to a variety of workforce options and a forum in which to ask difficult questions. Of note, there is a variety of cultural knowledge and expectations assumed in both the academic and professional worlds that is often not formally disseminated. The ECI program aims to better understand and facilitate transfer of this knowledge and reduce barriers to success for ECIs from both traditional and non-traditional backgrounds. The program also features webinars focused

Colloid-colloid hydrodynamic interaction around a bend in a quasi-one-dimensional channel.

Science.gov (United States)

Liepold, Christopher; Zarcone, Ryan; Heumann, Tibor; Rice, Stuart A; Lin, Binhua

2017-07-01

We report a study of how a bend in a quasi-one-dimensional (q1D) channel containing a colloid suspension at equilibrium that exhibits single-file particle motion affects the hydrodynamic coupling between colloid particles. We observe both structural and dynamical responses as the bend angle becomes more acute. The structural response is an increasing depletion of particles in the vicinity of the bend and an increase in the nearest-neighbor separation in the pair correlation function for particles on opposite sides of the bend. The dynamical response monitored by the change in the self-diffusion [D_{11}(x)] and coupling [D_{12}(x)] terms of the pair diffusion tensor reveals that the pair separation dependence of D_{12} mimics that of the pair correlation function just as in a straight q1D channel. We show that the observed behavior is a consequence of the boundary conditions imposed on the q1D channel: both the single-file motion and the hydrodynamic flow must follow the channel around the bend.

17 CFR 8.06 - Investigations.

Science.gov (United States)

2010-04-01

....06 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.06 Investigations. (a) Each exchange shall establish and maintain a disciplinary procedure which requires the enforcement staff of the...

Coupled-channel calculation for cross section of fusion and barrier distribution of {}^{16,17,18}O + {}^{16}O reactions

Science.gov (United States)

Fereidonnejad, R.; Sadeghi, H.; Ghambari, M.

2018-03-01

In this work, the effect of multi-phonon excitation on heavy-ion fusion reactions has been studied and fusion barrier distributions of energy intervals near and below the Coulomb barrier have been studied for 16,17,18O + 16O reactions. The structure and deformation of nuclear projectiles have been studied. Given the adaptation of computations to experimental data, our calculations predict the behavior of reactions in intervals of energy in which experimental measurements are not available. In addition the S-factor for these reactions has been calculated. The results showed that the structure and deformation of a nuclear projectile are important factors. The S-factor, obtained in the coupled-channel calculations for the {}^{16}O + {}^{16}O, {}^{17}O +{}^{16}O and {}^{18}O +{}^{16}O reactions, showed good agreement with the experimental data and had a maximum value at an energy near 5, 4.5 and 4 MeV, respectively.

Coupled-channel analysis of nucleon scattering from sup40Ca up to 80 MeV

International Nuclear Information System (INIS)

Honore, G.M.; Tornow, W.; Howell, C.R.; Pedroni, R.S.; Byrd, R.C.; Walter, R.L.; Delaroche, J.P.

1986-01-01

Differential cross sections sigma(theta) and analyzing powers A/sub y/(theta) for neutron scattering to the ground and first 3 - excited state of 40 Ca have been measured in the energy range from 11 to 17 MeV. Elastic and inelastic scattering measurements have been obtained for A/sub y/(theta) at energies of 11.0, 13.9, and 16.9 MeV, the inelastic scattering data representing the first (n,n') measurements of A/sub y/(theta) for this nucleus. Differential cross sections for (n,n) and (n,n') have been obtained at 13.9 and 16.9 MeV. Both the sigma(theta) and A/sub y/(theta) data at 13.9 MeV have been compared with previous measurements at this energy and the agreement is good, typically within less than 3%. These results have been combined with other sigma(theta) and A/sub y/(theta) data and total cross section sigma/sub T/ measurements to form a large set of scattering and reaction data for incident energies up to 80 MeV. This data set, along with sigma(theta) and A/sub y/(theta) measurements available for proton scattering in this energy range, has been described in the framework of the coupled-channel formalism. This highly constrained analysis has led to a precise determination of geometries, energy dependencies, and deformation parameters

Death by suicide and other externally caused injuries after stroke in Japan (1990-2010): the Japan Public Health Center-based prospective study.

Science.gov (United States)

Yamauchi, Takashi; Inagaki, Masatoshi; Yonemoto, Naohiro; Iwasaki, Motoki; Inoue, Manami; Akechi, Tatsuo; Iso, Hiroyasu; Tsugane, Shoichiro

2014-01-01

No large population-based prospective study has investigated the risks of suicide and death by other externally caused injuries (ECIs) among stroke patients. The purpose of this study was to examine whether stroke increases the risks of suicide and ECI deaths. We analyzed data from the Japan Public Health Center-based Prospective Study between 1990 and 2010. Poisson regression models were used to calculate adjusted risk ratios (RR) for suicide and ECI deaths. To adjust for unmeasured confounders, case-crossover analyses of all stroke patients who died by suicide and ECIs were also performed. A population-based cohort of 93,027 Japanese residents was established. During the follow-up period, 4793 residents had been diagnosed as having stroke. During this period, there were 22 suicides and 53 ECI deaths among stroke patients and 490 suicides and 675 ECI deaths among those who were stroke-free. Stroke patients were at increased risk for death by suicide and ECIs within the first 5 years after a stroke (suicide: RR = 10.2, 95% confidence interval [CI] = 6.3-16.6; ECI: RR = 12.8, 95% confidence interval = 9.0-18.2). Furthermore, case-crossover analyses confirmed the results of the Poisson regression models. The RRs of suicide and ECI deaths within the first 5 years after a stroke were noticeably high. These findings underscore the need for clinicians and health care professionals to be aware of causes of death after a stroke and closely monitor patients during the first few poststroke years.

Spin-spin interaction between polarized neutrons and polarized 27Al, 59Co, and 93Nb from dispersive optical model and coupled-channel analyses

International Nuclear Information System (INIS)

Nagadi, M.M.; Weisel, G.J.; Walter, R.L.; Delaroche, J.P.; Romain, P.

2004-01-01

Coupled-channel and dispersive-optical model analyses of published neutron scattering and reaction data for 27 Al, 59 Co, and 93 Nb at incident energies between 0.1 and 80 MeV have been performed. The resulting potentials are used to place constraints on the determination of the spin-spin interaction from published spin-spin cross-section measurements. For the three nuclei, the strength of the central real spin-spin potential, which was taken to have a surface plus volume shape, was found to be small. Volume integrals for this central potential component were determined to be in the 4-7 MeV fm 3 range and to decrease somewhat as mass number increases

Long quantum channels for high-quality entanglement transfer

International Nuclear Information System (INIS)

Banchi, L; Apollaro, T J G; Cuccoli, A; Verrucchi, P; Vaia, R

2011-01-01

High-quality quantum-state and entanglement transfer can be achieved in an unmodulated spin bus operating in the ballistic regime, which occurs when the endpoint qubits A and B are nonperturbatively coupled to the chain by a suitable exchange interaction j 0 . Indeed, the transition amplitude characterizing the transfer quality exhibits a maximum for a finite optimal value j opt 0 (N), where N is the channel length. We show that j opt 0 (N) scales as N -1/6 for large N and that it ensures a high-quality entanglement transfer even in the limit of arbitrarily long channels, almost independently of the channel initialization. For instance, for any chain length the average quantum-state transmission fidelity exceeds 90% and decreases very little in a broad neighbourhood of j opt 0 (N). We emphasize that, taking the reverse point of view, should j 0 be experimentally constrained, high-quality transfer can still be obtained by adjusting the channel length to its optimal value. (paper)

Iterative Sparse Channel Estimation and Decoding for Underwater MIMO-OFDM

Directory of Open Access Journals (Sweden)

Berger ChristianR

2010-01-01

Full Text Available We propose a block-by-block iterative receiver for underwater MIMO-OFDM that couples channel estimation with multiple-input multiple-output (MIMO detection and low-density parity-check (LDPC channel decoding. In particular, the channel estimator is based on a compressive sensing technique to exploit the channel sparsity, the MIMO detector consists of a hybrid use of successive interference cancellation and soft minimum mean-square error (MMSE equalization, and channel coding uses nonbinary LDPC codes. Various feedback strategies from the channel decoder to the channel estimator are studied, including full feedback of hard or soft symbol decisions, as well as their threshold-controlled versions. We study the receiver performance using numerical simulation and experimental data collected from the RACE08 and SPACE08 experiments. We find that iterative receiver processing including sparse channel estimation leads to impressive performance gains. These gains are more pronounced when the number of available pilots to estimate the channel is decreased, for example, when a fixed number of pilots is split between an increasing number of parallel data streams in MIMO transmission. For the various feedback strategies for iterative channel estimation, we observe that soft decision feedback slightly outperforms hard decision feedback.

Switchable coupling for superconducting qubits using double resonance in the presence of crosstalk

International Nuclear Information System (INIS)

Ashhab, S.; Nori, Franco

2007-01-01

Several methods have been proposed recently to achieve switchable coupling between superconducting qubits. We discuss some of the main considerations regarding the feasibility of implementing one of those proposals: The double-resonance method. We analyze mainly issues related to the achievable effective coupling strength and the effects of crosstalk on this coupling mechanism. We also find a crosstalk-assisted coupling channel that can be an attractive alternative when implementing the double-resonance coupling proposal

Effects of breakup couplings on 8B + 58 Ni elastic scattering

International Nuclear Information System (INIS)

Lubian, J.; Correa, T.; Gomes, P.R.S.; Canto, L.F.; Aguilera, E.F.; Gomez-Camacho, A.; Quiroz, E.M.

2009-01-01

Full text: Nuclear reactions involving weakly bound nuclei have been extensively investigated over the last years. Because of the low breakup threshold, collisions of weakly bound systems have large breakup cross sections. Nuclear reactions induced by 8 B projectiles have attracted particular interest, because the Coulomb dissociation of this nucleus leads to important information for understanding solar neutrino emission. Because the breakup process involves unbound states of the projectile's fragments is necessary to approximate the continuum by a finite number of channels. This is achieved by continuum discretized coupled channel (CDCC) method. Recently, new data have become available for the 8 B + 58 Ni system. Aguilera et al measured elastic angular distributions at several collisions energies, in the barrier region. In the present work, we perform a theoretical study of the effect of the breakup channel on the elastic angular distributions for the 8 B + 58 Ni system, using the CDCC method. The result of our calculations were in excellent agreement with the experimental results. We have also investigated the effects of inelastic excitations and of continuum-continuum couplings on the angular distributions. We found that inelastic excitations do not have an appreciable influence while continuum- continuum couplings are of utmost importance. We have shown that the multipole expansion of the coupling interaction is dominated by monopole, dipole, and quadrupole terms. Higher multipoles can be neglected. (author)

Structure of Voltage-gated Two-pore Channel TPC1 from Arabidopsis thaliana

Science.gov (United States)

Guo, Jiangtao; Zeng, Weizhong; Chen, Qingfeng; Lee, Changkeun; Chen, Liping; Yang, Yi; Cang, Chunlei; Ren, Dejian; Jiang, Youxing

2015-01-01

Two-pore channels (TPCs) contain two copies of a Shaker-like six-transmembrane (6-TM) domain in each subunit and are ubiquitously expressed in both animals and plants as organellar cation channels. Here, we present the first crystal structure of a vacuolar two-pore channel from Arabidopsis thaliana, AtTPC1, which functions as a homodimer. AtTPC1 activation requires both voltage and cytosolic Ca2+. Ca2+ binding to the cytosolic EF-hand domain triggers conformational changes coupled to the pair of pore-lining inner helices (IS6 helices) from the first 6-TM domains, whereas membrane potential only activates the second voltage-sensing domain (VSD2) whose conformational changes are coupled to the pair of inner helices (IIS6 helices) from the second 6-TM domains. Luminal Ca2+ or Ba2+ can modulate voltage activation by stabilizing VSD2 in the resting state and shifts voltage activation towards more positive potentials. Our Ba2+ bound AtTPC1 structure reveals a voltage sensor in the resting state, providing hitherto unseen structural insight into the general voltage-gating mechanism among voltage-gated channels. PMID:26689363

40 CFR 256.06 - Definitions.

Science.gov (United States)

2010-07-01

... AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions... public (including interstate) solid or hazardous waste management authority, or other public agency below... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 256.06 Section 256.06...

Fast Fiber-Coupled Imaging Devices

Energy Technology Data Exchange (ETDEWEB)

Brockington, Samuel; Case, Andrew; Witherspoon, Franklin

2018-04-22

HyperV Technologies Corp. has successfully designed, built and experimentally demonstrated a full scale 1024 pixel 100 MegaFrames/s fiber coupled camera with 12 or 14 bits, and record lengths of 32K frames, exceeding our original performance objectives. This high-pixel-count, fiber optically-coupled, imaging diagnostic can be used for investigating fast, bright plasma events. In Phase 1 of this effort, a 100 pixel fiber-coupled fast streak camera for imaging plasma jet profiles was constructed and successfully demonstrated. The resulting response from outside plasma physics researchers emphasized development of increased pixel performance as a higher priority over increasing pixel count. In this Phase 2 effort, HyperV therefore focused on increasing the sample rate and bit-depth of the photodiode pixel designed in Phase 1, while still maintaining a long record length and holding the cost per channel to levels which allowed up to 1024 pixels to be constructed. Cost per channel was $53.31, very close to our original target of $50 per channel. The system consists of an imaging "camera head" coupled to a photodiode bank with an array of optical fibers. The output of these fast photodiodes is then digitized at 100 Megaframes per second and stored in record lengths of 32,768 samples with bit depths of 12 to 14 bits per pixel. Longer record lengths are possible with additional memory. A prototype imaging system with up to 1024 pixels was designed and constructed and used to successfully take movies of very fast moving plasma jets as a demonstration of the camera performance capabilities. Some faulty electrical components on the 64 circuit boards resulted in only 1008 functional channels out of 1024 on this first generation prototype system. We experimentally observed backlit high speed fan blades in initial camera testing and then followed that with full movies and streak images of free flowing high speed plasma jets (at 30-50 km/s). Jet structure and jet collisions onto

On conduction in a bacterial sodium channel.

Directory of Open Access Journals (Sweden)

Simone Furini

Full Text Available Voltage-gated Na⁺-channels are transmembrane proteins that are responsible for the fast depolarizing phase of the action potential in nerve and muscular cells. Selective permeability of Na⁺ over Ca²⁺ or K⁺ ions is essential for the biological function of Na⁺-channels. After the emergence of the first high-resolution structure of a Na⁺-channel, an anionic coordination site was proposed to confer Na⁺ selectivity through partial dehydration of Na⁺ via its direct interaction with conserved glutamate side chains. By combining molecular dynamics simulations and free-energy calculations, a low-energy permeation pathway for Na⁺ ion translocation through the selectivity filter of the recently determined crystal structure of a prokaryotic sodium channel from Arcobacter butzleri is characterised. The picture that emerges is that of a pore preferentially occupied by two ions, which can switch between different configurations by crossing low free-energy barriers. In contrast to K⁺-channels, the movements of the ions appear to be weakly coupled in Na⁺-channels. When the free-energy maps for Na⁺ and K⁺ ions are compared, a selective site is characterised in the narrowest region of the filter, where a hydrated Na⁺ ion, and not a hydrated K⁺ ion, is energetically stable.

Galvanically Decoupled Current Source Modules for Multi-Channel Bioimpedance Measurement Systems

Directory of Open Access Journals (Sweden)

Roman Kusche

2017-10-01

Full Text Available Bioimpedance measurements have become a useful technique in the past several years in biomedical engineering. Especially, multi-channel measurements facilitate new imaging and patient monitoring techniques. While most instrumentation research has focused on signal acquisition and signal processing, this work proposes the design of an excitation current source module that can be easily implemented in existing or upcoming bioimpedance measurement systems. It is galvanically isolated to enable simultaneous multi-channel bioimpedance measurements with a very low channel-coupling. The system is based on a microcontroller in combination with a voltage-controlled current source circuit. It generates selectable sinusoidal excitation signals between 0.12 and 1.5 mA in a frequency range from 12 to 250 kHz, whereas the voltage compliance range is ±3.2 V. The coupling factor between two current sources, experimentally galvanically connected with each other, is measured to be less than −48 dB over the entire intended frequency range. Finally, suggestions for developments in the future are made.

Boundary vapor contentsin an annular channel

International Nuclear Information System (INIS)

Remizov, O.V.; Shurkin, N.G.; Podgornyj, K.K.; Gal'chenko, Eh.F.; Bukhteev, I.S.

1978-01-01

The work is aimed at the experimental investigation of the worsening of the heat transfer in an annular channel. The experiments have been carried out on the annular channel 32x28x3000 mm with the even distribution of the heat flux along the length at pressures of 6.9-19.6 MPa, flow rate of 350-1000 kg/m 2 s, and specific heat fluxes from 0.18 up to 0.6 MW/m 2 . Heating is external, oneside. Water monodistillate of the following composition has been used as a coolant: pH 9; dry residue - 0.8-1.2 mg/kg, oxygen -10-15 mg/kg. It is found out that the change character of the temperature field of the heating surface of the annular channel at the regime with the worsen of heat emission depends on the ratio of regime parameters. At pressures of 6.9-13.7 MPa and flow rate of 350-500 kg/m 2 s the channel wall temperature rises monotoneously, never reaching its maximum. With pressure rise > 13.7 MPa and mass velocity > 500 kg/m 2 s the temperature of the heat emitting surface reaches its maximum, and then slowly falls. At pressures of 6.9-11.8 MPa the boundary vapor content value within the whole range of mass velocities does not depend on the specific heat flux q. At pressures higher than 13.7 MPa and mass velocities of 350-1000 kg/m 2 s the boundary vapor content depends on q. The heating of the external or internal surface of the annular channel affects the value of the boundary vapor content within the whole range of regime parameters' change under investigation

Experimental evidence of independence of nuclear de-channeling length on the particle charge sign

Energy Technology Data Exchange (ETDEWEB)

Bagli, E.; Guidi, V.; Mazzolari, A.; Bandiera, L.; Germogli, G.; Sytov, A.I. [Universita di Ferrara, Dipartimento di Fisica e Scienze della Terra (Italy); INFN Sezione di Ferrara (Italy); De Salvador, D. [Universita di Padova, Dipartimento di Fisica e Astronomia, Padua (Italy); INFN Laboratori Nazionali di Legnaro (Italy); Berra, A.; Prest, M. [Universita dell' Insubria, Como (Italy); INFN Sezione di Milano Bicocca, Milan (Italy); Vallazza, E. [INFN Sezione di Trieste (Italy)

2017-02-15

Under coherent interactions, particles undergo correlated collisions with the crystal lattice and their motion result in confinement in the fields of atomic planes, i.e. particle channeling. Other than coherently interacting with the lattice, particles also suffer incoherent interactions with individual nuclei and may leave their bounded motion, i.e., they de-channel. The latter is the main limiting factor for applications of coherent interactions in crystal-assisted particle steering. We experimentally investigated the nature of de-channeling of 120 GeV/c e{sup -} and e{sup +} in a bent silicon crystal at H4-SPS external line at CERN. We found that while channeling efficiency differs significantly for e{sup -} (2 ± 2%) and e{sup +} (54 ± 2%), their nuclear de-channeling length is comparable, (0.6 ± 0.1) mm for e{sup -} and (0.7 ± 0.3) mm for e{sup +}. The experimental proof of the equality of the nuclear de-channeling length for positrons and electrons is interpreted in terms of similar dynamics undergone by the channeled particles in the field of nuclei irrespective of their charge. (orig.)

Stimulation of Slack K(+) Channels Alters Mass at the Plasma Membrane by Triggering Dissociation of a Phosphatase-Regulatory Complex.

Science.gov (United States)

Fleming, Matthew R; Brown, Maile R; Kronengold, Jack; Zhang, Yalan; Jenkins, David P; Barcia, Gulia; Nabbout, Rima; Bausch, Anne E; Ruth, Peter; Lukowski, Robert; Navaratnam, Dhasakumar S; Kaczmarek, Leonard K

2016-08-30

Human mutations in the cytoplasmic C-terminal domain of Slack sodium-activated potassium (KNa) channels result in childhood epilepsy with severe intellectual disability. Slack currents can be increased by pharmacological activators or by phosphorylation of a Slack C-terminal residue by protein kinase C. Using an optical biosensor assay, we find that Slack channel stimulation in neurons or transfected cells produces loss of mass near the plasma membrane. Slack mutants associated with intellectual disability fail to trigger any change in mass. The loss of mass results from the dissociation of the protein phosphatase 1 (PP1) targeting protein, Phactr-1, from the channel. Phactr1 dissociation is specific to wild-type Slack channels and is not observed when related potassium channels are stimulated. Our findings suggest that Slack channels are coupled to cytoplasmic signaling pathways and that dysregulation of this coupling may trigger the aberrant intellectual development associated with specific childhood epilepsies. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

Stimulation of Slack K+ channels alters mass at the plasma membrane by triggering dissociation of a phosphatase-regulatory complex

Science.gov (United States)

Fleming, Matthew R.; Brown, Maile R.; Kronengold, Jack; Zhang, Yalan; Jenkins, David P.; Barcia, Gulia; Nabbout, Rima; Bausch, Anne E.; Ruth, Peter; Lukowski, Robert; Navaratnam, Dhasakumar S.; Kaczmarek, Leonard K.

2016-01-01

Summary Human mutations in the cytoplasmic C-terminal domain of Slack sodium-activated potassium (KNa) channels result in childhood epilepsy with severe intellectual disability. Slack currents can be increased by pharmacological activators or by phosphorylation of a Slack C-terminal residue by protein kinase C. Using an optical biosensor assay, we find that Slack channel stimulation in neurons or transfected cells produces loss of mass near the plasma membrane. Slack mutants associated with intellectual disability fail to trigger any change in mass. The loss of mass results from the dissociation of the protein phosphatase 1 (PP1) targeting protein, Phactr-1, from the channel. Phactr1 dissociation is specific to wild-type Slack channels and is not observed when related potassium channels are stimulated. Our findings suggest that Slack channels are coupled to cytoplasmic signaling pathways, and that dysregulation of this coupling may trigger the aberrant intellectual development associated with specific childhood epilepsies. PMID:27545877

Stimulation of Slack K+ Channels Alters Mass at the Plasma Membrane by Triggering Dissociation of a Phosphatase-Regulatory Complex

Directory of Open Access Journals (Sweden)

Matthew R. Fleming

2016-08-01

Full Text Available Human mutations in the cytoplasmic C-terminal domain of Slack sodium-activated potassium (KNa channels result in childhood epilepsy with severe intellectual disability. Slack currents can be increased by pharmacological activators or by phosphorylation of a Slack C-terminal residue by protein kinase C. Using an optical biosensor assay, we find that Slack channel stimulation in neurons or transfected cells produces loss of mass near the plasma membrane. Slack mutants associated with intellectual disability fail to trigger any change in mass. The loss of mass results from the dissociation of the protein phosphatase 1 (PP1 targeting protein, Phactr-1, from the channel. Phactr1 dissociation is specific to wild-type Slack channels and is not observed when related potassium channels are stimulated. Our findings suggest that Slack channels are coupled to cytoplasmic signaling pathways and that dysregulation of this coupling may trigger the aberrant intellectual development associated with specific childhood epilepsies.

Angiotensin receptors and norepinephrine neuromodulation: implications of functional coupling.

Science.gov (United States)

Gelband, C H; Sumners, C; Lu, D; Raizada, M K

1998-02-27

The objective of this review is to examine the role of neuronal angiotensin II (Ang II) receptors in vitro. Two types of G protein-coupled Ang II receptors have been identified in cardiovascularly relevant areas of the brain: the AT1 and the AT2. We have utilized neurons in culture to study the signaling mechanisms of AT1 and AT2 receptors. Neuronal AT1 receptors are involved in norepinephrine (NE) neuromodulation. NE neuromodulation can be either evoked or enhanced. Evoked NE neuromodulation involves AT1 receptor-mediated, losartan-dependent, rapid NE release, inhibition of K+ channels and stimulation of Ca2+ channels. AT1 receptor-mediated enhanced NE neuromodulation involves the Ras-Raf-MAP kinase cascade and ultimately leads to an increase in NE transporter, tyrosine hydroxylase and dopamine beta-hydroxylase mRNA transcription. Neuronal AT2 receptors signal via a Gi protein and are coupled to activation of PP2A and PLA2 and stimulation of K+ channels. Finally, putative cross-talk pathways between AT1 and AT2 receptors will be discussed.

Probing the Higgs couplings to photons in h→4ℓ at the LHC.

Science.gov (United States)

Chen, Yi; Harnik, Roni; Vega-Morales, Roberto

2014-11-07

We explore the sensitivity of the Higgs decay to four leptons, the so-called golden channel, to higher dimensional loop-induced couplings of the Higgs boson to ZZ, Zγ, and γγ pairs, allowing for general CP mixtures. The larger standard model tree level coupling hZ(μ)Z(μ) is the dominant "background" for the loop-induced couplings. However, this large background interferes with the smaller loop-induced couplings, enhancing the sensitivity. We perform a maximum likelihood analysis based on analytic expressions of the fully differential decay width for h→4ℓ (4ℓ≡2e2μ,4e,4μ), including all interference effects. We find that the spectral shapes induced by Higgs couplings to photons are particularly different than the hZ(μ)Z(μ) background leading to enhanced sensitivity to these couplings. We show that even if the h→γγ and h→4ℓ rates agree with that predicted by the standard model, the golden channel has the potential to probe both the CP nature as well as the overall sign of the Higgs coupling to photons well before the end of a high-luminosity LHC.

The alpha channeling effect

Science.gov (United States)

Fisch, N. J.

2015-12-01

Alpha particles born through fusion reactions in a tokamak reactor tend to slow down on electrons, but that could take up to hundreds of milliseconds. Before that happens, the energy in these alpha particles can destabilize on collisionless timescales toroidal Alfven modes and other waves, in a way deleterious to energy confinement. However, it has been speculated that this energy might be instead be channeled into useful energy, so as to heat fuel ions or to drive current. Such a channeling needs to be catalyzed by waves Waves can produce diffusion in energy of the alpha particles in a way that is strictly coupled to diffusion in space. If these diffusion paths in energy-position space point from high energy in the center to low energy on the periphery, then alpha particles will be cooled while forced to the periphery. The energy from the alpha particles is absorbed by the wave. The amplified wave can then heat ions or drive current. This process or paradigm for extracting alpha particle energy collisionlessly has been called alpha channeling. While the effect is speculative, the upside potential for economical fusion is immense. The paradigm also operates more generally in other contexts of magnetically confined plasma.

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Türkiye’de Banka Kredileri Kanalının İşleyişi Üzerine Ampirik Bir Analiz = Empirical Analysis of the Bank Lending Channel in Turkey

Directory of Open Access Journals (Sweden)

Sinem Gözde BEŞBALLI

2010-01-01

Full Text Available The effect of a change in monetary policy on output operates through monetary transmission channels. The transmission channels of monetary policy may be gathered in five main titles: interest rates channel, asset prices channel, exchange rate channel, credit channel (bank lending channel, balance sheet channel and expectation channel. Findings obtained from the analysis of the transmission channels can be used in policy determination.This paper empirically analyzes the bank lending channel, one of the transmission mechanisms of monetary policy in Turkey. In this paper, data between 1996:06-2006:09 are examined using VAR methodology. According to the findings, the credit channel in Turkey operates partially.

Trilinear Higgs coupling determination via single-Higgs differential measurements at the LHC

Energy Technology Data Exchange (ETDEWEB)

Maltoni, Fabio; Shivaji, Ambresh; Zhao, Xiaoran [Universite Catholique de Louvain, Centre for Cosmology, Particle Physics and Phenomenology (CP3), Louvain-la-Neuve (Belgium); Pagani, Davide [Technische Universitaet Muenchen, Garching (Germany)

2017-12-15

We study one-loop effects induced by an anomalous Higgs trilinear coupling on total and differential rates for the H → 4l decay and some of the main single-Higgs production channels at the LHC, namely, VBF, VH, t anti tH and tHj. Our results are based on a public code that calculates these effects by simply reweighting samples of Standard-Model-like events for a given production channel. For VH and t anti tH production, where differential effects are particularly relevant, we include Standard Model electroweak corrections, which have similar sizes but different kinematic dependences. Finally, we study the sensitivity of future LHC runs to determine the trilinear coupling via inclusive and differential measurements, considering also the case where the Higgs couplings to vector bosons and the top quark is affected by new physics. We find that the constraints on the couplings and the relevance of differential distributions critically depend on the expected experimental and theoretical uncertainties. (orig.)

Trilinear Higgs coupling determination via single-Higgs differential measurements at the LHC

Science.gov (United States)

Maltoni, Fabio; Pagani, Davide; Shivaji, Ambresh; Zhao, Xiaoran

2017-12-01

We study one-loop effects induced by an anomalous Higgs trilinear coupling on total and differential rates for the H→ 4ℓ decay and some of the main single-Higgs production channels at the LHC, namely, VBF, VH, t{\\bar{t}}H and tHj. Our results are based on a public code that calculates these effects by simply reweighting samples of Standard-Model-like events for a given production channel. For VH and t{\\bar{t}}H production, where differential effects are particularly relevant, we include Standard Model electroweak corrections, which have similar sizes but different kinematic dependences. Finally, we study the sensitivity of future LHC runs to determine the trilinear coupling via inclusive and differential measurements, considering also the case where the Higgs couplings to vector bosons and the top quark is affected by new physics. We find that the constraints on the couplings and the relevance of differential distributions critically depend on the expected experimental and theoretical uncertainties.

Multi-channel grouping techniques for conducting reactor safety studies

International Nuclear Information System (INIS)

Waltar, A.E.; Wilburn, N.P.

1975-01-01

In conducting safety studies for postulated unprotected accidents in an LMFBR system, it is common practice to employ multi-channel coupled neutronics, thermal hydraulics computer programs such as SAS3A or MELT-III. The multichannel feature of such code systems is important if the natural fuel failure incoherencies and the resulting sodium void/fuel motion reactivity feedbacks--which have strong spatial variations--are to be properly modeled. Because of the large amounts of computer time associated with many channel runs, however, there is a strong incentive to conduct parametric studies with as few channels as possible. The paper presented is focused on methods successfully employed to accomplish this end for a study of the hypothetical unprotected transient overpower accident conducted for the FFTF

Optimizing the wireless power transfer over MIMO Channels

Science.gov (United States)

Wiedmann, Karsten; Weber, Tobias

2017-09-01

In this paper, the optimization of the power transfer over wireless channels having multiple-inputs and multiple-outputs (MIMO) is studied. Therefore, the transmitter, the receiver and the MIMO channel are modeled as multiports. The power transfer efficiency is described by a Rayleigh quotient, which is a function of the channel's scattering parameters and the incident waves from both transmitter and receiver side. This way, the power transfer efficiency can be maximized analytically by solving a generalized eigenvalue problem, which is deduced from the Rayleigh quotient. As a result, the maximum power transfer efficiency achievable over a given MIMO channel is obtained. This maximum can be used as a performance bound in order to benchmark wireless power transfer systems. Furthermore, the optimal operating point which achieves this maximum will be obtained. The optimal operating point will be described by the complex amplitudes of the optimal incident and reflected waves of the MIMO channel. This supports the design of the optimal transmitter and receiver multiports. The proposed method applies for arbitrary MIMO channels, taking transmitter-side and/or receiver-side cross-couplings in both near- and farfield scenarios into consideration. Special cases are briefly discussed in this paper in order to illustrate the method.

Optimizing the wireless power transfer over MIMO Channels

Directory of Open Access Journals (Sweden)

K. Wiedmann

2017-09-01

Full Text Available In this paper, the optimization of the power transfer over wireless channels having multiple-inputs and multiple-outputs (MIMO is studied. Therefore, the transmitter, the receiver and the MIMO channel are modeled as multiports. The power transfer efficiency is described by a Rayleigh quotient, which is a function of the channel's scattering parameters and the incident waves from both transmitter and receiver side. This way, the power transfer efficiency can be maximized analytically by solving a generalized eigenvalue problem, which is deduced from the Rayleigh quotient. As a result, the maximum power transfer efficiency achievable over a given MIMO channel is obtained. This maximum can be used as a performance bound in order to benchmark wireless power transfer systems. Furthermore, the optimal operating point which achieves this maximum will be obtained. The optimal operating point will be described by the complex amplitudes of the optimal incident and reflected waves of the MIMO channel. This supports the design of the optimal transmitter and receiver multiports. The proposed method applies for arbitrary MIMO channels, taking transmitter-side and/or receiver-side cross-couplings in both near- and farfield scenarios into consideration. Special cases are briefly discussed in this paper in order to illustrate the method.

Global synchronization criteria with channel time-delay for chaotic time-delay system

International Nuclear Information System (INIS)

Sun Jitao

2004-01-01

Based on the Lyapunov stabilization theory, matrix measure, and linear matrix inequality (LMIs), this paper studies the chaos synchronization of time-delay system using the unidirectional linear error feedback coupling with time-delay. Some generic conditions of chaos synchronization with time-delay in the transmission channel is established. The chaotic Chua's circuit is used for illustration, where the coupling parameters are determined according to the criteria under which the global chaos synchronization of the time-delay coupled systems is achieved

Death by suicide and other externally caused injuries following a cancer diagnosis: the Japan Public Health Center-based Prospective Study.

Science.gov (United States)

Yamauchi, Takashi; Inagaki, Masatoshi; Yonemoto, Naohiro; Iwasaki, Motoki; Inoue, Manami; Akechi, Tatsuo; Iso, Hiroyasu; Tsugane, Shoichiro

2014-09-01

There have been very few population-based prospective studies that have investigated the risks of deaths by suicide and other externally caused injuries (ECIs) among cancer patients in an Asian population. This study investigated whether the risk of death by both suicide and ECIs increases during the first year following the initial diagnosis of cancer. Data were analyzed from a population-based cohort of Japanese residents between 1990 and 2010, collected during the Japan Public Health Center-based Prospective Study. Poisson regression models were used to calculate adjusted risk ratios (RRs) for both suicide and ECI deaths. To adjust for unmeasured confounding factors, case-crossover analyses were conducted for all patients with cancer who died by suicide and ECIs. A population-based cohort of 102,843 Japanese residents was established. During the follow-up period, there were 34 suicides and 48 ECI deaths among patients with cancer, as compared with 527 suicides and 707 ECI deaths among those who did not have cancer. Analyses revealed that those who were newly diagnosed with cancer were at a greatly increased risk of death by suicide and ECIs within the first year after their diagnosis (suicide RR = 23.9, 95% CI: 13.8-41.6; ECI RR = 18.8, 95% CI: 11.4-31.0). Furthermore, the case-crossover analyses generally confirmed the results of the Poisson regressions. The risks of suicide and ECI deaths within the first year after a cancer diagnosis were higher than those among cancer-free populations. A diagnosis of cancer is a critical experience that may increase the risk of fatal outcomes. Copyright © 2014 John Wiley & Sons, Ltd.

Selectivity and evolutionary divergence of metabotropic glutamate receptors for endogenous ligands and G proteins coupled to phospholipase C or TRP channels.

Science.gov (United States)

Kang, Hye Jin; Menlove, Kit; Ma, Jianpeng; Wilkins, Angela; Lichtarge, Olivier; Wensel, Theodore G

2014-10-24

To define the upstream and downstream signaling specificities of metabotropic glutamate receptors (mGluR), we have examined the ability of representative mGluR of group I, II, and III to be activated by endogenous amino acids and catalyze activation of G proteins coupled to phospholipase C (PLC), or activation of G(i/o) proteins coupled to the ion channel TRPC4β. Fluorescence-based assays have allowed us to observe interactions not previously reported or clearly identified. We have found that the specificity for endogenous amino acids is remarkably stringent. Even at millimolar levels, structurally similar compounds do not elicit significant activation. As reported previously, the clear exception is L-serine-O-phosphate (L-SOP), which strongly activates group III mGluR, especially mGluR4,-6,-8 but not group I or II mGluR. Whereas L-SOP cannot activate mGluR1 or mGluR2, it acts as a weak antagonist for mGluR1 and a potent antagonist for mGluR2, suggesting that co-recognition of L-glutamate and L-SOP arose early in evolution, and was followed later by divergence of group I and group II mGluR versus group III in l-SOP responses. mGluR7 has low affinity and efficacy for activation by both L-glutamate and L-SOP. Molecular docking studies suggested that residue 74 corresponding to lysine in mGluR4 and asparagine in mGluR7 might play a key role, and, indeed, mutagenesis experiments demonstrated that mutating this residue to lysine in mGluR7 enhances the potency of L-SOP. Experiments with pertussis toxin and dominant-negative Gα(i/o) proteins revealed that mGluR1 couples strongly to TRPC4β through Gα(i/o), in addition to coupling to PLC through Gα(q/11). © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

Selectivity and Evolutionary Divergence of Metabotropic Glutamate Receptors for Endogenous Ligands and G Proteins Coupled to Phospholipase C or TRP Channels*

Science.gov (United States)

Kang, Hye Jin; Menlove, Kit; Ma, Jianpeng; Wilkins, Angela; Lichtarge, Olivier; Wensel, Theodore G.

2014-01-01

To define the upstream and downstream signaling specificities of metabotropic glutamate receptors (mGluR), we have examined the ability of representative mGluR of group I, II, and III to be activated by endogenous amino acids and catalyze activation of G proteins coupled to phospholipase C (PLC), or activation of Gi/o proteins coupled to the ion channel TRPC4β. Fluorescence-based assays have allowed us to observe interactions not previously reported or clearly identified. We have found that the specificity for endogenous amino acids is remarkably stringent. Even at millimolar levels, structurally similar compounds do not elicit significant activation. As reported previously, the clear exception is l-serine-O-phosphate (l-SOP), which strongly activates group III mGluR, especially mGluR4,-6,-8 but not group I or II mGluR. Whereas l-SOP cannot activate mGluR1 or mGluR2, it acts as a weak antagonist for mGluR1 and a potent antagonist for mGluR2, suggesting that co-recognition of l-glutamate and l-SOP arose early in evolution, and was followed later by divergence of group I and group II mGluR versus group III in l-SOP responses. mGluR7 has low affinity and efficacy for activation by both l-glutamate and l-SOP. Molecular docking studies suggested that residue 74 corresponding to lysine in mGluR4 and asparagine in mGluR7 might play a key role, and, indeed, mutagenesis experiments demonstrated that mutating this residue to lysine in mGluR7 enhances the potency of l-SOP. Experiments with pertussis toxin and dominant-negative Gαi/o proteins revealed that mGluR1 couples strongly to TRPC4β through Gαi/o, in addition to coupling to PLC through Gαq/11. PMID:25193666

Equilibrium fluctuation relations for voltage coupling in membrane proteins.

Science.gov (United States)

Kim, Ilsoo; Warshel, Arieh

2015-11-01

A general theoretical framework is developed to account for the effects of an external potential on the energetics of membrane proteins. The framework is based on the free energy relation between two (forward/backward) probability densities, which was recently generalized to non-equilibrium processes, culminating in the work-fluctuation theorem. Starting from the probability densities of the conformational states along the "voltage coupling" reaction coordinate, we investigate several interconnected free energy relations between these two conformational states, considering voltage activation of ion channels. The free energy difference between the two conformational states at zero (depolarization) membrane potential (i.e., known as the chemical component of free energy change in ion channels) is shown to be equivalent to the free energy difference between the two "equilibrium" (resting and activated) conformational states along the one-dimensional voltage couplin reaction coordinate. Furthermore, the requirement that the application of linear response approximation to the free energy functionals of voltage coupling should satisfy the general free energy relations, yields a novel closed-form expression for the gating charge in terms of other basic properties of ion channels. This connection is familiar in statistical mechanics, known as the equilibrium fluctuation-response relation. The theory is illustrated by considering the coupling of a unit charge to the external voltage in the two sites near the surface of membrane, representing the activated and resting states. This is done using a coarse-graining (CG) model of membrane proteins, which includes the membrane, the electrolytes and the electrodes. The CG model yields Marcus-type voltage dependent free energy parabolas for the response of the electrostatic environment (electrolytes etc.) to the transition from the initial to the final configuratinal states, leading to equilibrium free energy difference and free

Structure of the CLC-1 chloride channel from Homo sapiens.

Science.gov (United States)

Park, Eunyong; MacKinnon, Roderick

2018-05-29

CLC channels mediate passive Cl - conduction, while CLC transporters mediate active Cl - transport coupled to H + transport in the opposite direction. The distinction between CLC-0/1/2 channels and CLC transporters seems undetectable by amino acid sequence. To understand why they are different functionally we determined the structure of the human CLC-1 channel. Its 'glutamate gate' residue, known to mediate proton transfer in CLC transporters, adopts a location in the structure that appears to preclude it from its transport function. Furthermore, smaller side chains produce a wider pore near the intracellular surface, potentially reducing a kinetic barrier for Cl - conduction. When the corresponding residues are mutated in a transporter, it is converted to a channel. Finally, Cl - at key sites in the pore appear to interact with reduced affinity compared to transporters. Thus, subtle differences in glutamate gate conformation, internal pore diameter and Cl - affinity distinguish CLC channels and transporters. © 2018, Park & MacKinnon.

Measurement of the WWγ gauge boson couplings in p bar p collisions at √s=1.8 TeV

International Nuclear Information System (INIS)

Abachi, S.; Abbott, B.; Abolins, M.; Acharya, B.S.; Adam, I.; Adams, D.L.; Adams, M.; Ahn, S.; Aihara, H.; Alitti, J.; Alvarez, G.; Alves, G.A.; Amidi, E.; Amos, N.; Anderson, E.W.; Aronson, S.H.; Astur, R.; Avery, R.E.; Baden, A.; Balamurali, V.; Balderston, J.; Baldin, B.; Bantly, J.; Bartlett, J.F.; Bazizi, K.; Bendich, J.; Beri, S.B.; Bertram, I.; Bezzubov, V.A.; Bhat, P.C.; Bhatnagar, V.; Bhattacharjee, M.; Bischoff, A.; Biswas, N.; Blazey, G.; Blessing, S.; Bloom, P.; Boehnlein, A.; Bojko, N.I.; Borcherding, F.; Borders, J.; Boswell, C.; Brandt, A.; Brock, R.; Bross, A.; Buchholz, D.; Burtovoi, V.S.; Butler, J.M.; Casey, D.; Castilla-Valdez, H.; Chakraborty, D.; Chang, S.; Chekulaev, S.V.; Chen, L.; Chen, W.; Chevalier, L.; Chopra, S.; Choudhary, B.C.; Christenson, J.H.; Chung, M.; Claes, D.; Clark, A.R.; Cobau, W.G.; Cochran, J.; Cooper, W.E.; Cretsinger, C.; Cullen-Vidal, D.; Cummings, M.A.C.; Cutts, D.; Dahl, O.I.; De, K.; Demarteau, M.; Demina, R.; Denisenko, K.; Denisenko, N.; Denisov, D.; Denisov, S.P.; Dharmaratna, W.; Diehl, H.T.; Diesburg, M.; Di Loreto, G.; Dixon, R.; Draper, P.; Drinkard, J.; Ducros, Y.; Dugad, S.R.; Durston-Johnson, S.; Edmunds, D.; Ellison, J.; Elvira, V.D.; Engelmann, R.; Eno, S.; Eppley, G.; Ermolov, P.; Eroshin, O.V.; Evdokimov, V.N.; Fahey, S.; Fahland, T.; Fatyga, M.; Fatyga, M.K.; Featherly, J.; Feher, S.; Fein, D.; Ferbel, T.; Finocchiaro, G.; Fisk, H.E.; Fisyak, Y.; Flattum, E.; Forden, G.E.; Fortner, M.; Frame, K.C.; Franzini, P.; Fuess, S.; Galjaev, A.N.; Gallas, E.; Gao, C.S.; Gao, S.; Geld, T.L.; Genik, R.J. II; Genser, K.; Gerber, C.E.; Gibbard, B.; Glebov, V.; Glenn, S.; Gobbi, B.; Goforth, M.; Goldschmidt, A.; Gomez, B.; Goncharov, P.I.; Gordon, H.; Goss, L.T.; Graf, N.; Grannis, P.D.; Green, D.R.; Green, J.; Greenlee, H.; Griffin, G.; Grossman, N.; Grudberg, P.; Gruenendahl, S.; Gu, W.; Guida, J.A.; Guida, J.M.; Guryn, W.; Gurzhiev, S.N.; Gutnikov, Y.E.; Hadley, N.J.; Haggerty, H.; Hagopian, S.

1995-01-01

The WWγ gauge boson couplings were measured using p bar p→lνγ+X (l=e,μ) events at √s=1.8 TeV observed with the D0 detector at the Fermilab Tevatron Collider. The signal, obtained from the data corresponding to an integrated luminosity of 13.8pb -1 , agrees well with the standard model prediction. A fit to the photon transverse energy spectrum yields limits at the 95% confidence level on the CP-conserving anomalous coupling parameters of -1.6<Δκ<1.8 (λ=0) and -0.6<λ<0.6 (Δκ=0). Similar limits are obtained for the CP-violating coupling parameters

17 CFR 15.06 - Delegations.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Delegations. 15.06 Section 15... § 15.06 Delegations. (a) The Commission hereby delegates, until the Commission orders otherwise, the... Director of the Division of Market Oversight, to be exercised by such Director or by such other employee or...

Development and verification of a coupled code system RETRAN-MASTER-TORC

International Nuclear Information System (INIS)

Cho, J.Y.; Song, J.S.; Joo, H.G.; Zee, S.Q.

2004-01-01

Recently, coupled thermal-hydraulics (T-H) and three-dimensional kinetics codes have been widely used for the best-estimate simulations such as the main steam line break (MSLB) and locked rotor problems. This work is to develop and verify one of such codes by coupling the system T-H code RETRAN, the 3-D kinetics code MASTER and sub-channel analysis code TORC. The MASTER code has already been applied to such simulations after coupling with the MARS or RETRAN-3D multi-dimensional system T-H codes. The MASTER code contains a sub-channel analysis code COBRA-III C/P, and the coupled systems MARSMASTER-COBRA and RETRAN-MASTER-COBRA had been already developed and verified. With these previous studies, a new coupled system of RETRAN-MASTER-TORC is to be developed and verified for the standard best-estimate simulation code package in Korea. The TORC code has already been applied to the thermal hydraulics design of the several ABB/CE type plants and Korean Standard Nuclear Power Plants (KSNP). This justifies the choice of TORC rather than COBRA. Because the coupling between RETRAN and MASTER codes are already established and verified, this work is simplified to couple the TORC sub-channel T-H code with the MASTER neutronics code. The TORC code is a standalone code that solves the T-H equations for a given core problem from reading the input file and finally printing the converged solutions. However, in the coupled system, because TORC receives the pin power distributions from the neutronics code MASTER and transfers the T-H results to MASTER iteratively, TORC needs to be controlled by the MASTER code and does not need to solve the given problem completely at each iteration step. By this reason, the coupling of the TORC code with the MASTER code requires several modifications in the I/O treatment, flow iteration and calculation logics. The next section of this paper describes the modifications in the TORC code. The TORC control logic of the MASTER code is then followed. The

Early Childhood Intervention in China from the Families' Perspective

Science.gov (United States)

Zheng, Yuzhu; Maude, Susan P.; Brotherson, Mary Jane; Merritts, Ashley

2016-01-01

Research highlights the importance of early childhood intervention (ECI) for children with disabilities, and there is an increasing interest in China with respect to research on ECI. However, little research exists exploring the experience of families of young children with disabilities receiving ECI services and supports in China. The purpose of…

The convergent close-coupling method for a Coulomb three-body problem

International Nuclear Information System (INIS)

Bray, I.; Stelbovics, A.T.

1994-09-01

The close-coupling method relies on the reformulation of the Schroedinger equation into an infinite set of coupled-channel equations by expanding over the complete set of target states. The difficulty in applying this approach is that the continuum channels are known to be very important in the intermediate-energy region and coupling to them must be included with little approximation. The application of the Convergent Close-Coupling (CCC) method is discussed which allows the continuum to be treated in a systematic manner via the use of square-integrable states. The CCC method utilizes an expansion of the target in a complete set of orthogonal L 2 functions which form a basis for the underlying Hilbert space. The utility of the method relies on being able to demonstrate convergence in the scattering amplitudes of interest as the basis size is increased. Numerical examples for the well known Temkin-Poet problem are used to illustrate the method. It is estimated the methods may be readily applied to full electron-atom scattering problem. 17 refs., 4 figs

Instabilities simulations with wideband feedback systems: CMAD, HEADTAIL, WARP

CERN Document Server

Li, Kevin; Fox, J D; Pivi, M; Rivetta, C; Rumolo, G

2013-01-01

Transverse mode coupling (TMCI) and electron cloud instabilities (ECI) pose fundamental limitations on the acceptable beam intensities in the SPS at CERN. This in turn limits the ultimate achievable luminosity in the LHC. Therefore, future luminosity upgrades foresee methods for evading TMCI as well as ECI. Proposed approaches within the LHC Injector Upgrade (LIU) project include new optics with reduced transition energy as well as vacuum chamber coating techniques. As a complementary option, high bandwidth feedback systems may provide instability mitigation by actively damping the intra-bunch motion of unstable modes. In an effort to evaluate the potentials and limitations of such feedback systems and to characterise some of the specifications, a numerical model of a realistic feedback system has been developed and integrated into available instabilities simulation codes. Together with the implementation of this new feedback system model, CMAD and HEADTAIL have been used to investigate the impact of differen...

Regulation of KV channel voltage-dependent activation by transmembrane β subunits

Directory of Open Access Journals (Sweden)

Xiaohui eSun

2012-04-01

Full Text Available Voltage-activated K+ (KV channels are important for shaping action potentials and maintaining resting membrane potential in excitable cells. KV channels contain a central pore-gate domain (PGD surrounded by four voltage-sensing domains (VSD. The VSDs will change conformation in response to alterations of the membrane potential thereby inducing the opening of the PGD. Many KV channels are heteromeric protein complexes containing auxiliary β subunits. These β subunits modulate channel expression and activity to increase functional diversity and render tissue specific phenotypes. This review focuses on the KV β subunits that contain transmembrane (TM segments including the KCNE family and the β subunits of large conductance, Ca2+- and voltage-activated K+ (BK channels. These TM β subunits affect the voltage-dependent activation of KV α subunits. Experimental and computational studies have described the structural location of these β subunits in the channel complexes and the biophysical effects on VSD activation, PGD opening and VSD-PGD coupling. These results reveal some common characteristics and mechanistic insights into KV channel modulation by TM β subunits.

Emerging role of the KCNT1 Slack channel in intellectual disability.

Science.gov (United States)

Kim, Grace E; Kaczmarek, Leonard K

2014-01-01

The sodium-activated potassium KNa channels Slack and Slick are encoded by KCNT1 and KCNT2, respectively. These channels are found in neurons throughout the brain, and are responsible for a delayed outward current termed I KNa. These currents integrate into shaping neuronal excitability, as well as adaptation in response to maintained stimulation. Abnormal Slack channel activity may play a role in Fragile X syndrome, the most common cause for intellectual disability and inherited autism. Slack channels interact directly with the fragile X mental retardation protein (FMRP) and I KNa is reduced in animal models of Fragile X syndrome that lack FMRP. Human Slack mutations that alter channel activity can also lead to intellectual disability, as has been found for several childhood epileptic disorders. Ongoing research is elucidating the relationship between mutant Slack channel activity, development of early onset epilepsies and intellectual impairment. This review describes the emerging role of Slack channels in intellectual disability, coupled with an overview of the physiological role of neuronal I KNa currents.

Investigating ion channel conformational changes using voltage clamp fluorometry.

Science.gov (United States)

Talwar, Sahil; Lynch, Joseph W

2015-11-01

Ion channels are membrane proteins whose functions are governed by conformational changes. The widespread distribution of ion channels, coupled with their involvement in most physiological and pathological processes and their importance as therapeutic targets, renders the elucidation of these conformational mechanisms highly compelling from a drug discovery perspective. Thanks to recent advances in structural biology techniques, we now have high-resolution static molecular structures for members of the major ion channel families. However, major questions remain to be resolved about the conformational states that ion channels adopt during activation, drug modulation and desensitization. Patch-clamp electrophysiology has long been used to define ion channel conformational states based on functional criteria. It achieves this by monitoring conformational changes at the channel gate and cannot detect conformational changes occurring in regions distant from the gate. Voltage clamp fluorometry involves labelling cysteines introduced into domains of interest with environmentally sensitive fluorophores and inferring structural rearrangements from voltage or ligand-induced fluorescence changes. Ion channel currents are monitored simultaneously to verify the conformational status. By defining real time conformational changes in domains distant from the gate, this technique provides unexpected new insights into ion channel structure and function. This review aims to summarise the methodology and highlight recent innovative applications of this powerful technique. This article is part of the Special Issue entitled 'Fluorescent Tools in Neuropharmacology'. Copyright © 2015 Elsevier Ltd. All rights reserved.

L-Type Calcium Channels Modulation by Estradiol.

Science.gov (United States)

Vega-Vela, Nelson E; Osorio, Daniel; Avila-Rodriguez, Marco; Gonzalez, Janneth; García-Segura, Luis Miguel; Echeverria, Valentina; Barreto, George E

2017-09-01

Voltage-gated calcium channels are key regulators of brain function, and their dysfunction has been associated with multiple conditions and neurodegenerative diseases because they couple membrane depolarization to the influx of calcium-and other processes such as gene expression-in excitable cells. L-type calcium channels, one of the three major classes and probably the best characterized of the voltage-gated calcium channels, act as an essential calcium binding proteins with a significant biological relevance. It is well known that estradiol can activate rapidly brain signaling pathways and modulatory/regulatory proteins through non-genomic (or non-transcriptional) mechanisms, which lead to an increase of intracellular calcium that activate multiple kinases and signaling cascades, in the same way as L-type calcium channels responses. In this context, estrogens-L-type calcium channels signaling raises intracellular calcium levels and activates the same signaling cascades in the brain probably through estrogen receptor-independent modulatory mechanisms. In this review, we discuss the available literature on this area, which seems to suggest that estradiol exerts dual effects/modulation on these channels in a concentration-dependent manner (as a potentiator of these channels in pM concentrations and as an inhibitor in nM concentrations). Indeed, estradiol may orchestrate multiple neurotrophic responses, which open a new avenue for the development of novel estrogen-based therapies to alleviate different neuropathologies. We also highlight that it is essential to determine through computational and/or experimental approaches the interaction between estradiol and L-type calcium channels to assist these developments, which is an interesting area of research that deserves a closer look in future biomedical research.

Broadband and scalable optical coupling for silicon photonics using polymer waveguides

Science.gov (United States)

La Porta, Antonio; Weiss, Jonas; Dangel, Roger; Jubin, Daniel; Meier, Norbert; Horst, Folkert; Offrein, Bert Jan

2018-04-01

We present optical coupling schemes for silicon integrated photonics circuits that account for the challenges in large-scale data processing systems such as those used for emerging big data workloads. Our waveguide based approach allows to optimally exploit the on-chip optical feature size, and chip- and package real-estate. It further scales well to high numbers of channels and is compatible with state-of-the-art flip-chip die packaging. We demonstrate silicon waveguide to polymer waveguide coupling losses below 1.5 dB for both the O- and C-bands with a polarisation dependent loss of <1 dB. Over 100 optical silicon waveguide to polymer waveguide interfaces were assembled within a single alignment step, resulting in a physical I/O channel density of up to 13 waveguides per millimetre along the chip-edge, with an average coupling loss of below 3.4 dB measured at 1310 nm.

Sar1-GTPase-dependent ER exit of KATP channels revealed by a mutation causing congenital hyperinsulinism

DEFF Research Database (Denmark)

Taneja, Tarvinder K; Mankouri, Jamel; Karnik, Rucha

2009-01-01

The ATP-sensitive potassium (K(ATP)) channel controls insulin secretion by coupling glucose metabolism to excitability of the pancreatic beta-cell membrane. The channel comprises four subunits each of Kir6.2 and the sulphonylurea receptor (SUR1), encoded by KCNJ11 and ABCC8, respectively. Mutatio...

Operation and scalability of dopant-segregated Schottky barrier MOSFETs with recessed channels

International Nuclear Information System (INIS)

Shih, Chun-Hsing; Hsia, Jui-Kai

2013-01-01

Recessed channels were used in scaled dopant-segregated Schottky barrier MOSFETs (DS-SBMOS) to control the severe short-channel effect. The physical operation and device scalability of the DS-SBMOS resulting from the presence of recessed channels and associated gate-corners are elucidated. The coupling of Schottky and gate-corner barriers has a key function in determining the on–off switching and drain current. The gate-corner barriers divide the channel into three regions for protection from the drain penetration field. To prevent resistive degradations in the drive current, an alternative asymmetric recessed channel (ARC) without a source-side gate-corner is proposed to simultaneously optimize both the short-channel effect and drive current in the scaled DS-SBMOS. By employing the proposed ARC architecture, the DS-SBMOS devices can be successfully scaled down, making them promising candidates for next-generation CMOS devices. (paper)

Transport of bedload sediment and channel morphology of a southeast Alaska stream.

Science.gov (United States)

Margaret A. Estep; Robert L. Beschta

1985-01-01

During 1980-81, transport of bedload sediment and channel morphology were determined at Trap Bay Creek, a third-order stream that drains a 13.5-square kilometer watershed on Chichagof island in southeast Alaska. Bedload sediment was sampled for 10 storms: peak flows ranged from 0.6 to 19.0 cubic meters per second, and transport rates ranged from 4 to 4400 kilograms per...

Effects of quantum coupling on the performance of metal-oxide ...

Indian Academy of Sciences (India)

LING-FENG MAO. School of Electronics & Information Engineering, Soochow University, ... Quantum coupling; metal-oxide-semiconductor field transistors. ... effects of the barrier height reduction caused by the channel electron velocity due to.

FMRFamide-gated sodium channel and ASIC channels: a new class of ionotropic receptors for FMRFamide and related peptides.

Science.gov (United States)

Lingueglia, Eric; Deval, Emmanuel; Lazdunski, Michel

2006-05-01

FMRFamide and related peptides typically exert their action through G-protein coupled receptors. However, two ionotropic receptors for these peptides have recently been identified. They are both members of the epithelial amiloride-sensitive Na+ channel and degenerin (ENaC/DEG) family of ion channels. The invertebrate FMRFamide-gated Na+ channel (FaNaC) is a neuronal Na+-selective channel which is directly gated by micromolar concentrations of FMRFamide and related tetrapeptides. Its response is fast and partially desensitizing, and FaNaC has been proposed to participate in peptidergic neurotransmission. On the other hand, mammalian acid-sensing ion channels (ASICs) are not gated but are directly modulated by FMRFamide and related mammalian peptides like NPFF and NPSF. ASICs are activated by external protons and are therefore extracellular pH sensors. They are expressed both in the central and peripheral nervous system and appear to be involved in many physiological and pathophysiological processes such as hippocampal long-term potentiation and defects in learning and memory, acquired fear-related behavior, retinal function, brain ischemia, pain sensation in ischemia and inflammation, taste perception, hearing functions, and mechanoperception. The potentiation of ASIC activity by endogenous RFamide neuropeptides probably participates in the response to noxious acidosis in sensory and central neurons. Available data also raises the possibility of the existence of still unknown FMRFamide related endogenous peptides acting as direct agonists for ASICs.

Optical bistability in a single-sided cavity coupled to a quantum channel

Science.gov (United States)

Payravi, M.; Solookinejad, Gh; Jabbari, M.; Nafar, M.; Ahmadi Sangachin, E.

2018-06-01

In this paper, we discuss the long wavelength optical reflection and bistable behavior of an InGaN/GaN quantum dot nanostructure coupled to a single-sided cavity. It is found that due to the presence of a strong coupling field, the reflection coefficient can be controlled at long wavelength, which is essential for adjusting the threshold of reflected optical bistability. Moreover, the phase shift features of the reflection pulse inside an electromagnetically induced transparency window are also discussed.

Theoretical study of annealed proton-exchanged Nd $LiNbO_{3}$ channel waveguide lasers with variational method

CERN Document Server

De Long Zhang; Yuan Guo Xie; Guilan, Ding; Yuming, Cui; Cai He Chen

2001-01-01

The controllable fabrication parameters, including anneal time, initial exchange time, channel width, dependences of TM/sub 00/ mode size, corresponding effective refractive index, effective pump area, and coupling efficiency between pump and laser modes in z-cut annealed proton-exchanged (APE) Nd:LiNbO/sub 3/ channel waveguide lasers were studied by using variational method. The effect of channel width on the surface index increment and the waveguide depth was taken into account. The features of mode size and effective refractive index were summarized, discussed, and compared with previously published experimental results. The effective pump area, which is directly proportional to threshold pump power, increases strongly, slightly, and very slightly with the increase of anneal time, channel width, and initial exchange time, respectively. However, the coupling efficiency, which is directly proportional to slope efficiency, remains constant (around 0.82) no matter what changes made to these parameters. The var...

GASIFICATION TEST RUN TC06

Energy Technology Data Exchange (ETDEWEB)

Southern Company Services, Inc.

2003-08-01

This report discusses test campaign TC06 of the Kellogg Brown & Root, Inc. (KBR) Transport Reactor train with a Siemens Westinghouse Power Corporation (Siemens Westinghouse) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The Transport Reactor is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using a particulate control device (PCD). The Transport Reactor was operated as a pressurized gasifier during TC06. Test run TC06 was started on July 4, 2001, and completed on September 24, 2001, with an interruption in service between July 25, 2001, and August 19, 2001, due to a filter element failure in the PCD caused by abnormal operating conditions while tuning the main air compressor. The reactor temperature was varied between 1,725 and 1,825 F at pressures from 190 to 230 psig. In TC06, 1,214 hours of solid circulation and 1,025 hours of coal feed were attained with 797 hours of coal feed after the filter element failure. Both reactor and PCD operations were stable during the test run with a stable baseline pressure drop. Due to its length and stability, the TC06 test run provided valuable data necessary to analyze long-term reactor operations and to identify necessary modifications to improve equipment and process performance as well as progressing the goal of many thousands of hours of filter element exposure.

Charge movement and depolarization-contraction coupling in arthropod vs. vertebrate skeletal muscle.

OpenAIRE

Scheuer, T; Gilly, W F

1986-01-01

Voltage-dependent charge movement has been characterized in arthropod skeletal muscle. Charge movement in scorpion (Centuroides sculpturatus) muscle is distinguishable from that in vertebrate skeletal muscle by criteria of kinetics, voltage dependence, and pharmacology. The function of scorpion charge movement is gating of calcium channels in the sarcolemma, and depolarization-contraction coupling relies on calcium influx through these channels.

Systematic continuum-discretized coupled-channels calculations of total fusion for 6Li with targets 28Si, 59Co, 96Zr, 198Pt, and 209Bi: Effect of resonance states

Science.gov (United States)

Gómez Camacho, A.; Wang, Bing; Zhang, H. Q.

2018-05-01

Continuum discretized coupled-channel (CDCC) calculations of total fusion cross sections for reactions induced by the weakly bound nucleus 6Li with targets 28Si, 59Co, 96Zr, 198Pt, and 209Bi at energies around the Coulomb barrier are presented. In the cluster structure frame of 6Li→α +d , short-range absorption potentials are considered for the interactions between the α and d fragments with the targets. The effect of resonance (l =2 , Jπ=3+,2+,1+ ) and nonresonance states of 6Li on fusion is studied by using two approaches: (1) by omitting the resonance states from the full discretized CDCC breakup space and (2) by considering only the resonance subspace. A systematic analysis of the effect on fusion from resonance breakup couplings is carried out from light to heavy mass targets. Among other things, it is found that resonance breakup states produce strong repulsive polarization potentials that lead to fusion suppression. Couplings from nonresonance states give place to weak repulsive potentials at high energies; however, these become attractive for the heavier targets at low energies.

Spatial distribution of electrons on a superfluid helium charge-coupled device

International Nuclear Information System (INIS)

Takita, Maika; Bradbury, F R; Lyon, S A; Gurrieri, T M; Wilkel, K J; Eng, Kevin; Carroll, M S

2012-01-01

Electrons floating on the surface of superfluid helium have been suggested as promising mobile spin qubits. Three micron wide channels fabricated with standard silicon processing are filled with superfluid helium by capillary action. Photoemitted electrons are held by voltages applied to underlying gates. The gates are connected as a 3-phase charge-coupled device (CCD). Starting with approximately one electron per channel, no detectable transfer errors occur while clocking 10 9 pixels. One channel with its associated gates is perpendicular to the other 120, providing a CCD which can transfer electrons between the others. This perpendicular channel has not only shown efficient electron transport but also serves as a way to measure the uniformity of the electron occupancy in the 120 parallel channels.

Independent and cooperative motions of the Kv1.2 channel: voltage sensing and gating.

Science.gov (United States)

Yeheskel, Adva; Haliloglu, Turkan; Ben-Tal, Nir

2010-05-19

Voltage-gated potassium (Kv) channels, such as Kv1.2, are involved in the generation and propagation of action potentials. The Kv channel is a homotetramer, and each monomer is composed of a voltage-sensing domain (VSD) and a pore domain (PD). We analyzed the fluctuations of a model structure of Kv1.2 using elastic network models. The analysis suggested a network of coupled fluctuations of eight rigid structural units and seven hinges that may control the transition between the active and inactive states of the channel. For the most part, the network is composed of amino acids that are known to affect channel activity. The results suggested allosteric interactions and cooperativity between the subunits in the coupling between the motion of the VSD and the selectivity filter of the PD, in accordance with recent empirical data. There are no direct contacts between the VSDs of the four subunits, and the contacts between these and the PDs are loose, suggesting that the VSDs are capable of functioning independently. Indeed, they manifest many inherent fluctuations that are decoupled from the rest of the structure. In general, the analysis suggests that the two domains contribute to the channel function both individually and cooperatively. Copyright 2010 Biophysical Society. Published by Elsevier Inc. All rights reserved.

Sedimentary Facies Mapping Based on Tidal Channel Network and Topographic Features

Science.gov (United States)

Ryu, J. H.; Lee, Y. K.; Kim, K.; Kim, B.

2015-12-01

Tidal flats on the west coast of Korea suffer intensive changes in their surface sedimentary facies as a result of the influence of natural and artificial changes. Spatial relationships between surface sedimentary facies distribution and benthic environments were estimated for the open-type Ganghwa tidal flat and semi closed-type Hwangdo tidal flat, Korea. In this study, we standardized the surface sedimentary facies and tidal channel index of the channel density, distance, thickness and order. To extract tidal channel information, we used remotely sensed data, such as those from the Korea Multi-Purpose Satellite (KOMPSAT)-2, KOMPSAT-3, and aerial photographs. Surface sedimentary facies maps were generated based on field data using an interpolation method.The tidal channels in each sediment facies had relatively constant meandering patterns, but the density and complexity were distinguishable. The second fractal dimension was 1.7-1.8 in the mud flat, about 1.4 in the mixed flat, and about 1.3 in the sand flat. The channel density was 0.03-0.06 m/m2 in the mud flat and less than 0.02 m/m2 in the mixed and sand flat areas of the two test areas. Low values of the tidal channel index, which indicated a simple pattern of tidal channel distribution, were identified at areas having low elevation and coarse-grained sediments. By contrast, high values of the tidal channel index, which indicated a dendritic pattern of tidal channel distribution, were identified at areas having high elevation and fine-grained sediments. Surface sediment classification based on remotely sensed data must circumspectly consider an effective critical grain size, water content, local topography, and intertidal structures.

Quantum-state transfer through long-range correlated disordered channels

Science.gov (United States)

Almeida, Guilherme M. A.; de Moura, Francisco A. B. F.; Lyra, Marcelo L.

2018-05-01

We study quantum-state transfer in XX spin-1/2 chains where both communicating spins are weakly coupled to a channel featuring disordered on-site magnetic fields. Fluctuations are modeled by long-range correlated sequences with self-similar profile obeying a power-law spectrum. We show that the channel is able to perform almost perfect quantum-state transmissions even in the presence of significant amounts of disorder provided the degree of those correlations is strong enough, with the cost of having long transfer times and unavoidable timing errors. Still, we show that the lack of mirror symmetry in the channel does not affect much the likelihood of having high-quality outcomes. Our results suggest that coexistence between localized and delocalized states can diminish effects of static perturbations in solid-state devices for quantum communication.

Channel Power in Multi-Channel Environments

NARCIS (Netherlands)

M.G. Dekimpe (Marnik); B. Skiera (Bernd)

2004-01-01

textabstractIn the literature, little attention has been paid to instances where companies add an Internet channel to their direct channel portfolio. However, actively managing multiple sales channels requires knowing the customers’ channel preferences and the resulting channel power. Two key

FAMILIES’ FIRST IN EARLYCHILDHOOD INTERVENTION.A THEORETICAL APPROACH TOWARDS PARENT’S INVOLVEMENT AND INCREASE OF EFFICIENCY OF THE EARLY CHILDHOOD INTERVENTION

Directory of Open Access Journals (Sweden)

Manfred PRETIS

2012-03-01

Full Text Available Early Childhood Intervention (ECI for vulnerable children between the age of 0-3 and 6 can be seen as well established preventive service in Europe. Even though recent epidemiologic data indicate higher rates of vulnerability during childhood and adolescence, traditionally up to 6% of the children are eligible for the ECI treatment. Definitions describing the ECI include from stable or ad hoc trans-disciplinary teams helping the child, to specific professional profiles. There is a scientific consensus regarding the effects of the ECI upon the child’s development and the family dynamics. The ECI itself is responsible for more stable impact on the socio-emotional development of the child and the parent-child relationship. Specific focus in the research is given to the role of the parents as primary caregivers. Based on the importance of enhancing the interactions between the parents and the children, this paper discusses the strategies that help increase the efficiency of the ECI trough parental involvement. Special attention is dedicated to the mutual understanding, transparency and the use of common language such as the ICF.

Asymmetric fluxes of water and sediments in a mesotidal mudflat channel

Science.gov (United States)

Mariotti, G.; Fagherazzi, S.

2011-01-01

The hydrodynamics of a small tributary channel and its adjacent mudflat is studied in Willapa Bay, Washington State, USA. Velocity profiles and water levels are simultaneously measured at different locations in the channel and on the mudflat for two weeks. The above tidal flat and channel hydrodynamics differ remarkably during the tidal cycle. When the water surface level is above the tidal flat elevation, the channel is inactive. At this stage, the above tidal flat flow is predominantly aligned along the Bay axis, oscillating with the tide as a standing wave with peak velocities up to 0.3 m/s. When the mudflat becomes emergent, the flow concentrates in the channel. During this stage, current velocities up to 1 m/s are measured during ebb; and up to 0.6 m/s during flood. Standard equations for open-channel flow are utilized to study the channel hydrodynamics. From the continuity equation, a lateral inflow is predicted during ebb, which likely originates from the drainage of the mudflat through the lateral runnels. Both advective acceleration and lateral discharge terms, estimated directly from the velocity profiles, play a significant role in the momentum equation. The computed drag coefficient for bottom friction is small, due to an absence of vegetation and bottom bedforms in the channel. Sediment fluxes are calculated by combining flow and suspended sediment concentration estimated using the acoustic backscatter signal of the instruments. A net export of the sediment from the channel is found during ebb, which is not balanced by the sediment import during flood. When the mudflat is submerged, ebb-flood asymmetries in suspended sediment concentration are present, leading to a net sediment flux toward the inner part of the Willapa Bay. Finally, a residual flow is detected inside the channel at high slack water, probably associated with the thermohaline circulation.

Large-scale laboratory testing of bedload-monitoring technologies: overview of the StreamLab06 Experiments

Science.gov (United States)

Marr, Jeffrey D.G.; Gray, John R.; Davis, Broderick E.; Ellis, Chris; Johnson, Sara; Gray, John R.; Laronne, Jonathan B.; Marr, Jeffrey D.G.

2010-01-01

A 3-month-long, large-scale flume experiment involving research and testing of selected conventional and surrogate bedload-monitoring technologies was conducted in the Main Channel at the St. Anthony Falls Laboratory under the auspices of the National Center for Earth-surface Dynamics. These experiments, dubbed StreamLab06, involved 25 researchers and volunteers from academia, government, and the private sector. The research channel was equipped with a sediment-recirculation system and a sediment-flux monitoring system that allowed continuous measurement of sediment flux in the flume and provided a data set by which samplers were evaluated. Selected bedload-measurement technologies were tested under a range of flow and sediment-transport conditions. The experiment was conducted in two phases. The bed material in phase I was well-sorted siliceous sand (0.6-1.8 mm median diameter). A gravel mixture (1-32 mm median diameter) composed the bed material in phase II. Four conventional bedload samplers – a standard Helley-Smith, Elwha, BLH-84, and Toutle River II (TR-2) sampler – were manually deployed as part of both experiment phases. Bedload traps were deployed in study Phase II. Two surrogate bedload samplers – stationarymounted down-looking 600 kHz and 1200 kHz acoustic Doppler current profilers – were deployed in experiment phase II. This paper presents an overview of the experiment including the specific data-collection technologies used and the ambient hydraulic, sediment-transport and environmental conditions measured as part of the experiment. All data collected as part of the StreamLab06 experiments are, or will be available to the research community.

Contributions of counter-charge in a potassium channel voltage-sensor domain

DEFF Research Database (Denmark)

Pless, Stephan Alexander; Galpin, Jason D; Niciforovic, Ana P

2011-01-01

Voltage-sensor domains couple membrane potential to conformational changes in voltage-gated ion channels and phosphatases. Highly coevolved acidic and aromatic side chains assist the transfer of cationic side chains across the transmembrane electric field during voltage sensing. We investigated...... the functional contribution of negative electrostatic potentials from these residues to channel gating and voltage sensing with unnatural amino acid mutagenesis, electrophysiology, voltage-clamp fluorometry and ab initio calculations. The data show that neutralization of two conserved acidic side chains...

Multiple-state Feshbach resonances mediated by high-order couplings

International Nuclear Information System (INIS)

Hemming, Christopher J.; Krems, Roman V.

2008-01-01

We present a study of multistate Feshbach resonances mediated by high-order couplings. Our analysis focuses on a system with one open scattering state and multiple bound states. The scattering state is coupled to one off-resonant bound state and multiple Feshbach resonances are induced by a sequence of indirect couplings between the closed channels. We derive a general recursive expression that can be used to fit the experimental data on multistate Feshbach resonances involving one continuum state and several bound states and present numerical solutions for several model systems. Our results elucidate general features of multistate Feshbach resonances induced by high-order couplings and suggest mechanisms for controlling collisions of ultracold atoms and molecules with external fields

Mass shifts and decay widths of ψ mesons due to OZI-allowed decay channels

International Nuclear Information System (INIS)

Yabusaki, N.; Kato, K.; Hirano, M.; Sakai, M.; Matsuda, Y.

2000-01-01

Using effective quark-quark interactions proposed by the Cornell group and by Barbour and Gilchrist, we study the open-channel effects of the ψ states. We take into account the meson-meson final-state interaction in open channels, which is derived microscopically from the quark-level one-boson-exchange model. By applying the complex scaling transformation to the coupled-channel equation, mass shifts and OZI-allowed decay widths of the ψ states are simultaneously evaluated. Agreement with the experimental data is improved considerably. Refs. 20 (author)

Investigation of Size Effects to the Mixing Performance on the X-shaped Micro-Channels

Directory of Open Access Journals (Sweden)

S Tu

2016-09-01

Full Text Available Due to the developing of micro-electro-mechanical-system, MEMS, the fabrication of the microminiaturization devices becomes obviously important. The advances in the basic understanding of fluid physics have opened an era of application of fluid dynamics systems using microchannels. The purpose of this study is to research the flow transport phenomenon by employing different kinds of micro-channel sizing in X-shaped micro-channels. As the working fluid, water is injected to microchannel at different mass flow rate. Over a wide range of flow condition, 1.06 < Re < 514, in X-shaped micro-channels, the mixture performances of numerical simulation, flow visualization, and temperature distribution remain the same. At the same mass flow rate as the Reynolds number below 112.53, the biggest channel size had the slowest flow velocity and got the best mixing performance; as the Reynolds number above 112.53, the smaller the channel sizing, the lower the pressure drops and the faster velocity becomes. The transition form early from laminar flow, the unsteady flow is an advantage for mixing in the limited mixing area, therefore 0.7 mm got the best mixing performance. It is clear that the size of the channel plays an important role in the X-shaped micro-channels.

One- and two-channel Kondo model with logarithmic Van Hove singularity: A numerical renormalization group solution

Science.gov (United States)

Zhuravlev, A. K.; Anokhin, A. O.; Irkhin, V. Yu.

2018-02-01

Simple scaling consideration and NRG solution of the one- and two-channel Kondo model in the presence of a logarithmic Van Hove singularity at the Fermi level is given. The temperature dependences of local and impurity magnetic susceptibility and impurity entropy are calculated. The low-temperature behavior of the impurity susceptibility and impurity entropy turns out to be non-universal in the Kondo sense and independent of the s-d coupling J. The resonant level model solution in the strong coupling regime confirms the NRG results. In the two-channel case the local susceptibility demonstrates a non-Fermi-liquid power-law behavior.

Erosion versus construction: The origin of Venusian channels

Science.gov (United States)

Bussey, D. B. J.; Guest, J. E.

1992-01-01

Lava channels are a common feature in the volcanic regions of the Moon, and have now been observed on Venus. There has been much debate about the origin of lunar channels as to whether they are the result of erosional (either thermal or mechanical) or constructional processes. It is necessary to determine the criteria to distinguish between the different types of channels. The clearest evidence is that the presence of levees indicates that the channel experienced a constructional phase for a period. One example of a channel of this type in the southeast region of Aphrodite Terra appears to show both erosional and constructional characteristics. It is approximately 700 km long with an average width of about 1 km. It drops a distance of 700 m from beginning to end, which means that the average slope is 0.06 degrees. Its source may have been a graben situated at the northwest end of the channel. It appears to have different origins along its length. The lack of levees near the source suggests that the channel is erosional in this region. The presence of levees indicates that a constructional phase has occurred. These are formed by lava repeatedly splashing over the channel sides and solidifying. Evidence of levees is seen further away from the source. However, the presence of levees does not mean that the lava was not also eroding and deepening the channel. Thus, in conclusion, our example channel is very sinuous and there is evidence of erosion. There may also have been overflow here. In its middle reaches it roofs over and has the characteristics of a lava tube. In the lower reaches there is strong evidence for the presence of levees indicating construction. On Earth, limited amounts of erosion may occur in basaltic lava channels, although not nearly on the same scale as on the planets just mentioned. For lava erosion on Earth to occur to a comparable extent, excessive eruption times are required. However, low-viscosity komatiite lava may erode to a larger extent

Measurements of low noise 64 channel counting ASIC for Si and CdTe strip detectors

International Nuclear Information System (INIS)

Kachel, M; Grybos, P; Szczygiel, R; Takeyoshi, T

2011-01-01

We present the design and performance of a 64-channel ASIC called SXDR64. The circuit is intended to work with DC coupled CdTe detectors as well as with standard AC coupled Si detectors. A single channel of the ASIC consists of a charge sensitive amplifier with a pole-zero cancellation circuit, a 4 th order programmable shaper, a base-line restorer and two independent discriminators with 20-bit counters equipped with RAM. The circuit is able to operate correctly with both polarities of the input signal and the detectors leakage current in a few nA range, with the average rate of input pulses up to 1 Mcps.

EMOTIONAL CREATIVITY INVENTORY: FACTOR STRUCTURE, RELIABILITY AND VALIDITY IN A GEORGIAN-SPEAKING POPULATION

Directory of Open Access Journals (Sweden)

Khatuna Martsksvishvili

2017-12-01

Full Text Available The concept of emotional creativity is based on a social constructivist theory of emotion and refers to an individual’s ability to experience and express novel, sincere, and effective mixtures of emotions. The present research examines the psychometric properties of the Georgian version of Emotional Creativity Inventory (G-ECI; Averill, 1999. 834 individuals across five studies completed the G-ECI. Results from exploratory factor analysis indicate that the factor structure of the original ECI broadly replicates in the Georgian translation. The Cronbach’s alpha reliabilities of the G-ECI scales are mostly acceptable. There are significant gender differences. Examining the construct validity of G-ECI with other constructs (namely, with emotional intelligence, creativity and flow showed the expected relationships. In conclusion, the Georgian version of the emotional creativity inventory seems well suited for future research purposes.

Power module assemblies with staggered coolant channels

Science.gov (United States)

Herron, Nicholas Hayden; Mann, Brooks S; Korich, Mark D

2013-07-16

A manifold is provided for supporting a power module assembly with a plurality of power modules. The manifold includes a first manifold section. The first face of the first manifold section is configured to receive the first power module, and the second face of the first manifold section defines a first cavity with a first baseplate thermally coupled to the first power module. The first face of the second manifold section is configured to receive the second power module, and the second face of the second manifold section defines a second cavity with a second baseplate thermally coupled to the second power module. The second face of the first manifold section and the second face of the second manifold section are coupled together such that the first cavity and the second cavity form a coolant channel. The first cavity is at least partially staggered with respect to second cavity.

Search for anomalous couplings in WW and WZ measurements at the Tevatron (D0 and CDF results)

International Nuclear Information System (INIS)

Diehl, H.T.

1995-06-01

The search for WW and WZ production in p anti p collisions at √s = 1.8 TeV using the CDF and D0 detectors is presented. Three analyses, one concentrating on the leptons + jets decay channels and two concentrating on the dilepton decay channels are described in detail. Limits on anomalous WWγ and WWZ trilinear gauge boson couplings are presented. Prospects for further study of diboson production and anomalous couplings with the Upgraded Tevatron are also presented

Coupled fast-thermal system at the RB, masters thesis; Spregnuti brzo-termicki sistem na reaktoru RB, magistarski rad

Energy Technology Data Exchange (ETDEWEB)

Pesic, M [Boris Kidric Institute of nuclear sciences Vinca, Belgrade (Yugoslavia)

1984-05-15

Coupled fast-thermal system at the RB reactor was formed owing to availability of highly enriched fuel. This paper deals with reactor parameters calculations and measurements of coupled core taking into account safety constraints. Validity of applied calculation methods was confirmed. The following parameters were analyzed: critical height of the core; reactivity dependent on heavy water level in the core; fast neutron spectrum in the fast region channel; spatial distribution of thermal. epithermal and fat neutrons in the fast region channel; reactivity of safety rods; neutron and gamma absorption doses in the center of the coupled core.

$H\\rightarrow\\gamma\\gamma$ Coupling Measurements

CERN Document Server

Vasquez, Jared Gregory; The ATLAS collaboration

2017-01-01

Since the discovery of the Higgs boson, measurements of the decay rates and couplings have become paramount to an understanding of the new boson and its role in electroweak symmetry breaking and the mechanism of fermion mass generation. Despite the small branching ratio, the diphoton decay channel is a particularly attractive method to study these properties thanks to the clean signal peak and novel analysis strategy. This poster will present the latest 13 TeV measurements on the signal strengths (and their ratios) from various Higgs production modes in the diphoton decay channel. The measurements are further extended to include cross-section measurements in theory motivated kinematic regions as defined by the Simplified Template Cross-Section framework.

Numerical Study of Frequency-dependent Seismoelectric Coupling in Partially-saturated Porous Media

Directory of Open Access Journals (Sweden)

Djuraev Ulugbek

2017-01-01

Full Text Available The seismoelectric phenomenon associated with propagation of seismic waves in fluid-saturated porous media has been studied for many decades. The method has a great potential to monitor subsurface fluid saturation changes associated with production of hydrocarbons. Frequency of the seismic source has a significant impact on measurement of the seismoelectric effects. In this paper, the effects of seismic wave frequency and water saturation on the seismoelectric response of a partially-saturated porous media is studied numerically. The conversion of seismic wave to electromagnetic wave was modelled by extending the theoretically developed seismoelectric coupling coefficient equation. We assumed constant values of pore radius and zeta-potential of 80 micrometers and 48 microvolts, respectively. Our calculations of the coupling coefficient were conducted at various water saturation values in the frequency range of 10 kHz to 150 kHz. The results show that the seismoelectric coupling is frequency-dependent and decreases exponentially when frequency increases. Similar trend is seen when water saturation is varied at different frequencies. However, when water saturation is less than about 0.6, the effect of frequency is significant. On the other hand, when the water saturation is greater than 0.6, the coupling coefficient shows monotonous trend when water saturation is increased at constant frequency.

Global versus local mechanisms of temperature sensing in ion channels.

Science.gov (United States)

Arrigoni, Cristina; Minor, Daniel L

2018-05-01

Ion channels turn diverse types of inputs, ranging from neurotransmitters to physical forces, into electrical signals. Channel responses to ligands generally rely on binding to discrete sensor domains that are coupled to the portion of the channel responsible for ion permeation. By contrast, sensing physical cues such as voltage, pressure, and temperature arises from more varied mechanisms. Voltage is commonly sensed by a local, domain-based strategy, whereas the predominant paradigm for pressure sensing employs a global response in channel structure to membrane tension changes. Temperature sensing has been the most challenging response to understand and whether discrete sensor domains exist for pressure and temperature has been the subject of much investigation and debate. Recent exciting advances have uncovered discrete sensor modules for pressure and temperature in force-sensitive and thermal-sensitive ion channels, respectively. In particular, characterization of bacterial voltage-gated sodium channel (BacNa V ) thermal responses has identified a coiled-coil thermosensor that controls channel function through a temperature-dependent unfolding event. This coiled-coil thermosensor blueprint recurs in other temperature sensitive ion channels and thermosensitive proteins. Together with the identification of ion channel pressure sensing domains, these examples demonstrate that "local" domain-based solutions for sensing force and temperature exist and highlight the diversity of both global and local strategies that channels use to sense physical inputs. The modular nature of these newly discovered physical signal sensors provides opportunities to engineer novel pressure-sensitive and thermosensitive proteins and raises new questions about how such modular sensors may have evolved and empowered ion channel pores with new sensibilities.

Prediction of moderator temperature under 35% RIH break LOCA with LOECC in CANDU calandria vessel

International Nuclear Information System (INIS)

Yu, Seon Oh; Kim, Man Woong; Kim, Hho Jung; Lee, Jae Yung

2004-01-01

A CANDU reactor has the unique safety features with the intrinsic safety related characteristics that distinguish it from other water-cooled thermal reactors such as a PWR. One of the safety features is that the heavy water moderator is continuously cooled, providing with a heat sink for the decay heat produced in the fuel when there is the LOCA with the coincident failure of the emergency coolant injection (ECI) system. Under such a dual failure condition, the hot pressure tube (PT) would deform into contacting with the calandria tube (CT), providing with an effective heat transfer path from the fuel to the moderator. Following PT/CT contact, there is the spike of the heat flux in the moderator surrounding the CT, which could lead to sustained CT dryout. The prevention of the CT dryout depends on available local moderator subcooling. Higher moderator temperature (or lower subcooling) would decrease the margin of the CTs to dryout. As for LOCAs with coincident loss of the ECI, fuel channel integrity depends on the capability of the moderator as an ultimate heat sink. In this regard, the Canadian Nuclear Safety Commission (CNSC) had categorized the temperature prediction for the moderator cooling integrity as a general action item (GAI) and had recommended that a series of experimental works should be performed to verify the evaluation codes comparing with the results of three-dimensional experimental data. However, although a couple of computer codes were used to predict moderator temperature prediction for those problems, they could not be adequately validated due to the uncertainty of temperature prediction. In this work, the temperature prediction under the transient condition of LOCA with loss of emergency core cooling (LOECC) in a CANDU reactor is conducted using the optimized calculation scheme from the previous work

A methodology for the coupling of RAMONA-3B neutron kinetics and TRAC-BF1 thermal-hydraulics

International Nuclear Information System (INIS)

Lopez, Arsenio Procopio; Morales Sandoval, Jaime B.

2005-01-01

The initial objective of this project was to directly couple the RAMONA and TRAC codes running on different PCs. The idea was to use the best part of each one and eliminate some of their limitations and widen the applicability of these codes to simulate different BWR and system components. It was required to try to minimize the amount of changes to present code subroutines and calculation procedures. If possible, just substitute values obtained in the parallel code. Preliminary results indicated that using a CHAN component of TRAC to model thermal-hydraulic phenomena for each neutronic channel modeled in RAMONA is rather difficult. Large amounts of CPU time consumption are obtained and lots of PCs would make this solution difficult, besides considerable large transients are introduced by the differences in thermal-hydraulic results of these codes. The substitution of the thermal-hydraulics of RAMONA, by the TRAC channel calculations, is possible but simulation of a null transient on both codes must be planed and a gradual change must be controlled by an additional supervisory subroutine. An indirect coupling of these codes, it is therefore proposed, in order to eliminate most of these limitations. In this indirect coupling, a thermal-hydraulic model of the average tube in a bundle and the global channel cooling fluid dynamics is programmed for each neutronic channel while the global reactor vessel and core is modeled by TRAC with just four channels and four rings. Results are more reliable, coupling is simpler and faster simulations are possible

AlGaN channel field effect transistors with graded heterostructure ohmic contacts

Science.gov (United States)

Bajaj, Sanyam; Akyol, Fatih; Krishnamoorthy, Sriram; Zhang, Yuewei; Rajan, Siddharth

2016-09-01

We report on ultra-wide bandgap (UWBG) Al0.75Ga0.25N channel metal-insulator-semiconductor field-effect transistors (MISFETs) with heterostructure engineered low-resistance ohmic contacts. The low intrinsic electron affinity of AlN (0.6 eV) leads to large Schottky barriers at the metal-AlGaN interface, resulting in highly resistive ohmic contacts. In this work, we use a reverse compositional graded n++ AlGaN contact layer to achieve upward electron affinity grading, leading to a low specific contact resistance (ρsp) of 1.9 × 10-6 Ω cm2 to n-Al0.75Ga0.25N channels (bandgap ˜5.3 eV) with non-alloyed contacts. We also demonstrate UWBG Al0.75Ga0.25N channel MISFET device operation employing the compositional graded n++ ohmic contact layer and 20 nm atomic layer deposited Al2O3 as the gate-dielectric.

A general analysis of Wtb anomalous couplings

Science.gov (United States)

Cao, Qing-Hong; Yan, Bin; Yu, Jiang-Hao; Zhang, Chen

2017-06-01

We investigate new physics effects on the Wtb effective couplings in a model-independent framework. The new physics effects can be parametrized by four independent couplings, , , and . We further introduce a set of parameters x 0, x m , x p and x 5 which exhibit a linear relation to the single top production cross sections. Using recent data for the t-channel single top production cross section σ t , tW associated production cross section σ tW, s-channel single top production cross section σ s , and W-helicity fractions F 0, F L and F R collected at the 8 TeV LHC and Tevatron, we perform a global fit to impose constraints on the top quark effective couplings. Our global fitting results show that the top quark effective couplings are strongly correlated. We show that (i) improving the measurements of σ t and σ tW is important in constraining the correlation of (,) and (,); (ii) and are anti-correlated, and are sensitive to all the four experiments; (iii) and are also anti-correlated, and are sensitive to the F 0 and F L measurements; (iv) the correlation between and is sensitive to the precision of the σ t , σ tW and F 0 measurements. The effective Wtb couplings are studied in three kinds of new physics models: the G(221) = SU(2)1 ⊗ SU(2)2 ⊗ U(1) X models, the vector-like quark models and the Littlest Higgs model with and without T-parity. We show that the Wtb couplings in the left-right model and the un-unified model are sensitive to the ratio of gauge couplings when the new heavy gauge boson’s mass (M W‧) is less than several hundred GeV, but the constraint is loose if M W‧ > 1 TeV. Furthermore, the Wtb couplings in vector-like quark models and the Littlest Higgs models are sensitive to the mixing angles of new heavy particles and SM particles. Supported by National Science Foundation of China (11275009, 11675002, 11635001), National Science Foundation (PHY-1315983, PHY-1316033) and DOE (DE- SC0011095)

Characteristics of turbulent velocity and temperature in a wall channel of a heated rod bundle

Energy Technology Data Exchange (ETDEWEB)

Krauss, T.; Meyer, L. [Forschungszentrum Karlsruhe (Germany)

1995-09-01

Turbulent air flow in a wall sub-channel of a heated 37-rod bundle (P/D = 1.12, W/D = 1.06) was investigated. measurements were performed with hot-wire probe with X-wires and a temperature wire. The mean velocity, the mean fluid temperature, the wall shear stress and wall temperature, the turbulent quantities such as the turbulent kinetic energy, the Reynolds-stresses and the turbulent heat fluxes were measured and are discussed with respect to data from isothermal flow in a wall channel and heated flow in a central channel of the same rod bundle. Also, data on the power spectral densities of the velocity and temperature fluctuations are presented. These data show the existence of large scale periodic fluctuations are responsible for the high intersubchannel heat and momentum exchange.

Spatially coupled LDPC coding in cooperative wireless networks

NARCIS (Netherlands)

Jayakody, D.N.K.; Skachek, V.; Chen, B.

2016-01-01

This paper proposes a novel technique of spatially coupled low-density parity-check (SC-LDPC) code-based soft forwarding relaying scheme for a two-way relay system. We introduce an array-based optimized SC-LDPC codes in relay channels. A more precise model is proposed to characterize the residual

Effect of Hartree-Fock exact exchange on intramolecular magnetic coupling constants of organic diradicals

Science.gov (United States)

Cho, Daeheum; Ko, Kyoung Chul; Ikabata, Yasuhiro; Wakayama, Kazufumi; Yoshikawa, Takeshi; Nakai, Hiromi; Lee, Jin Yong

2015-01-01

The intramolecular magnetic coupling constant (J) of diradical systems linked with five- or six-membered aromatic rings was calculated to obtain the scaling factor (experimental J/calculated J ratio) for various density functional theory (DFT) functionals. Scaling factors of group A (PBE, TPSSh, B3LYP, B97-1, X3LYP, PBE0, and BH&HLYP) and B (M06-L, M06, M06-2X, and M06-HF) were shown to decrease as the amount of Hartree-Fock exact exchange (HFx) increases, in other words, overestimation of calculated J becomes more severe as the HFx increases. We further investigated the effect of HFx fraction of DFT functional on J value, spin contamination, and spin density distributions by comparing the B3LYP analogues containing different amount of HFx. It was revealed that spin contamination and spin densities at each atom increases as the HFx increases. Above all, newly developed BLYP-5 functional, which has 5% of HFx, was found to have the scaling factor of 1.029, indicating that calculated J values are very close to that of experimental values without scaling. BLYP-5 has potential to be utilized for accurate evaluation of intramolecular magnetic coupling constant (J) of diradicals linked by five- or six-membered aromatic ring couplers.

Effect of Hartree-Fock exact exchange on intramolecular magnetic coupling constants of organic diradicals

Energy Technology Data Exchange (ETDEWEB)

Cho, Daeheum; Ko, Kyoung Chul; Lee, Jin Yong, E-mail: jinylee@skku.edu [Department of Chemistry, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Ikabata, Yasuhiro; Wakayama, Kazufumi; Yoshikawa, Takeshi [Department of Chemistry and Biochemistry, School of Advanced Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555 (Japan); Nakai, Hiromi, E-mail: nakai@waseda.jp [Department of Chemistry and Biochemistry, School of Advanced Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555 (Japan); Research Institute for Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555 (Japan); CREST, Japan Science and Technology Agency, Tokyo 102-0075 (Japan); Elements Strategy Initiative for Catalysts and Batteries (ESICB), Kyoto University, Katsura, Kyoto 615-8520 (Japan)

2015-01-14

The intramolecular magnetic coupling constant (J) of diradical systems linked with five- or six-membered aromatic rings was calculated to obtain the scaling factor (experimental J/calculated J ratio) for various density functional theory (DFT) functionals. Scaling factors of group A (PBE, TPSSh, B3LYP, B97-1, X3LYP, PBE0, and BH and HLYP) and B (M06-L, M06, M06-2X, and M06-HF) were shown to decrease as the amount of Hartree-Fock exact exchange (HFx) increases, in other words, overestimation of calculated J becomes more severe as the HFx increases. We further investigated the effect of HFx fraction of DFT functional on J value, spin contamination, and spin density distributions by comparing the B3LYP analogues containing different amount of HFx. It was revealed that spin contamination and spin densities at each atom increases as the HFx increases. Above all, newly developed BLYP-5 functional, which has 5% of HFx, was found to have the scaling factor of 1.029, indicating that calculated J values are very close to that of experimental values without scaling. BLYP-5 has potential to be utilized for accurate evaluation of intramolecular magnetic coupling constant (J) of diradicals linked by five- or six-membered aromatic ring couplers.

Four Channel Mini Wire Chamber to Study Cosmic Rays

Science.gov (United States)

Felix, J.; Rodriguez, G. J.

2018-01-01

Multiwire proportional chamber is a conventional technique to study radiation in general, and cosmic rays in particular. To study cosmic rays, it was planned, designed, constructed, characterized, and tested a four channel mini wire chamber, based on two 3 cm × 3 cm × 0.6 cm Aluminum frames, two 3 cm × 3 cm × 0.6 cm plastic frames, two 3 cm × 3 cm × 0.3 cm Aluminum frames, two electronic planes each with two Tungsten Gold plated 1 mil diameter wires, parallel and 1 cm apart each other at 25 g stretched-each plane was 90° rotated each other in the final assemble- and two Aluminum foil window to define the gas volume; it was operated with Argon 90%-CH4 10% gas mixture at 1 atmosphere and ambient temperature (20°C in the average). It is presented technical details, results on characterization, and preliminary results on cosmic rays detection.

A Study of the Influence of Gas Channel Parameters on HT-PEM Fuel Cell Performance Using FEM Analysis

Directory of Open Access Journals (Sweden)

Ionescu Viorel

2016-01-01

Full Text Available Proton Exchange Membrane Fuel Cells (PEMFC are highly efficient power generators, achieving up to 50–60% conversion efficiency, even in sizes of a few kilowatts. Comsol Multiphysics, a commercial solver based on the Finite Element Method (FEM was used for developing a three dimensional model of a high temperature PEMFC that can deal with both anode and cathode flow field for examining the micro flow channel with electrochemical reaction. Cathode gas flow velocity influence on the cell performance was investigated at first. Polarization curves for three different channel widths (0.8, 1.6 and 2.4 mm and three different channel depths (1, 2 and 3 mm were computed at a cathode inlet flow velocity of 0.06 m/s. Oxygen molar concentration at cathode catalyst layer-GDL channel interface and local current density variation along the cell length were also studied for specific gas channel geometries.

Trans-Channel Interactions in Batrachotoxin-Modified Skeletal Muscle Sodium Channels: Voltage-Dependent Block by Cytoplasmic Amines, and the Influence of μ-Conotoxin GIIIA Derivatives and Permeant Ions

Science.gov (United States)

Pavlov, Evgeny; Britvina, Tatiana; McArthur, Jeff R.; Ma, Quanli; Sierralta, Iván; Zamponi, Gerald W.; French, Robert J.

2008-01-01

External μ-conotoxins and internal amine blockers inhibit each other's block of voltage-gated sodium channels. We explore the basis of this interaction by measuring the shifts in voltage-dependence of channel inhibition by internal amines induced by two μ-conotoxin derivatives with different charge distributions and net charges. Charge changes on the toxin were made at residue 13, which is thought to penetrate most deeply into the channel, making it likely to have the strongest individual interaction with an internal charged ligand. When an R13Q or R13E molecule was bound to the channel, the voltage dependence of diethylammonium (DEA)-block shifted toward more depolarized potentials (23 mV for R13Q, and 16 mV for R13E). An electrostatic model of the repulsion between DEA and the toxin simulated these data, with a distance between residue 13 of the μ-conotoxin and the DEA-binding site of ∼15 Å. Surprisingly, for tetrapropylammonium, the shifts were only 9 mV for R13Q, and 7 mV for R13E. The smaller shifts associated with R13E, the toxin with a smaller net charge, are generally consistent with an electrostatic interaction. However, the smaller shifts observed for tetrapropylammonium than for DEA suggest that other factors must be involved. Two observations indicate that the coupling of permeant ion occupancy of the channel to blocker binding may contribute to the overall amine-toxin interaction: 1), R13Q binding decreases the apparent affinity of sodium for the conducting pore by ∼4-fold; and 2), increasing external [Na+] decreases block by DEA at constant voltage. Thus, even though a number of studies suggest that sodium channels are occupied by no more than one ion most of the time, measurable coupling occurs between permeant ions and toxin or amine blockers. Such interactions likely determine, in part, the strength of trans-channel, amine-conotoxin interactions. PMID:18658222

Trans-channel interactions in batrachotoxin-modified skeletal muscle sodium channels: voltage-dependent block by cytoplasmic amines, and the influence of mu-conotoxin GIIIA derivatives and permeant ions.

Science.gov (United States)

Pavlov, Evgeny; Britvina, Tatiana; McArthur, Jeff R; Ma, Quanli; Sierralta, Iván; Zamponi, Gerald W; French, Robert J

2008-11-01

External mu-conotoxins and internal amine blockers inhibit each other's block of voltage-gated sodium channels. We explore the basis of this interaction by measuring the shifts in voltage-dependence of channel inhibition by internal amines induced by two mu-conotoxin derivatives with different charge distributions and net charges. Charge changes on the toxin were made at residue 13, which is thought to penetrate most deeply into the channel, making it likely to have the strongest individual interaction with an internal charged ligand. When an R13Q or R13E molecule was bound to the channel, the voltage dependence of diethylammonium (DEA)-block shifted toward more depolarized potentials (23 mV for R13Q, and 16 mV for R13E). An electrostatic model of the repulsion between DEA and the toxin simulated these data, with a distance between residue 13 of the mu-conotoxin and the DEA-binding site of approximately 15 A. Surprisingly, for tetrapropylammonium, the shifts were only 9 mV for R13Q, and 7 mV for R13E. The smaller shifts associated with R13E, the toxin with a smaller net charge, are generally consistent with an electrostatic interaction. However, the smaller shifts observed for tetrapropylammonium than for DEA suggest that other factors must be involved. Two observations indicate that the coupling of permeant ion occupancy of the channel to blocker binding may contribute to the overall amine-toxin interaction: 1), R13Q binding decreases the apparent affinity of sodium for the conducting pore by approximately 4-fold; and 2), increasing external [Na(+)] decreases block by DEA at constant voltage. Thus, even though a number of studies suggest that sodium channels are occupied by no more than one ion most of the time, measurable coupling occurs between permeant ions and toxin or amine blockers. Such interactions likely determine, in part, the strength of trans-channel, amine-conotoxin interactions.

Evolution of a Diffusion Channel in an Inhomogeneous Electric Field of the KrF-Laser Pump Discharge

Science.gov (United States)

Yampol'skaya, S. A.; Yastremsky, A. G.; Panchenko, Yu. N.; Puchikin, A. V.; Bobrovnikov, S. M.

2018-01-01

The results of studying the 2D-simulation of evolution of a diffusion channel in the KrF-laser pump discharge initiated by the pin on the cathode surface are presented. It is shown that during the pump pulse, the inhomogeneity passes successively through three stages: a plasma spot on the cathode surface, a diffuse channel, and a high-conductivity channel. From the analysis of the dynamics of spatial distribution of spontaneous emission on the B0-X transition of the KrF molecule in such a discharge, it is obtained that the channel can work as an amplifying medium while the volumetric form of its glow is maintained. Despite the contraction of the channel into a narrow cord at the end of the pump pulse, the distribution of the radiation energy over the entire pulse has the shape of a torch with the width at the anode of 0.6 cm.

The quaternary lidocaine derivative, QX-314, exerts biphasic effects on transient receptor potential vanilloid subtype 1 channels in vitro

DEFF Research Database (Denmark)

Rivera-Acevedo, Ricardo E; Pless, Stephan Alexander; Ahern, Christopher A

2011-01-01

concentrations (less than 1 mM), QX-314 potently inhibited capsaicin-evoked TRPV1 currents with an IC₅₀ of 8.0 ± 0.6 μM. CONCLUSIONS: The results of this study show that the quaternary lidocaine derivative QX-314 exerts biphasic effects on TRPV1 channels, inhibiting capsaicin-evoked TRPV1 currents at lower...... channels. METHODS: The authors conducted an in vitro laboratory study in which they expressed TRPV1 and TRPV4 channels in Xenopus laevis oocytes and recorded cation currents with the two-electrode voltage clamp method. They used confocal microscopy for Ca²⁺ imaging in TRPV1 transient transfected tsA201...

Distributed feedback laser amplifiers combining the functions of amplifiers and channel filters

DEFF Research Database (Denmark)

Wang, Z.; Durhuus, T.; Mikkelsen, Benny

1994-01-01

A dynamic model for distributed feedback amplifiers, including the mode coupled equations and the carrier rate equation, is established. The presented mode coupled equations have taken into account the interaction between fast changing optical signal and the waveguide with corrugations. By showin...... the possibility of amplifying 100 ps pulses without pulse broadening, we anticipate that a distributed feedback amplifier can be used as a combined amplifier and channel filter in high bit rate transmission systems....

Minimum decoherence cat-like states in Gaussian noisy channels

Energy Technology Data Exchange (ETDEWEB)

Serafini, A [Dipartimento di Fisica ' E R Caianiello' , Universita di Salerno, INFM UdR Salerno, INFN Sezione Napoli, G C Salerno, Via S Allende, 84081 Baronissi, SA (Italy); De Siena, S [Dipartimento di Fisica ' E R Caianiello' , Universita di Salerno, INFM UdR Salerno, INFN Sezione Napoli, G C Salerno, Via S Allende, 84081 Baronissi, SA (Italy); Illuminati, F [Dipartimento di Fisica ' E R Caianiello' , Universita di Salerno, INFM UdR Salerno, INFN Sezione Napoli, G C Salerno, Via S Allende, 84081 Baronissi, SA (Italy); Paris, M G A [ISIS ' A Sorbelli' , I-41026 Pavullo nel Frignano, MO (Italy)

2004-06-01

We address the evolution of cat-like states in general Gaussian noisy channels, by considering superpositions of coherent and squeezed coherent states coupled to an arbitrarily squeezed bath. The phase space dynamics is solved and decoherence is studied, keeping track of the purity of the evolving state. The influence of the choice of the state and channel parameters on purity is discussed and optimal working regimes that minimize the decoherence rate are determined. In particular, we show that squeezing the bath to protect a non-squeezed cat state against decoherence is equivalent to orthogonally squeezing the initial cat state while letting the bath be phase insensitive.

Minimum decoherence cat-like states in Gaussian noisy channels

International Nuclear Information System (INIS)

Serafini, A; De Siena, S; Illuminati, F; Paris, M G A

2004-01-01

We address the evolution of cat-like states in general Gaussian noisy channels, by considering superpositions of coherent and squeezed coherent states coupled to an arbitrarily squeezed bath. The phase space dynamics is solved and decoherence is studied, keeping track of the purity of the evolving state. The influence of the choice of the state and channel parameters on purity is discussed and optimal working regimes that minimize the decoherence rate are determined. In particular, we show that squeezing the bath to protect a non-squeezed cat state against decoherence is equivalent to orthogonally squeezing the initial cat state while letting the bath be phase insensitive

Monolithic integration of microfluidic channels and semiconductor lasers

Science.gov (United States)

Cran-McGreehin, Simon J.; Dholakia, Kishan; Krauss, Thomas F.

2006-08-01

We present a fabrication method for the monolithic integration of microfluidic channels into semiconductor laser material. Lasers are designed to couple directly into the microfluidic channel, allowing submerged particles pass through the output beams of the lasers. The interaction between particles in the channel and the lasers, operated in either forward or reverse bias, allows for particle detection, and the optical forces can be used to trap and move particles. Both interrogation and manipulation are made more amenable for lab-on-a-chip applications through monolithic integration. The devices are very small, they require no external optical components, have perfect intrinsic alignment, and can be created with virtually any planar configuration of lasers in order to perform a variety of tasks. Their operation requires no optical expertise and only low electrical power, thus making them suitable for computer interfacing and automation. Insulating the pn junctions from the fluid is the key challenge, which is overcome by using photo-definable SU8-2000 polymer.

Straightforward and complete deposition of NMR data to the PDBe

International Nuclear Information System (INIS)

Penkett, Christopher J.; Ginkel, Glen van; Velankar, Sameer; Swaminathan, Jawahar; Ulrich, Eldon L.; Mading, Steve; Stevens, Tim J.; Fogh, Rasmus H.; Gutmanas, Aleksandras; Kleywegt, Gerard J.; Henrick, Kim; Vranken, Wim F.

2010-01-01

We present a suite of software for the complete and easy deposition of NMR data to the PDB and BMRB. This suite uses the CCPN framework and introduces a freely downloadable, graphical desktop application called CcpNmr Entry Completion Interface (ECI) for the secure editing of experimental information and associated datasets through the lifetime of an NMR project. CCPN projects can be created within the CcpNmr Analysis software or by importing existing NMR data files using the CcpNmr FormatConverter. After further data entry and checking with the ECI, the project can then be rapidly deposited to the PDBe using AutoDep, or exported as a complete deposition NMR-STAR file. In full CCPN projects created with ECI, it is straightforward to select chemical shift lists, restraint data sets, structural ensembles and all relevant associated experimental collection details, which all are or will become mandatory when depositing to the PDB. Instructions and download information for the ECI are available from the PDBe web site at http://www.ebi.ac.uk/pdbe/nmr/deposition/eci.htmlhttp://www.ebi.ac.uk/pdbe/nmr/deposition/eci.html.

The European Citizens’ Initiative: Transnational Democracy in the EU at last?

Directory of Open Access Journals (Sweden)

Maximilian Conrad

2011-06-01

Full Text Available The European Union’s Lisbon Treaty, in force since December 2009, introduced the European Citizens’ Initiative (ECI as a means of strengthening citizen involvement in EU decision making. A minimum of one million citizens from at least seven of the EU’s current 27 member states can request that the European Commission submit a legislative proposal on the issue of the initiative. But the ECI is not only a means of strengthening participatory democracy in the EU. It also bears the potential for a more fundamental transformation of democracy, namely in the direction of transnational participatory democracy. Starting with a short introduction to how the ECI will work in practice as well as a brief history of participatory democracy in the EU, this article therefore examines the ECI from the perspective of democratic theory. How profound an impact will the ECI have on democracy in the European Union?

Skeletal muscle excitation-contraction coupling: who are the dancing partners?

Science.gov (United States)

Rebbeck, Robyn T; Karunasekara, Yamuna; Board, Philip G; Beard, Nicole A; Casarotto, Marco G; Dulhunty, Angela F

2014-03-01

There is an overwhelming body of work supporting the idea that excitation-contraction coupling in skeletal muscle depends on a physical interaction between the skeletal muscle isoform of the dihydropyridine receptor L-type Ca(2+) channel and the skeletal isoform of the ryanodine receptor Ca(2+) release channel. A general assumption is that this physical interaction is between "critical" residues that have been identified in the II-III loop of the dihydropyridine receptor alpha subunit and the ryanodine receptor. However, despite extensive searches, the complementary "critical" residues in the ryanodine receptor have not been identified. This raises the possibility that the coupling proceeds either through other subunits of the dihydropyridine receptor and/or other co-proteins within the large RyR1 protein complex. There have been some remarkable advances in recent years in identifying proteins in the RyR complex that impact on the coupling process, and these are considered in this review. A major candidate for a role in the coupling mechanism is the beta subunit of the dihydropyridine receptor, because specific residues in both the beta subunit and ryanodine receptor have been identified that facilitate an interaction between the two proteins and these also impact on excitation-contraction coupling. This role of beta subunit remains to be fully investigated as well as the degree to which it may complement any other direct or indirect voltage-dependent coupling interactions between the DHPR alpha II-III loop and the ryanodine receptor. Copyright © 2014. Published by Elsevier Ltd.

33 CFR 151.06 - Special areas.

Science.gov (United States)

2010-07-01

....06 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships General § 151.06 Special areas. (a) For the purposes of this part, the... that portion of the Atlantic Ocean within the boundary constituted by the 30° N parallel from Florida...

Water circulation in non-isothermal droplet-laden turbulent channel flow

NARCIS (Netherlands)

Russo, E; Kuerten, Johannes G.M.; van der Geld, C.W.M.; Geurts, Bernardus J.; Simos, T.; Psihoyios, G.; Tsitouras, Ch.

2013-01-01

We propose a point-particle model for two-way coupling of water droplets dispersed in turbulent flow of a carrier gas consisting of air and water vapor. An incompressible flow formulation is applied for direct numerical simulation (DNS) of turbulent channel flow with a warm and a cold wall. Compared

Opioid inhibition of N-type Ca2+ channels and spinal analgesia couple to alternative splicing.

Science.gov (United States)

Andrade, Arturo; Denome, Sylvia; Jiang, Yu-Qiu; Marangoudakis, Spiro; Lipscombe, Diane

2010-10-01

Alternative pre-mRNA splicing occurs extensively in the nervous systems of complex organisms, including humans, considerably expanding the potential size of the proteome. Cell-specific alternative pre-mRNA splicing is thought to optimize protein function for specialized cellular tasks, but direct evidence for this is limited. Transmission of noxious thermal stimuli relies on the activity of N-type Ca(V)2.2 calcium channels in nociceptors. Using an exon-replacement strategy in mice, we show that mutually exclusive splicing patterns in the Ca(V)2.2 gene modulate N-type channel function in nociceptors, leading to a change in morphine analgesia. Exon 37a (e37a) enhances μ-opioid receptor-mediated inhibition of N-type calcium channels by promoting activity-independent inhibition. In the absence of e37a, spinal morphine analgesia is weakened in vivo but the basal response to noxious thermal stimuli is not altered. Our data suggest that highly specialized, discrete cellular responsiveness in vivo can be attributed to alternative splicing events regulated at the level of individual neurons.

Control of the neurovascular coupling by nitric oxide-dependent regulation of astrocytic Ca2+ signaling

Directory of Open Access Journals (Sweden)

Manuel Francisco Muñoz

2015-03-01

Full Text Available Neuronal activity must be tightly coordinated with blood flow to keep proper brain function, which is achieved by a mechanism known as neurovascular coupling. Then, an increase in synaptic activity leads to a dilation of local parenchymal arterioles that matches the enhanced metabolic demand. Neurovascular coupling is orchestrated by astrocytes. These glial cells are located between neurons and the microvasculature, with the astrocytic endfeet ensheathing the vessels, which allows fine intercellular communication. The neurotransmitters released during neuronal activity reach astrocytic receptors and trigger a Ca2+ signaling that propagates to the endfeet, activating the release of vasoactive factors and arteriolar dilation. The astrocyte Ca2+ signaling is coordinated by gap junction channels and hemichannels formed by connexins (Cx43 and Cx30 and channels formed by pannexins (Panx-1. The neuronal activity-initiated Ca2+ waves are propagated among neighboring astrocytes directly via gap junctions or through ATP release via connexin hemichannels or pannexin channels. In addition, Ca2+ entry via connexin hemichannels or pannexin channels may participate in the regulation of the astrocyte signaling-mediated neurovascular coupling. Interestingly, nitric oxide (NO can activate connexin hemichannel by S-nitrosylation and the Ca2+-dependent NO-synthesizing enzymes endothelial NO synthase (eNOS and neuronal NOS (nNOS are expressed in astrocytes. Therefore, the astrocytic Ca2+ signaling triggered in neurovascular coupling may activate NO production, which, in turn, may lead to Ca2+ influx through hemichannel activation. Furthermore, NO release from the hemichannels located at astrocytic endfeet may contribute to the vasodilation of parenchymal arterioles. In this review, we discuss the mechanisms involved in the regulation of the astrocytic Ca2+ signaling that mediates neurovascular coupling, with a special emphasis in the possible participation of NO in

COUPLED SIMULATION OF GAS COOLED FAST REACTOR FUEL ASSEMBLY WITH NESTLE CODE SYSTEM

Directory of Open Access Journals (Sweden)

Filip Osusky

2018-05-01

Full Text Available The paper is focused on coupled calculation of the Gas Cooled Fast Reactor. The proper modelling of coupled neutronics and thermal-hydraulics is the corner stone for future safety assessment of the control and emergency systems. Nowadays, the system and channel thermal-hydraulic codes are accepted by the national regulatory authorities in European Union for license purposes, therefore the code NESTLE was used for the simulation. The NESTLE code is a coupled multigroup neutron diffusion code with thermal-hydraulic sub-channel code. In the paper, the validation of NESTLE code 5.2.1 installation is presented. The processing of fuel assembly homogeneous parametric cross-section library for NESTLE code simulation is made by the sequence TRITON of SCALE code package system. The simulated case in the NESTLE code is one fuel assembly of GFR2400 concept with reflective boundary condition in radial direction and zero flux boundary condition in axial direction. The results of coupled calculation are presented and are consistent with the GFR2400 study of the GoFastR project.

Regression of non-linear coupling of noise in LIGO detectors

Science.gov (United States)

Da Silva Costa, C. F.; Billman, C.; Effler, A.; Klimenko, S.; Cheng, H.-P.

2018-03-01

In 2015, after their upgrade, the advanced Laser Interferometer Gravitational-Wave Observatory (LIGO) detectors started acquiring data. The effort to improve their sensitivity has never stopped since then. The goal to achieve design sensitivity is challenging. Environmental and instrumental noise couple to the detector output with different, linear and non-linear, coupling mechanisms. The noise regression method we use is based on the Wiener–Kolmogorov filter, which uses witness channels to make noise predictions. We present here how this method helped to determine complex non-linear noise couplings in the output mode cleaner and in the mirror suspension system of the LIGO detector.

Microvillar ion channels: cytoskeletal modulation of ion fluxes.

Science.gov (United States)

Lange, K

2000-10-21

The recently presented theory of microvillar Ca(2+)signaling [Lange, K. (1999) J. Cell. Physiol.180, 19-35], combined with Manning's theory of "condensed counterions" in linear polyelectrolytes [Manning, G. S. (1969). J. Chem. Phys.51, 924-931] and the finding of cable-like ion conductance in actin filaments [Lin, E. C. & Cantiello, H. F. (1993). Biophys. J.65, 1371-1378], allows a systematic interpretation of the role of the actin cytoskeleton in ion channel regulation. Ion conduction through actin filament bundles of microvilli exhibits unique nonlinear transmission properties some of which closely resemble that of electronic semiconductors: (1) bundles of microfilaments display significant resistance to cation conduction and (2) this resistance is decreased by supply of additional energy either as thermal, mechanical or electromagnetic field energy. Other transmission properties, however, are unique for ionic conduction in polyelectrolytes. (1) Current pulses injected into the filaments were transformed into oscillating currents or even into several discrete charge pulses closely resembling that of single-channel recordings. Discontinuous transmission is due to the existence of counterion clouds along the fixed anionic charge centers of the polymer, each acting as an "ionic capacitor". (2) The conductivity of linear polyelectrolytes strongly decreases with the charge number of the counterions; thus, Ca(2+)and Mg(2+)are effective modulator of charge transfer through linear polyelectrolytes. Field-dependent formation of divalent cation plugs on either side of the microvillar conduction line may generate the characteristic gating behavior of cation channels. (3) Mechanical movement of actin filament bundles, e.g. bending of hair cell microvilli, generates charge translocations along the filament structure (mechano-electrical coupling). (4) Energy of external fields, by inducing molecular dipoles within the polyelectrolyte matrix, can be transformed into mechanical

Direct coupling of polymer-based microchip electrophoresis to online MALDI-MS using a rotating ball inlet.

Science.gov (United States)

Musyimi, Harrison K; Guy, Jason; Narcisse, Damien A; Soper, Steven A; Murray, Kermit K

2005-12-01

We report on the coupling of a polymer-based microfluidic chip to a MALDI-TOF MS using a rotating ball interface. The microfluidic chips were fabricated by micromilling a mold insert into a brass plate, which was then used for replicating polymer microparts via hot embossing. Assembly of the chip was accomplished by thermally annealing a cover slip to the embossed substrate to enclose the channels. The linear separation channel was 50 microm wide, 100 microm deep, and possessed an 8 cm effective length separation channel with a double-T injector (V(inj) = 10 nL). The exit of the separation channel was machined to allow direct contact deposition of effluent onto a specially constructed rotating ball inlet to the mass spectrometer. Matrix addition was accomplished in-line on the surface of the ball. The coupling utilized the ball as the cathode transfer electrode to transport sample into the vacuum for desorption with a 355 nm Nd:YAG laser and analyzed on a TOF mass spectrometer. The ball was cleaned online after every rotation. The ability to couple poly(methylmethacrylate) microchip electrophoresis devices for the separation of peptides and peptide fragments produced from a protein digest with subsequent online MALDI MS detection was demonstrated.

2018-05-06T17:06:19Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

article/86634 2018-05-06T17:06:19Z wajiar:ART Managing Associated Risks in Cloud Computer Applications Souley, B Umara, AM Google App Engine, Java Programming Language, cloud infrastructure Cloud Computing, the long-held dream of ...

Sensitivity of neutron scattering properties to the coupling to giant resonances

International Nuclear Information System (INIS)

Delaroche, J.P.; Guss, P.P.; Floyd, C.E.; Walter, R.L.; Tornow, W.

1983-01-01

Extended coupled channels calculations have been performed for neutron elastic and inelastic cross sections and analyzing powers for vibrational nuclei with 40 208 Pb and 12 MeV results for 40 Ca are illustrated here

Remodelling of cellular excitation (reaction) and intercellular coupling (diffusion) by chronic atrial fibrillation represented by a reaction-diffusion system

Science.gov (United States)

Zhang, Henggui; Garratt, Clifford J.; Kharche, Sanjay; Holden, Arun V.

2009-06-01

Human atrial tissue is an excitable system, in which myocytes are excitable elements, and cell-to-cell electrotonic interactions are via diffusive interactions of cell membrane potentials. We developed a family of excitable system models for human atrium at cellular, tissue and anatomical levels for both normal and chronic atrial fibrillation (AF) conditions. The effects of AF-induced remodelling of cell membrane ionic channels (reaction kinetics) and intercellular gap junctional coupling (diffusion) on atrial excitability, conduction of excitation waves and dynamics of re-entrant excitation waves are quantified. Both ionic channel and gap junctional coupling remodelling have rate dependent effects on atrial propagation. Membrane channel conductance remodelling allows the propagation of activity at higher rates than those sustained in normal tissue or in tissue with gap junctional remodelling alone. Membrane channel conductance remodelling is essential for the propagation of activity at rates higher than 300/min as seen in AF. Spatially heterogeneous gap junction coupling remodelling increased the risk of conduction block, an essential factor for the genesis of re-entry. In 2D and 3D anatomical models, the dynamical behaviours of re-entrant excitation waves are also altered by membrane channel modelling. This study provides insights to understand the pro-arrhythmic effects of AF-induced reaction and diffusion remodelling in atrial tissue.

SIMULATE-3 K coupled code applications

Energy Technology Data Exchange (ETDEWEB)

Joensson, Christian [Studsvik Scandpower AB, Vaesteraas (Sweden); Grandi, Gerardo; Judd, Jerry [Studsvik Scandpower Inc., Idaho Falls, ID (United States)

2017-07-15

This paper describes the coupled code system TRACE/SIMULATE-3 K/VIPRE and the application of this code system to the OECD PWR Main Steam Line Break. A short description is given for the application of the coupled system to analyze DNBR and the flexibility the system creates for the user. This includes the possibility to compare and evaluate the result with the TRACE/SIMULATE-3K (S3K) coupled code, the S3K standalone code (core calculation) as well as performing single-channel calculations with S3K and VIPRE. This is the typical separate-effect-analyses required for advanced calculations in order to develop methodologies to be used for safety analyses in general. The models and methods of the code systems are presented. The outline represents the analysis approach starting with the coupled code system, reactor and core model calculation (TRACE/S3K). This is followed by a more detailed core evaluation (S3K standalone) and finally a very detailed thermal-hydraulic investigation of the hot pin condition (VIPRE).

Use of Ion-Channel Modulating Agents to Study Cyanobacterial Na+ - K+ Fluxes

Directory of Open Access Journals (Sweden)

Pomati Francesco

2004-01-01

Full Text Available Here we describe an experimental design aimed to investigate changes in total cellular levels of Na+ and K+ ions in cultures of freshwater filamentous cyanobacteria. Ion concentrations were measured in whole cells by flame photometry. Cellular Na+ levels increased exponentially with rising alkalinity, with K+ levels being maximal for optimal growth pH (~8. At standardized pH conditions, the increase in cellular Na+, as induced by NaCl at 10 mM, was coupled by the two sodium channel-modulating agents lidocaine hydrochloride at 1 &mgr;M and veratridine at 100 &mgr;M. Both the channel-blockers amiloride (1 mM and saxitoxin (1 &mgr;M, decreased cell-bound Na+ and K+ levels. Results presented demonstrate the robustness of well-defined channel blockers and channel-activators in the study of cyanobacterial Na+- K+ fluxes.

Direct coupled-channels deperturbation analysis of the A{sup 1}Σ{sup +} ∼ b{sup 3}Π complex in LiCs with experimental accuracy

Energy Technology Data Exchange (ETDEWEB)

Kowalczyk, P., E-mail: Pawel.Kowalczyk@fuw.edu.pl [Institute of Experimental Physics, Faculty of Physics, University of Warsaw, ul. Pasteura 5, 02-093 Warsaw (Poland); Jastrzebski, W.; Szczepkowski, J. [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warsaw (Poland); Pazyuk, E. A.; Stolyarov, A. V., E-mail: avstol@phys.chem.msu.ru [Department of Chemistry, Lomonosov Moscow State University, Leninskie Gory 1/3, Moscow 119991 (Russian Federation)

2015-06-21

We have carried out the direct deperturbation analysis of about 780 rovibronic term values of the strongly spin-orbit (SO) coupled A{sup 1}Σ{sup +} and b{sup 3}Π states of the {sup 7}Li{sup 133}Cs molecule recorded by polarization labelling spectroscopy technique. The explicit A{sup 1}Σ{sup +} ∼ b{sup 3}Π{sub Ω=0,1,2} coupled-channels treatment allowed us to reproduce 95% experimental term values with a standard deviation of 0.05 cm{sup −1} which is close to the accuracy of the present experiment. The initial potential energy curves (PECs) of the mutually perturbed states and SO matrix elements were ab initio evaluated in the basis of the spin-averaged wave functions. The empirically refined PECs and SO functions, along with the theoretical transition dipole moments, were used to predict energy and radiative properties of the A ∼ b complex for low J levels of both {sup 7}Li{sup 133}Cs and {sup 6}Li{sup 133}Cs isotopologues. The reasonable candidates for the stimulated Raman transitions between initial Feshbach resonance states, the mixed levels of the A ∼ b complex, and absolute ground X{sup 1}Σ{sup +} (v = 0 and J = 0) state were identified.

46 CFR 57.06-5 - Production toughness testing.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Production toughness testing. 57.06-5 Section 57.06-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING WELDING AND BRAZING Production Tests § 57.06-5 Production toughness testing. (a) In addition to the test specimens required by...

Extracorporeal irradiation -Physicist perspective

International Nuclear Information System (INIS)

Vijayaprabhu, N.; Saravanan, K.S.; Gunaseelan; Vivekanandam, S.; Reddy, K.S.; Parthasarathy; Mourougan, S.; Elangovan, K.

2008-01-01

Extracorporeal irradiation (ECI) involves irradiation of body tissues, particularly malignant bones of the extremities, outside the body. This involves en bloc resection of the tumour, extracorporeal irradiation of the bone segment with a single dose of 50 Gy or more, and reimplantation of the irradiated bone with fixation devices. Bone tumours like Ewing's Sarcoma, Chondrosarcoma and Oesteosarcoma; in the involved sites like femur, tibia, humerus, ilium and sacrum can be treated with ECI. The reimplanted bone simply acts as a framework for appositional bone growth from surrounding healthy bones. The conventional indications for postoperative irradiation are still applied. The major advantages of ECI are the precise anatomic fit of the reimplanted bone segment, preservation of joint mobility and its potential in avoiding the growth discrepancy commonly seen in prosthetic replacement. The use of ECI was first described in 1968 and practiced in Australia since 1996. In our center, we have completed six ECIs

Transport spectroscopy of coupled donors in silicon nano-transistors

Science.gov (United States)

Moraru, Daniel; Samanta, Arup; Anh, Le The; Mizuno, Takeshi; Mizuta, Hiroshi; Tabe, Michiharu

2014-01-01

The impact of dopant atoms in transistor functionality has significantly changed over the past few decades. In downscaled transistors, discrete dopants with uncontrolled positions and number induce fluctuations in device operation. On the other hand, by gaining access to tunneling through individual dopants, a new type of devices is developed: dopant-atom-based transistors. So far, most studies report transport through dopants randomly located in the channel. However, for practical applications, it is critical to control the location of the donors with simple techniques. Here, we fabricate silicon transistors with selectively nanoscale-doped channels using nano-lithography and thermal-diffusion doping processes. Coupled phosphorus donors form a quantum dot with the ground state split into a number of levels practically equal to the number of coupled donors, when the number of donors is small. Tunneling-transport spectroscopy reveals fine features which can be correlated with the different numbers of donors inside the quantum dot, as also suggested by first-principles simulation results. PMID:25164032

Control of Toxic Chemicals in Puget Sound, Phase 3: Study Of Atmospheric Deposition of Air Toxics to the Surface of Puget Sound

Science.gov (United States)

2007-01-01

http://www.ecy.wa.gov/ biblio /0810084.html Environmental Protection Agency (EPA) (1991). Evaluation of the Atmospheric Deposition of Toxic Contaminants...Washington State Department of Ecology, Olympia, WA. Publication Number: 09-03- 015. http://www.ecy.wa.gov/ biblio /0903015.html. Pelletier, G...Washington http://www.ecy.wa.gov/ biblio /0810084.html Fabbri, D., Marynowski, L., Fabianska, M.J., Zaton, M. Simoneit, B.R.T. (2008). Levoglucosan and

Study on the reduction and hysteresis effect of soil nitrogen pollution by Alfalfa in channel buffer bank

Science.gov (United States)

Chi, Yixia; Xue, Lianqing; Zhang, Zhanyu; Li, Dongying

2018-01-01

Based on the simulation experiments of solute transport in channel buffer bank and pot experiments, this study analyzed the transport of nitrogen pollution from farmland drains along the South-North Water Transfer east route project; and compared the nitrogen transport rule and purification effect of alfalfa in channel buffer bank soil under situations of bare land and alfalfa mulching. The results showed that: (1) soil nitrogen content decreased gradually with the width increase of channel buffer bank by the soil adsorption and decomposition; (2) the migration rates of nitrogen were 0.06 g·kg-1 by the alfalfa mulching; (3) the removed rates of nitrogen from the soil were 0.088 g·kg-1 by cutting alfalfa; (4) the residual nitrogen of soil with alfalfa was 10% of the bare land. Alfalfa in channel buffer bank had obvious reduction and hysteresis effect to soil nitrogen pollution.

The Physical Connection and Magnetic Coupling of the MICE Cooling Channel Magnets and the Magnet Forces for Various MICE Operating Modes

International Nuclear Information System (INIS)

Yang, Stephanie Q.; Baynham, D.E.; Fabricatore, Pasquale; Farinon, Stefania; Green, Michael A.; Ivanyushenkov, Yury; Lau, Wing W.; Maldavi, S.M.; Virostek, Steve P.; Witte, Holger

2006-01-01

A key issue in the construction of the MICE cooling channel is the magnetic forces between various elements in the cooling channel and the detector magnets. This report describes how the MICE cooling channel magnets are hooked to together so that the longitudinal magnetic forces within the cooling channel can be effectively connected to the base of the experiment. This report presents a magnetic force and stress analysis for the MICE cooling channel magnets, even when longitudinal magnetic forces as large as 700 kN (70 tons) are applied to the vacuum vessel of various magnets within the MICE channel. This report also shows that the detector magnets can be effectively separated from the central MICE cooling channel magnets without damage to either type of magnet component

Anomalous couplings in single top quark and searches for rare top quark couplings with the ATLAS detector

CERN Document Server

Cabrera Urban, Susana; The ATLAS collaboration

2017-01-01

Two recent analyses that have exhaustively explored potential anomalous couplings in the $Wtb$ vertex using $t$-channel single-top-quark events selected from collision data at $\\sqrt{s} = $ 8 TeV with the ATLAS detector are reviewed. The first one measures the top-quark polarisation and six W-boson spin opservables from angular asymmetries unfolded to parton level. The second one measures the normalised triple-differential angular decay rate of top quarks to simultaneously constrain all the anomalous couplings. The limits on the anomalous couplings improve the existing limits set by ATLAS at $\\sqrt{s} = $ 7 TeV. In addition, searches for flavour-changing neutral current top-quark interactions based on data collected by ATLAS and CMS, are reviewed. Finally, a recent search for $t \\rightarrow qH$, with $H \\rightarrow \\gamma\\gamma$, performed by ATLAS at $\\sqrt{s} = $ 13 TeV is also presented, where previous LHC limits are improved.

Preparation and Testing of Impedance-based Fluidic Biochips with RTgill-W1 Cells for Rapid Evaluation of Drinking Water Samples for Toxicity.

Science.gov (United States)

Brennan, Linda M; Widder, Mark W; McAleer, Michael K; Mayo, Michael W; Greis, Alex P; van der Schalie, William H

2016-03-07

This manuscript describes how to prepare fluidic biochips with Rainbow trout gill epithelial (RTgill-W1) cells for use in a field portable water toxicity sensor. A monolayer of RTgill-W1 cells forms on the sensing electrodes enclosed within the biochips. The biochips are then used for testing in a field portable electric cell-substrate impedance sensing (ECIS) device designed for rapid toxicity testing of drinking water. The manuscript further describes how to run a toxicity test using the prepared biochips. A control water sample and the test water sample are mixed with pre-measured powdered media and injected into separate channels of the biochip. Impedance readings from the sensing electrodes in each of the biochip channels are measured and compared by an automated statistical software program. The screen on the ECIS instrument will indicate either "Contamination Detected" or "No Contamination Detected" within an hour of sample injection. Advantages are ease of use and rapid response to a broad spectrum of inorganic and organic chemicals at concentrations that are relevant to human health concerns, as well as the long-term stability of stored biochips in a ready state for testing. Limitations are the requirement for cold storage of the biochips and limited sensitivity to cholinesterase-inhibiting pesticides. Applications for this toxicity detector are for rapid field-portable testing of drinking water supplies by Army Preventative Medicine personnel or for use at municipal water treatment facilities.

Photobiomodulation on KATP Channels of Kir6.2-Transfected HEK-293 Cells

Directory of Open Access Journals (Sweden)

Fu-qing Zhong

2014-01-01

Full Text Available Background and Objective. ATP-sensitive potassium (KATP channel couples cell metabolism to excitability. To explore role of KATP channels in cellular photobiomodulation, we designed experiment to study effect of low intensity 808 nm laser irradiation on the activity of membrane KATP channel. Study Design/Materials and Methods. Plasmids encoding Kir6.2 was constructed and heterologously expressed in cultured mammalian HEK-293 cells. The patch-clamp and data acquisition systems were used to record KATP channel current before and after irradiation. A laser beam of Ga-As 808 nm at 5 mW/cm2 was used in experiments. A one-way ANOVA test followed by a post hoc Student-Newman-Keuls test was used to assess the statistical differences between data groups. Results. Obvious openings of KATP channels of Kir6.2-transfected HEK-293 cells and excised patches were recorded during and after low intensity 808 nm laser irradiation. Compared with the channels that did not undergo irradiation, open probability, current amplitude, and dwell time of KATP channels after irradiation improved. Conclusions. Low intensity 808 nm laser irradiation may activate membrane KATP channels of Kir6.2-transfected HEK-293 cells and in excised patches.

Statistical properties of chaotic scattering with one open channel

International Nuclear Information System (INIS)

Izrajlev, F.M.; Saher, D.; Sokolov, V.V.

1993-01-01

The correspondence between statistical properties of decaying states and fluctuations in resonance scattering is studied in a statistical model with one open channel. The model is described by an ensemble of random nonhermitian matrices. The dependence of the correlation length on the coupling parameter both for the S-matrix and the cross-section is studied numerically. 37 refs., 7 figs

Modulation of voltage-gated Ca2+ channels by G protein-coupled receptors in celiac-mesenteric ganglion neurons of septic rats.

Directory of Open Access Journals (Sweden)

Mohamed Farrag

Full Text Available Septic shock, the most severe complication associated with sepsis, is manifested by tissue hypoperfusion due, in part, to cardiovascular and autonomic dysfunction. In many cases, the splanchnic circulation becomes vasoplegic. The celiac-superior mesenteric ganglion (CSMG sympathetic neurons provide the main autonomic input to these vessels. We used the cecal ligation puncture (CLP model, which closely mimics the hemodynamic and metabolic disturbances observed in septic patients, to examine the properties and modulation of Ca2+ channels by G protein-coupled receptors in acutely dissociated rat CSMG neurons. Voltage-clamp studies 48 hr post-sepsis revealed that the Ca2+ current density in CMSG neurons from septic rats was significantly lower than those isolated from sham control rats. This reduction coincided with a significant increase in membrane surface area and a negligible increase in Ca2+ current amplitude. Possible explanations for these findings include either cell swelling or neurite outgrowth enhancement of CSMG neurons from septic rats. Additionally, a significant rightward shift of the concentration-response relationship for the norepinephrine (NE-mediated Ca2+ current inhibition was observed in CSMG neurons from septic rats. Testing for the presence of opioid receptor subtypes in CSMG neurons, showed that mu opioid receptors were present in ~70% of CSMG, while NOP opioid receptors were found in all CSMG neurons tested. The pharmacological profile for both opioid receptor subtypes was not significantly affected by sepsis. Further, the Ca2+ current modulation by propionate, an agonist for the free fatty acid receptors GPR41 and GPR43, was not altered by sepsis. Overall, our findings suggest that CSMG function is affected by sepsis via changes in cell size and α2-adrenergic receptor-mediated Ca2+ channel modulation.

Organic-inorganic hybrid materials as semiconducting channels in thin-film field-effect transistors

Science.gov (United States)

Kagan; Mitzi; Dimitrakopoulos

1999-10-29

Organic-inorganic hybrid materials promise both the superior carrier mobility of inorganic semiconductors and the processability of organic materials. A thin-film field-effect transistor having an organic-inorganic hybrid material as the semiconducting channel was demonstrated. Hybrids based on the perovskite structure crystallize from solution to form oriented molecular-scale composites of alternating organic and inorganic sheets. Spin-coated thin films of the semiconducting perovskite (C(6)H(5)C(2)H(4)NH(3))(2)SnI(4) form the conducting channel, with field-effect mobilities of 0.6 square centimeters per volt-second and current modulation greater than 10(4). Molecular engineering of the organic and inorganic components of the hybrids is expected to further improve device performance for low-cost thin-film transistors.

2018-05-06T06:53:16Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

article/41690 2018-05-06T06:53:16Z ijer:ART Responses of African Universities to HIV and Aids: Students' Perspectives from University of Cape Coast, Ghana Ocansey, F This study sought to determine the views of students of University of Cape ...

A feasibility study on SiC optoinjected CCD with buried channels

International Nuclear Information System (INIS)

Ye Na; Chen Zhiming; Xie Longfei

2013-01-01

An SiC optoinjected charge-coupled device with buried channels (BCCD) is designed for the detection of ultraviolet light (UV), and its feasibility is studied by means of Silvaco numerical simulation software. Charge storage and transfer characteristics of the BCCD can be conformed by simulation results. The buried channel design is a key point to realize the high sensitivity of the device. The channel mobility of electrons in the 6H-SiC BCCD can be changed from 47 to 200 cm 2 /(V.s) when the channel is replaced from surface to the subsurface of 0.2 μm. With the optimized device parameters, the density of stored electrons can reach up to 1.062 × 10 11 cm −2 and the number of stored electrons is up to 1.826 × 10 8 for UV light with wavelengths from 200 to 380 nm and an intensity of 0.1 W/cm 2 under a driving voltage of 15 V at room temperature. (semiconductor devices)

Elastic and inelastic scattering of 9,11 Li + Si at backward angles in the energy range (9.5 - 25) AMeV

International Nuclear Information System (INIS)

Petrascu, M.; Bordeanu, C.; Isbasescu, A.; Mihai, I.; Giurgiu, M.

1997-01-01

Recently, an inclusive fusion experiment of 9,11 Li projectiles with Si targets, in the energy range (9.5 - 25) AMeV has been performed at Riken Ring Cyclotron-Japan using, for the detection of the fusion products, an ionization chamber, MUSIC, built in NIPNE-HH, Bucharest. In this experiment, the contribution of elastic and inelastic scattering, at forward detection angles is eliminated through the experimental set-up. For a clear investigation of the fusion process, the estimation of elastic and inelastic scattering at backward angles, between 80 angle - 180 angle was considered necessary. This estimation was made by the coupled channels computer code ECIS. ECIS is an iterative method, the first iteration of this procedure being DWBA. In the analysis of elastic and inelastic scattering of 9,11 Li projectile on Si target we assumed that the incident 9 Li and 11 Li waves are diffracted by an optical potential with an Woods-Saxon geometry. The adopted optical potential is given. For the depth of the real and imaginary volume terms we used values dependent on projectile energy and target mass number. These values have been chosen in good agreement with a semi-microscopic model with a double-folding potential. The set of optical parameters selected for the system 9,11 Li (13 AMeV) + Si is given. The presence of neutron halo of 11 Li nucleus was taken into account by using adjusted values for the parameters r R and a R . The 28 Si nucleus is considered a rigid rotor, including the couplings involving the ground state and a first to excited states. The quadrupole deformation parameter was β 2 = - 0.24. The results for the scattering of 11 Li projectile on Si target at 13 AMeV energy are given with the parameters R match , I and J max taken from the Monte Carlo simulations with PACE code. We found that the contribution of elastic and inelastic scattering for background angles, between 80 angle - 180 angle is under 2%. The contribution of a inelastic scattering taken