DEFF Research Database (Denmark)
Bjarløv, Søren Peter; Johnston, C.J.; Hansen, M.H.
2016-01-01
compliance with the current Danish Building Regulations (BR10) for airtightness (moisture levels in attics with vapour-open roofing underlays. North facing cold attic spaces under the eaves constitute a worst case scenario. Following best...... to allow an influx of 3.3 l/s of conditioned indoor air 20 °C and 60% RH at a pressure difference of 50 Pa) and ventilation (singled-sided, passive ventilation) contained more moisture and had significantly higher levels of mould growth than the non-ventilated attics. Under the same physical conditions...... the ‘pressure equalized’ attic rooms were found to have moisture levels in between those observed in the ventilated and non-ventilated attic rooms. Likewise, the observed levels of mould growth were in between those observed in the cases of the ventilated and non-ventilated attic rooms. Attics with reduced...
Genome-wide analysis reveals the extent of EAV-HP integration in domestic chicken.
Wragg, David; Mason, Andrew S; Yu, Le; Kuo, Richard; Lawal, Raman A; Desta, Takele Taye; Mwacharo, Joram M; Cho, Chang-Yeon; Kemp, Steve; Burt, David W; Hanotte, Olivier
2015-10-14
EAV-HP is an ancient retrovirus pre-dating Gallus speciation, which continues to circulate in modern chicken populations, and led to the emergence of avian leukosis virus subgroup J causing significant economic losses to the poultry industry. We mapped EAV-HP integration sites in Ethiopian village chickens, a Silkie, Taiwan Country chicken, red junglefowl Gallus gallus and several inbred experimental lines using whole-genome sequence data. An average of 75.22 ± 9.52 integration sites per bird were identified, which collectively group into 279 intervals of which 5 % are common to 90 % of the genomes analysed and are suggestive of pre-domestication integration events. More than a third of intervals are specific to individual genomes, supporting active circulation of EAV-HP in modern chickens. Interval density is correlated with chromosome length (P < 2.31(-6)), and 27 % of intervals are located within 5 kb of a transcript. Functional annotation clustering of genes reveals enrichment for immune-related functions (P < 0.05). Our results illustrate a non-random distribution of EAV-HP in the genome, emphasising the importance it may have played in the adaptation of the species, and provide a platform from which to extend investigations on the co-evolutionary significance of endogenous retroviral genera with their hosts.
Impact of e-AV Biology Website for Learning about Renewable Energy
Nugraini, Siti Hadiati; Choo, Koo Ah; Hin, Hew Soon; Hoon, Teoh Sian
2013-01-01
This paper considers the design and development of a Website for Biology in senior high schools in Indonesia. The teaching media, namely e-AV Biology, was developed with the main features of video lessons and other features in supporting the students' learning process. Some video lessons describe the production process of Biofuel or Renewable…
Paweska, J T
1997-06-01
Clinical, virological and serological responses were investigated in five pregnant donkey mares after experimental exposure to the South African asinine-94 strain of equine arteritis virus (EAV), and the duration of maternal immunity to EAV was studied in their foals. In four intranasally inoculated mares, fever with maximum rectal temperatures of 39.1-40.7 degrees C was recorded 2-11 d after challenge. All the inoculated mares developed mild depression, and a serous ocular and nasal discharge; in three mares mild conjuctivitis was observed. The virus was recovered from the nasopharynx and from buffy-coat samples of all the mares 3-10 d, and 2-18 d post inoculation (p.i.), respectively. Seroconversion to EAV was detected on days 8-10 p.i. Peak serum-virus-neutralizing antibody titres of log10 1.8-2.4, and IgG ELISA OD values of 0.85-2.15 were recorded 2-3 weeks p.i. The in-contact (p.c.) control mare developed fever on days 15-19 post exposure, and showed mild clinical signs of equine viral arteritis similar to those observed in the inoculated mares. Seroconversion to EAV was detected in the p.c. mare on day 20 post exposure, and virus was isolated from nasal swabs and blood samples collected at the time of the febrile response and 1-3 d afterwards. None of the mares aborted. After they had given normal birth 45-128 d p.i. or after p.c. exposure, no virus could be isolated from their placentas. The concentration of EAV-neutralizing antibody in colostrum was two to eight times higher than in serum samples collected at the time of parturition. All the foals born to infected mares were clinically normal at the time of birth and throughout the subsequent 1-2 months of observation. No EAV was recovered from the buffy-coat fraction of blood samples collected at birth nor from those collected on days 1, 2 and 7 after birth. Also, no virus-serum-neutralizing or IgG ELISA antibody to EAV was detected in sera collected immediately after birth before the foals started nursing
Consistent boundary conditions for open strings
International Nuclear Information System (INIS)
Lindstroem, Ulf; Rocek, Martin; Nieuwenhuizen, Peter van
2003-01-01
We study boundary conditions for the bosonic, spinning (NSR) and Green-Schwarz open string, as well as for (1+1)-dimensional supergravity. We consider boundary conditions that arise from (1) extremizing the action, (2) BRST, rigid or local supersymmetry, or κ(Siegel)-symmetry of the action, (3) closure of the set of boundary conditions under the symmetry transformations, and (4) the boundary limits of bulk Euler-Lagrange equations that are 'conjugate' to other boundary conditions. We find corrections to Neumann boundary conditions in the presence of a bulk tachyon field. We discuss a boundary superspace formalism. We also find that path integral quantization of the open string requires an infinite tower of boundary conditions that can be interpreted as a smoothness condition on the doubled interval; we interpret this to mean that for a path-integral formulation of open strings with only Neuman boundary conditions, the description in terms of orientifolds is not just natural, but is actually fundamental
Endogenous retrovirus EAV-HP linked to blue egg phenotype in Mapuche fowl.
Wragg, David; Mwacharo, Joram M; Alcalde, José A; Wang, Chen; Han, Jian-Lin; Gongora, Jaime; Gourichon, David; Tixier-Boichard, Michèle; Hanotte, Olivier
2013-01-01
Oocyan or blue/green eggshell colour is an autosomal dominant trait found in native chickens (Mapuche fowl) of Chile and in some of their descendants in European and North American modern breeds. We report here the identification of an endogenous avian retroviral (EAV-HP) insertion in oocyan Mapuche fowl and European breeds. Sequencing data reveals 100% retroviral identity between the Mapuche and European insertions. Quantitative real-time PCR analysis of European oocyan chicken indicates over-expression of the SLCO1B3 gene (P<0.05) in the shell gland and oviduct. Predicted transcription factor binding sites in the long terminal repeats (LTR) indicate AhR/Ar, a modulator of oestrogen, as a possible promoter/enhancer leading to reproductive tissue-specific over-expression of the SLCO1B3 gene. Analysis of all jungle fowl species Gallus sp. supports the retroviral insertion to be a post-domestication event, while identical LTR sequences within domestic chickens are in agreement with a recent de novo mutation.
Integration of eaves and shading devices for improving the thermal comfort in a multi-zone building
Directory of Open Access Journals (Sweden)
Haddam Muhammad Abdalkhalaq Chuayb
2015-01-01
Full Text Available This paper introduces a new approach to the description and modelling of multi-zone buildings in Saharan climate. Therefore, nodal method was used to apprehend thermo-aeraulic behavior of air subjected to varied solicitations. A coupling was made between equations proposed by P. Rumianowski and some equations of a building thermal energy model found in the TRNSYS user manual. Runge-Kutta fourth order numerical method was used to solve the obtained system of differential equations. Theses results show that proper design of passive houses in an arid region is based on the control of direct solar gains, temperatures and specific humidities. According to the compactness index, the insersion of solar shading and eaves can provide improved thermo-aeraulic comfort.
Directory of Open Access Journals (Sweden)
Chaki Prosper P
2009-09-01
Full Text Available Abstract Background Malaria transmission in Africa occurs predominantly inside houses where the primary vectors prefer to feed. Human preference and investment in blocking of specific entry points for mosquitoes into houses was evaluated and compared with known entry point preferences of the mosquitoes themselves. Methods Cross-sectional household surveys were conducted in urban Dar es Salaam, Tanzania to estimate usage levels of available options for house proofing against mosquito entry, namely window screens, ceilings and blocking of eaves. These surveys also enabled evaluation of household expenditure on screens and ceilings and the motivation behind their installation. Results Over three quarters (82.8% of the 579 houses surveyed in Dar es Salaam had window screens, while almost half (48.9% had ceilings. Prevention of mosquito entry was cited as a reason for installation of window screens and ceilings by 91.4% (394/431 and 55.7% (127/228 of respondents, respectively, but prevention of malaria was rarely cited (4.3%, 22/508. The median cost of window screens was between US $ 21-30 while that of ceilings was between US $301-400. The market value of insecticide-treated nets, window screening and ceilings currently in use in the city was estimated as 2, 5 and 42 million US$. More than three quarters of the respondents that lacked them said it was too expensive to install ceilings (82.2% or window screens (75.5%. Conclusion High coverage and spending on screens and ceilings implies that these techniques are highly acceptable and excellent uptake can be achieved in urban settings like Dar es Salaam. Effective models for promotion and subsidization should be developed and evaluated, particularly for installation of ceilings that prevent entry via the eaves, which are the most important entry point for mosquitoes that cause malaria, a variety of neglected tropical diseases and the nuisance which motivates uptake.
Directory of Open Access Journals (Sweden)
E. Sgnaolin
2012-07-01
Full Text Available Objective: Fibromyalgia syndrome (FMs is a chronic widespread pain condition that can negatively impact on all aspects of patient’s life. The purpose of this study was: first, to evaluate illness perception (IP, quality of life (QoL and affective-emotive variables (EAV of patients with FM; and second, to compare these variables to different pain conditions. Methods: Consecutive 34 women (mean age 47.4±8.3 years affected by FM were enrolled for the study from December 2009 to May 2011. IP was evaluated by means of the Revised Illness Perception Questionnaire, QoL through Nottigham Health Profile and EAV through the Beck Depression Inventory. Scores were compared with rheumatoid arthritis (RA (n=20; mean age 53±12.8 years and low back pain (LBP (n=20; 51.3±7.8 years groups. Results: FM patients scored higher than RA and LBP groups on IP (Identity scale mean: FM=8.8±2.3, AR=5.5±3.3, LBP=4.1±2.9; Kruskal-Wallis=24.42. Moreover FM patients show higher EAV (mean FM=21±9.6, AR=8.9±5.6, LBP=14.9±6.5; Kolmogorov-Smirnov Z=2.17 and QoL (Pain scale mean: FM=74.2±24.1; AR=35.7±19.9; LBP=56.5±20.4; Kolmogorov-Smirnov Z=2.27; Energy scale mean: FM=86.2±28.5; AR=46.8±35.4; LBP=61.6 ±63.7; Kolmogorov-Smirnov Z=1.98 than RA group. Conclusions: Our study highlighted dysfunctional IP, low QoL, high EAV scores in FM patients and the significant relations between these variables. Research results provided support for relevance of a multidisciplinary approach to the management of FM, including psychological interventions, according to a biopsychosocial perspective.Objective: Fibromyalgia syndrome (FMs is a chronic widespread pain condition that can negatively impact on all aspects of patient’s life. The purposes of this study were: i to evaluate illness perception (IP, quality of life (QoL and affective-emotive variables (EAV of patients with FM; and ii to compare these variables to different pain conditions. Methods: Consecutive 34 women (mean age
Killeen, Gerry F; Masalu, John P; Chinula, Dingani; Fotakis, Emmanouil A; Kavishe, Deogratius R; Malone, David; Okumu, Fredros
2017-05-01
We assessed window screens and eave baffles (WSEBs), which enable mosquitoes to enter but not exit houses, as an alternative to indoor residual spraying (IRS) for malaria vector control. WSEBs treated with water, the pyrethroid lambda-cyhalothrin, or the organophosphate pirimiphos-methyl, with and without a binding agent for increasing insecticide persistence on netting, were compared with IRS in experimental huts. Compared with IRS containing the same insecticide, WSEBs killed similar proportions of Anopheles funestus mosquitoes that were resistant to pyrethroids, carbamates and organochlorines and greater proportions of pyrethroid-resistant, early exiting An. arabiensis mosquitoes. WSEBs with pirimiphos-methyl killed greater proportions of both vectors than lambda-cyhalothrin or lambda-cyhalothrin plus pirimiphos-methyl and were equally efficacious when combined with binding agent. WSEBs required far less insecticide than IRS, and binding agents might enhance durability. WSEBs might enable affordable deployment of insecticide combinations to mitigate against physiologic insecticide resistance and improve control of behaviorally resistant, early exiting vectors.
Directory of Open Access Journals (Sweden)
Raúl Hernando Pardo
Full Text Available The present study identified the entering and exiting sites for Lutzomyia longiflocosa in rural houses of the sub-Andean region in Colombia. Entering sites were identified with sticky traps set up outside the bedrooms, around the eave openings, and with cage traps enclosing the slits in the doors and windows inside the bedrooms. Exiting sites were identified by releasing groups of females indoors. These females were blood fed and marked with fluorescent powders. Females were recaptured with the trap placement described above but set up on the opposite sides of the openings. In the entering experiment, a significantly higher number of females were captured in the sticky traps at the zone nearest the eave openings (n = 142 than those captured in the other zones of the trap (n = 52; similarly, a higher number of females were captured on the front side of the house (n = 105 than at the rear side (n = 37. Only two females were collected in the cage trap. In the exiting experiment, at the ceiling, the highest percentage (86.2% of females was recaptured with sticky traps nearest the eave openings and on the front side of the house (70.0%. Seven females were collected in the cage trap. Lu. longiflocosa entered and exited houses primarily through the eave openings in a non-random pattern in relation to the sides of the house.
Pardo, Raúl Hernando; Santamaría, Erika; Cabrera, Olga Lucia
2017-01-01
The present study identified the entering and exiting sites for Lutzomyia longiflocosa in rural houses of the sub-Andean region in Colombia. Entering sites were identified with sticky traps set up outside the bedrooms, around the eave openings, and with cage traps enclosing the slits in the doors and windows inside the bedrooms. Exiting sites were identified by releasing groups of females indoors. These females were blood fed and marked with fluorescent powders. Females were recaptured with the trap placement described above but set up on the opposite sides of the openings. In the entering experiment, a significantly higher number of females were captured in the sticky traps at the zone nearest the eave openings (n = 142) than those captured in the other zones of the trap (n = 52); similarly, a higher number of females were captured on the front side of the house (n = 105) than at the rear side (n = 37). Only two females were collected in the cage trap. In the exiting experiment, at the ceiling, the highest percentage (86.2%) of females was recaptured with sticky traps nearest the eave openings and on the front side of the house (70.0%). Seven females were collected in the cage trap. Lu. longiflocosa entered and exited houses primarily through the eave openings in a non-random pattern in relation to the sides of the house.
Visualization of house-entry behaviour of malaria mosquitoes.
Spitzen, Jeroen; Koelewijn, Teun; Mukabana, W Richard; Takken, Willem
2016-04-25
Malaria mosquitoes often blood feed indoors on human hosts. The mosquitoes predominantly enter houses via open eaves. Host-seeking is odour-driven, and finding a host depends on the quality of the odour plume and whether the route towards the host is free of obstructions. Little is known about in-flight behaviour of mosquitoes during house entry. This semi-field study visualizes mosquito house entry in three dimensions (3D) and offers new insights for optimizing vector control interventions. The approach and house entry of Anopheles gambiae sensu stricto was studied in a semi-field set-up using video-recorded flight tracks and 3D analysis. Behavioural parameters of host-seeking female mosquitoes were visualized with respect to their position relative to the eave as well as whether a mosquito would enter or not. Host odour was standardized using an attractive synthetic blend in addition to CO2. The study was conducted in western Kenya at the Thomas Odhiambo Campus of the International Centre of Insect Physiology and Ecology, Mbita. The majority of host-seeking An. gambiae approached a house with a flight altitude at eave level, arriving within a horizontal arc of 180°. Fifty-five per cent of mosquitoes approaching a house did not enter or made multiple attempts before passing through the eave. During approach, mosquitoes greatly reduced their speed and the flight paths became more convoluted. As a result, mosquitoes that passed through the eave spent more than 80 % of the observed time within 30 cm of the eave. Mosquitoes that exited the eave departed at eave level and followed the edge of the roof (12.5 %) or quickly re-entered after exiting (9.6 %). The study shows that host-seeking mosquitoes, when entering a house, approach the eave in a wide angle to the house at eave level. Less than 25 % of approaching mosquitoes entered the house without interruption, whereas 12.5 % of mosquitoes that had entered left the house again within the time of observation
Effect analysis of core barrel openings under CEFR normal condition
International Nuclear Information System (INIS)
Zhang Yabo; Yang Hongyi
2008-01-01
Openings on the bottom of core barrel are important part of the decay heat removal system of China Experimental Fast Reactor (CEFR), which are designed to discharge the decay heat from reactor under accident condition. This paper analyses the effect of the openings design on the normal operation condition using the famouse CFD code CFX. The result indicates that the decay heat can be discharged safely and at the same time the effect of core barrel openings on the normal operation condition is acceptable. (authors)
Well Conditioned Formulations for Open Surface Scattering
National Research Council Canada - National Science Library
Ottusch, John J; Visher, John L
2008-01-01
.... This report describes an analytical preconditioner method for the EFIE on open surface PEC targets that converts the EFIE to a well conditioned, second-kind integral equation. We present theory and the results from a numerical implementation. We also discuss a 2d extension of the Poincare-Bertrand identity could be used to develop an explicitly second-kind integral equation for open surface scattering problems.
Arterivirus replicase processing : regulatory cascade or Gordian knot?
Aken, Arnoldus Theodorus van
2008-01-01
Equine arteritis virus (EAV) is the prototypic virus of the family Arteriviridae. The EAV genome is a positive-sense single-stranded RNA molecule in which two open reading frames (ORFs) encode the large replicase polyproteins pp1a and pp1ab. Processing of pp1a and pp1ab is mediated by three viral
Thermal Simulations, Open Boundary Conditions and Switches
Burnier, Yannis; Florio, Adrien; Kaczmarek, Olaf; Mazur, Lukas
2018-03-01
SU(N) gauge theories on compact spaces have a non-trivial vacuum structure characterized by a countable set of topological sectors and their topological charge. In lattice simulations, every topological sector needs to be explored a number of times which reflects its weight in the path integral. Current lattice simulations are impeded by the so-called freezing of the topological charge problem. As the continuum is approached, energy barriers between topological sectors become well defined and the simulations get trapped in a given sector. A possible way out was introduced by Lüscher and Schaefer using open boundary condition in the time extent. However, this solution cannot be used for thermal simulations, where the time direction is required to be periodic. In this proceedings, we present results obtained using open boundary conditions in space, at non-zero temperature. With these conditions, the topological charge is not quantized and the topological barriers are lifted. A downside of this method are the strong finite-size effects introduced by the boundary conditions. We also present some exploratory results which show how these conditions could be used on an algorithmic level to reshuffle the system and generate periodic configurations with non-zero topological charge.
Thermal Simulations, Open Boundary Conditions and Switches
Directory of Open Access Journals (Sweden)
Burnier Yannis
2018-01-01
Full Text Available SU(N gauge theories on compact spaces have a non-trivial vacuum structure characterized by a countable set of topological sectors and their topological charge. In lattice simulations, every topological sector needs to be explored a number of times which reflects its weight in the path integral. Current lattice simulations are impeded by the so-called freezing of the topological charge problem. As the continuum is approached, energy barriers between topological sectors become well defined and the simulations get trapped in a given sector. A possible way out was introduced by Lüscher and Schaefer using open boundary condition in the time extent. However, this solution cannot be used for thermal simulations, where the time direction is required to be periodic. In this proceedings, we present results obtained using open boundary conditions in space, at non-zero temperature. With these conditions, the topological charge is not quantized and the topological barriers are lifted. A downside of this method are the strong finite-size effects introduced by the boundary conditions. We also present some exploratory results which show how these conditions could be used on an algorithmic level to reshuffle the system and generate periodic configurations with non-zero topological charge.
Open boundary condition, Wilson flow and the scalar glueball mass
International Nuclear Information System (INIS)
Chowdhury, Abhishek; Harindranath, A.; Maiti, Jyotirmoy
2014-01-01
A major problem with periodic boundary condition on the gauge fields used in current lattice gauge theory simulations is the trapping of topological charge in a particular sector as the continuum limit is approached. To overcome this problem open boundary condition in the temporal direction has been proposed recently. One may ask whether open boundary condition can reproduce the observables calculated with periodic boundary condition. In this work we find that the extracted lowest glueball mass using open and periodic boundary conditions at the same lattice volume and lattice spacing agree for the range of lattice scales explored in the range 3 GeV≤(1/a)≤5 GeV. The problem of trapping is overcome to a large extent with open boundary and we are able to extract the glueball mass at even larger lattice scale ≈ 5.7 GeV. To smoothen the gauge fields we have used recently proposed Wilson flow which, compared to HYP smearing, exhibits better systematics in the extraction of glueball mass. The extracted glueball mass shows remarkable insensitivity to the lattice spacings in the range explored in this work, 3 GeV≤(1/a)≤5.7 GeV.
Nested Bethe Ansatz for Spin Ladder Model with Open Boundary Conditions
International Nuclear Information System (INIS)
Wu Junfang; Zhang Chunmin; Yue Ruihong; Li Runling
2005-01-01
The nested Bethe ansatz (BA) method is applied to find the eigenvalues and the eigenvectors of the transfer matrix for spin-ladder model with open boundary conditions. Based on the reflection equation, we find the general diagonal solution, which determines the general boundary interaction in the Hamiltonian. We introduce the spin-ladder model with open boundary conditions. By finding the solution K ± of the reflection equation which determines the nontrivial boundary terms in the Hamiltonian, we diagonalize the transfer matrix of the spin-ladder model with open boundary conditions in the framework of nested BA.
Open and continuous fermentation: products, conditions and bioprocess economy.
Li, Teng; Chen, Xiang-bin; Chen, Jin-chun; Wu, Qiong; Chen, Guo-Qiang
2014-12-01
Microbial fermentation is the key to industrial biotechnology. Most fermentation processes are sensitive to microbial contamination and require an energy intensive sterilization process. The majority of microbial fermentations can only be conducted over a short period of time in a batch or fed-batch culture, further increasing energy consumption and process complexity, and these factors contribute to the high costs of bio-products. In an effort to make bio-products more economically competitive, increased attention has been paid to developing open (unsterile) and continuous processes. If well conducted, continuous fermentation processes will lead to the reduced cost of industrial bio-products. To achieve cost-efficient open and continuous fermentations, the feeding of raw materials and the removal of products must be conducted in a continuous manner without the risk of contamination, even under 'open' conditions. Factors such as the stability of the biological system as a whole during long cultivations, as well as the yield and productivity of the process, are also important. Microorganisms that grow under extreme conditions such as high or low pH, high osmotic pressure, and high or low temperature, as well as under conditions of mixed culturing, cell immobilization, and solid state cultivation, are of interest for developing open and continuous fermentation processes. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Open-Phase Condition Detecting System for Transformers in Nuclear Power Plant
International Nuclear Information System (INIS)
Ha, Che-Wung; Lee, Do-Hwan
2015-01-01
Recently, several events involving the loss of one of the three phases of the offsite power circuit occurred in the US nuclear power plants (NPPs).. In some cases, the open-phase condition existed undetected for an extended period and in other case, was not properly responded to. Accordingly, the Nuclear Regulatory Commission (NRC) requested all license holders to take corrective actions to address the open-phase condition. It was also requested that all holders or applicant for a standard design certification (DC) include a description of a protection system to detect and separate the open circuit into design control document (DCD). Currently, NPPs including Duke Energy, Exelon, and institutes including Electric Power Research Institute (EPRI) are working together to resolve issues associated with detecting an open-phase condition. This paper, using Electromagnetic Transients Program (EMTP), presents a system to detect and address the loss of one of three phases of the offsite power circuit connected to main, auxiliary and standby transformers, which is hard to be detected in the current protection system. This paper, using EMTP, presents a system to detect and address the loss of one of three phases of the offsite power circuit running to MT, UAT or SAT which is hard to be detected in the current protection system. The system presented in this paper will be useful not only for the KHNP to meet the NRC requirement, but also for nuclear power plants at home and abroad to take corrective actions to provide protection from a single phase open circuit condition for offsite power sources
Open-Phase Condition Detecting System for Transformers in Nuclear Power Plant
Energy Technology Data Exchange (ETDEWEB)
Ha, Che-Wung; Lee, Do-Hwan [KHNP Central Research Institute, Daejeon (Korea, Republic of)
2015-05-15
Recently, several events involving the loss of one of the three phases of the offsite power circuit occurred in the US nuclear power plants (NPPs).. In some cases, the open-phase condition existed undetected for an extended period and in other case, was not properly responded to. Accordingly, the Nuclear Regulatory Commission (NRC) requested all license holders to take corrective actions to address the open-phase condition. It was also requested that all holders or applicant for a standard design certification (DC) include a description of a protection system to detect and separate the open circuit into design control document (DCD). Currently, NPPs including Duke Energy, Exelon, and institutes including Electric Power Research Institute (EPRI) are working together to resolve issues associated with detecting an open-phase condition. This paper, using Electromagnetic Transients Program (EMTP), presents a system to detect and address the loss of one of three phases of the offsite power circuit connected to main, auxiliary and standby transformers, which is hard to be detected in the current protection system. This paper, using EMTP, presents a system to detect and address the loss of one of three phases of the offsite power circuit running to MT, UAT or SAT which is hard to be detected in the current protection system. The system presented in this paper will be useful not only for the KHNP to meet the NRC requirement, but also for nuclear power plants at home and abroad to take corrective actions to provide protection from a single phase open circuit condition for offsite power sources.
Boundary conditions for open quantum systems driven far from equilibrium
Frensley, William R.
1990-07-01
This is a study of simple kinetic models of open systems, in the sense of systems that can exchange conserved particles with their environment. The system is assumed to be one dimensional and situated between two particle reservoirs. Such a system is readily driven far from equilibrium if the chemical potentials of the reservoirs differ appreciably. The openness of the system modifies the spatial boundary conditions on the single-particle Liouville-von Neumann equation, leading to a non-Hermitian Liouville operator. If the open-system boundary conditions are time reversible, exponentially growing (unphysical) solutions are introduced into the time dependence of the density matrix. This problem is avoided by applying time-irreversible boundary conditions to the Wigner distribution function. These boundary conditions model the external environment as ideal particle reservoirs with properties analogous to those of a blackbody. This time-irreversible model may be numerically evaluated in a discrete approximation and has been applied to the study of a resonant-tunneling semiconductor diode. The physical and mathematical properties of the irreversible kinetic model, in both its discrete and its continuum formulations, are examined in detail. The model demonstrates the distinction in kinetic theory between commutator superoperators, which may become non-Hermitian to describe irreversible behavior, and anticommutator superoperators, which remain Hermitian and are used to evaluate physical observables.
Solar cell degradation under open circuit condition in out-doors-in desert region
Directory of Open Access Journals (Sweden)
M. Boussaid
Full Text Available The reliability of solar cells is an important parameter in the design of photovoltaic systems and particularly for cost estimation. Solar cell degradation is the result of various operating conditions; temperature is one of most important factors. Installed PV modules in desert regions are subjected to various temperature changes with significant gradient leading to accelerated degradation. In the present work, we demonstrate the influence of open-circuit condition on the degradation of PV modules. The experiment is carried out in the desert region of ADRAR (southern Algeria using two modules IJISEL of single-crystal silicon. A continuous monitoring allows analysis of both performances of modules for duration of 330 days. The module in open-circuit condition reaches higher temperature means than the module in charging condition; therefore, it undergoes a higher degradation. By simulation, we found that the life of a PV module (whose power output is close to 50% in a condition of an open-circuit in the desert region could be reduced to 4 years, and that has a significant impact on economy. Keywords: WEIBULL, Photovoltaic, Degradation, Open-circuit, Single-crystal, Silicon
78 FR 7424 - National Coal Council
2013-02-01
... DEPARTMENT OF ENERGY National Coal Council AGENCY: Department of Energy. ACTION: Notice of open meeting. SUMMARY: This notice announces a meeting of the National Coal Council (NCC). The Federal Advisory... 2013 meeting of the National Coal Council. Agenda: 1. Opening Remarks by NCC Chairman John Eaves 2...
THE TYPE OF PACKAGING MATERIAL AND STORAGE CONDITIONS AS FACTORS FOR WHEAT SEED QUALITY
Directory of Open Access Journals (Sweden)
Josip Šimenić
2000-12-01
Full Text Available Seed of cereal is normally grown on 5-8% of the overall plots under cereals in the Republic of Croatia. The produced seed meets the needs for high quality seed of wheat, barley, oat and other cereals. Certain quantities of seed remain unsold every year and are kept at various storage conditions and in various packaging material. The objective of this paper was to find out which storage conditions and what sort of packaging material would provide for the best viability of wheat seed. The investigation was carried out at storage simulation and by using various packaging material. In addition to well-known packaging material, such as paper 2 and 4-layer bags, jute bags, and PPR bags, the seed was also packed in the PVC transparent and PVC black bags, as well as in bags made of Aluminium foil. The investigation lasted for two years and was carried out in three various storage conditions, such as in the "New Warehouse" - a warehouse of a new type with thermal isolation in the roof and with uncontrolled conditions, ii the "Old Warehouse" made of filled-in brick and with a roof made of asbestos board, and iii under the "Eaves". The results have shown that the best seed was obtained when packed in 2 and 4-layer paper bags, PVC transparent bags and those made of Aluminium foil. Poorer results were obtained with bags of jute, polypropeline bags and PVC black bags. The storage of seed at "Eaves" has attained the best results in both years of the investigation, as compared to all three types of storage and it can in our circumstances meet the needs for wheat seed storage during one year
Directory of Open Access Journals (Sweden)
Daniel Alberto Morales Rivera
2006-01-01
Full Text Available Se estudiaron algunas propiedades de espumas poliméricas, preparadas con mezclas de copolímeros de etileno-acetato de vinilo (EAV y caucho natural (CN: comportamiento térmico, por análisis térmico diferencial (DSC, y análisis termogravimétrico (TGA, resistencia a la tracción, compresión set y contenido de gel. Se establecieron relaciones entre la composición de las mezclas y las propiedades medidas en función de la reticulación y el espumado, teniendo en cuenta estudios previos realizados en espumas poliolefínicas con densidades similares.
Open system architecture for condition based maintenance applied to a hydroelectric power plant
Energy Technology Data Exchange (ETDEWEB)
Amaya, E.J.; Alvares, A.J. [University of Brasilia (UnB), DF (Brazil). Mechanical and Mechatronic Dept.], Emails: eamaya@unb.br, alvares@AlvaresTech.com; Gudwin, R.R. [State University of Campinas (UNICAMP), SP (Brazil). Computer Engineering and Industrial Automation Dept.], E-mail: gudwin@dca.fee.unicamp.br
2009-07-01
The hydroelectric power plant of Balbina is implementing a condition based maintenance system applying an open, modular and scalable integrated architecture to provide comprehensive solutions and support to the end users like operational and maintenance team. The system called SIMPREBAL (Predictive Maintenance System of Balbina) is advocate of open standards, in particular through collaborative research programmers. In the developing is clearly understands the need for both, industry standards and a simple to use software development tool chain, supporting the development of complex condition based maintenance systems with multiple partners. The Open System Architecture for Condition Based Maintenance (OSA-CBM) is a standard that consider seven hierarchic layers that represent a logic transition or performed data flow from the data acquisition layer, through the intermediates layers as signal processing, condition monitor, health assessment, prognostics and decision support, to arrive to the presentation layer. SIMPREBAL is being implementing as an OSA-CBM software framework and tool set that allows the creation of truly integrated, comprehensive maintenance solutions through the internet. This paper identifies specific benefits of the application of the OSA-CBM in comprehensive solutions of condition based maintenance for a hydroelectric power plant. (author)
Oil spill cleanup in severe weather and open ocean conditions
International Nuclear Information System (INIS)
Kowalski, T.
1993-01-01
Most serious oil spills occur in open water under severe weather conditions. At first the oil stays on the surface, where it is spread by winds and water currents. The action of the waves then mixes the oil into the water column. With time the light elements of crude oil evaporate. The remaining residue is of very low commercial value, but of significant environmental impact. The oil spill can move either out to sea or inshore, where it ends up on the beaches. Normal procedures are to let outbound oil disperse by evaporation and mixing into the water column, and to let the inbound oil collect on the beaches, where the cleanup operations are concentrated. The reason for this is that there is no capability to clean the surface of the water in wave conditions-present-day oil skimmers are ineffective in waves approaching 4 ft in height. It would be simpler, more effective and environmentally more beneficial to skim the oil right at the spill location. This paper describes a method to do this. In the case of an oil spill in open water and high wave conditions, it is proposed to reduce the height of the ocean waves by the use of floating breakwaters to provide a relatively calm area. In such protected areas existing oil skimmers can be used to recover valuable oil and clean up the spill long before it hits the beaches. A floating breakwater developed at the University of Rhode Island by the author can be of great benefit in oil spill cleanup for open ocean conditions. This breakwater is constructed from scrap automobile tires. It is built in units of 20 tires each, which are easily transportable and can be connected together at the spill site to form any desired configuration
Conditions required for opening of a commercial mineral deposit
International Nuclear Information System (INIS)
Shastry, S.
1991-01-01
It has been observed that once a mineral deposit is discovered and ore reserves are estimation, it is presumed that the deposit is commercially exploitable. Estimation of ore reserves, alone is not sufficient to consider a deposit exploitable. There are many more investigation necessary to make a deposit commercially mineable. Data regarding rock characteristics, behaviour of the ore body, hydrological conditions, extraction properties of ore, disposal of mine water and waste rock and suitable sites for mill tailings disposal, are required to be collected for assessing the opening of a new deposit. In this paper all these conditions are discussed
International Nuclear Information System (INIS)
Bhan, Jaemi; Kwon, Younghun
2007-01-01
Recently Yeo showed that thermal states in Heisenberg XX model with periodic boundary condition could be used for three-party quantum teleportation. However it is hard to implement the periodic boundary condition in spin chain. So instead of imposing the periodic boundary condition, we consider open boundary condition in Heisenberg XX model and investigate the possibility of using thermal states in Heisenberg XX model with open boundary condition. Using this way, we find the best fidelity conditions to three known protocols in three-party quantum teleportation. It turns out that the best fidelity in every protocol would be 23
[Acoustic conditions in open plan office - Application of technical measures in a typical room].
Mikulski, Witold
2018-03-09
Noise in open plan offices should not exceed acceptable levels for the hearing protection. Its major negative effects on employees are nuisance and impediment in execution of work. Specific technical solutions should be introduced to provide proper acoustic conditions for work performance. Acoustic evaluation of a typical open plan office was presented in the article published in "Medycyna Pracy" 5/2016. None of the rooms meets all the criteria, therefore, in this article one of the rooms was chosen to apply different technical solutions to check the possibility of reaching proper acoustic conditions. Acoustic effectiveness of those solutions was verified by means of digital simulation. The model was checked by comparing the results of measurements and calculations before using simulation. The analyzis revealed that open plan offices supplemented with signals for masking speech signals can meet all the required criteria. It is relatively easy to reach proper reverberation time (i.e., sound absorption). It is more difficult to reach proper values of evaluation parameters determined from A-weighted sound pressure level (SPLA) of speech. The most difficult is to provide proper values of evaluation parameters determined from speech transmission index (STI). Finally, it is necessary (besides acoustic treatment) to use devices for speech masking. The study proved that it is technically possible to reach proper acoustic condition. Main causes of employees complaints in open plan office are inadequate acoustic work conditions. Therefore, it is necessary to apply specific technical solutions - not only sound absorbing suspended ceiling and high acoustic barriers, but also devices for speech masking. Med Pr 2018;69(2):153-165. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.
On the extraction of spectral quantities with open boundary conditions
International Nuclear Information System (INIS)
Bruno, Mattia; Korcyl, Piotr; Lottini, Stefano; Schaefer, Stefan; Korzec, Tomasz
2014-11-01
We discuss methods to extract decay constants, meson masses and gluonic observables in the presence of open boundary conditions. The ensembles have been generated by the CLS effort and have 2+1 flavors of O(a)-improved Wilson fermions with a small twisted-mass term as proposed by Luescher and Palombi. We analyse the effect of the associated reweighting factors on the computation of different observables.
Wang, Yanfu; Jiang, Juncheng; Zhu, Dezhi
2009-07-15
In order to research the fire characteristic under natural ventilation conditions in tunnels with roof openings, full-scale experiment of tunnel fire is designed and conducted. All the experimental data presented in this paper can be further applied for validation of numerical simulation models and reduced-scale experimental results. The physical model of tunnel with roof openings and the mathematical model of tunnel fire are presented in this paper. The tunnel fire under the same conditions as experiment is simulated using CFD software. From the results, it can be seen that most smoke is discharged directly off the tunnel through roof openings, so roof openings are favorable for exhausting smoke. But along with the decrease of smoke temperatures, some smoke may backflow and mix with the smoke-free layer below, which leads to fall in visibility and is unfavorable for personnel evacuation. So it is necessary to research more efficient ways for improving the smoke removal efficiency, such as early fire detection systems, adequate warning signs and setting tunnel cap.
Antishocks in the ASEP with open boundaries conditioned on low current
International Nuclear Information System (INIS)
Belitsky, V; Schütz, G M
2013-01-01
We study the time evolution of the ASEP on a finite lattice with L sites and open boundaries, conditioned on an atypically low current up to a finite time t. By an exact computation, we show that for a one-parameter family of boundary densities and a special value of the conditioned current, an initial product measure with an antishock at site k evolves into a convex combination of such antishocks at sites k′. The weights p(k′, t|k, 0) are shown to be the transition probabilities of simple biased random walk with reflecting boundaries. We compute explicitly these transition rates. Our result implies that the antishock remains microscopically stable under the locally conditioned dynamics. (paper)
Experience with the Open Source based implementation for ATLAS Conditions Data Management System
Amorim, A; Oliveira, C; Pedro, L; Barros, N
2003-01-01
Conditions Data in high energy physics experiments is frequently seen as every data needed for reconstruction besides the event data itself. This includes all sorts of slowly evolving data like detector alignment, calibration and robustness, and data from detector control system. Also, every Conditions Data Object is associated with a time interval of validity and a version. Besides that, quite often is useful to tag collections of Conditions Data Objects altogether. These issues have already been investigated and a data model has been proposed and used for different implementations based in commercial DBMSs, both at CERN and for the BaBar experiment. The special case of the ATLAS complex trigger that requires online access to calibration and alignment data poses new challenges that have to be met using a flexible and customizable solution more in the line of Open Source components. Motivated by the ATLAS challenges we have developed an alternative implementation, based in an Open Source RDBMS. Several issues...
Novel method to avoid the open-sky condition in penetrating keratoplasty: covered cornea technique.
Arslan, Osman S; Unal, Mustafa; Arici, Ceyhun; Cicik, Erdoğan; Mangan, Serhat; Atalay, Eray
2014-09-01
The aim of this study was to present a novel technique to avoid the open-sky condition in pediatric and adult penetrating keratoplasty (PK). Seventy-two eyes of 65 infants and children and 44 eyes of 44 adult patients were operated on using this technique. After trephining the recipient cornea up to a depth of 50% to 70%, the anterior chamber was entered at 1 point. Then, only a 2 clock hour segment of the recipient button was incised, and this segment was sutured to the recipient rim with a single tight suture. The procedure was repeated until the entire recipient button was excised and resutured. The donor corneal button was sutured to the recipient corneal rim. The sutures between the recipient button and the rim were then cut off, and the recipient button was drawn out. None of the patients operated on with this technique developed complications related to the open-sky condition. Visual acuities, graft failure rates, and endothelial cell loss were comparable with the findings of studies performed for conventional PK. The technique described avoids the open-sky condition during the entire PK procedure. Endothelial cell loss rates are acceptable.
Affordable house designs to improve health in rural Africa
DEFF Research Database (Denmark)
Knudsen, Jakob; von Seidlein, Lorenz
2017-01-01
. In the modified houses, major structural problems such as leaking roofs were repaired, windows screened, open eaves blocked with bricks and mortar, cement floors repaired or constructed, and rain gutters and a tank for water storage added. Prototype houses were randomly allocated to village households through...
78 FR 23242 - National Coal Council
2013-04-18
... DEPARTMENT OF ENERGY National Coal Council AGENCY: Department of Energy. ACTION: Notice of open meetings. SUMMARY: This notice announces two meetings of the National Coal Council (NCC). The Federal...: Agenda for Thursday, May 16, 2013 1. Call to Order by John Eaves, Chairman, National Coal Council 2...
International Nuclear Information System (INIS)
Ree, Suhan
2003-01-01
Fractal analysis is performed to measure the chaoticity of a classical hard-wall billiard with openings. We use the circular billiard with a straight cut with two openings, and a two-dimensional (2D) set of initial conditions that produce all possible trajectories of a particle injected from one opening. We numerically compute the fractal dimension of singular points of the function that maps an initial condition to the number of collisions with the wall before the exit, using the box-counting algorithm that uses uniformly distributed points inside the 2D set of initial conditions. Finally, the classical chaotic properties are observed while the parameters of the billiard are varied, and the results are compared with those with the one-dimensional set of initial conditions
International Nuclear Information System (INIS)
Moore, Brian D.; Balasuriya, Udeni B.R.; Watson, Johanna L.; Bosio, Catharine M.; MacKay, Robert J.; MacLachlan, N. James
2003-01-01
Equine arteritis virus (EAV) infects endothelial cells (ECs) and macrophages in horses, and many of the clinical manifestations of equine viral arteritis (EVA) reflect vascular injury. To further evaluate the potential role of EAV-induced, macrophage-derived cytokines in the pathogenesis of EVA, we infected cultured equine alveolar macrophages (AMphi), blood monocyte-derived macrophages (BMphi), and pulmonary artery ECs with either a virulent (KY84) or an avirulent (CA95) strain of EAV. EAV infection of equine AMphi, BMphi, and ECs resulted in their activation with increased transcription of genes encoding proinflammatory mediators, including interleukin (IL)-1β, IL-6, IL-8, and tumor necrosis factor (TNF)-α. Furthermore, the virulent KY84 strain of EAV induced significantly higher levels of mRNA encoding proinflammatory cytokines in infected AMphi and BMphi than did the avirulent CA95 strain. Treatment of equine ECs with the culture supernatants of EAV-infected AMphi and BMphi also resulted in EC activation with cell surface expression of E-selectin, whereas infection of ECs with purified EAV alone caused only minimal expression of E-selectin. The presence of TNF-α in the culture supernatants of EAV-infected equine AMphi, BMphi, and ECs was confirmed by bioassay, and the virulent KY84 strain of EAV induced significantly more TNF-α in all cell types than did the avirulent CA95 strain. Thus, the data indicate that EAV-induced, macrophage-derived cytokines may contribute to the pathogenesis of EVA in horses, and that the magnitude of the cytokine response of equine AMphi, BMphi, and ECs to EAV infection reflects the virulence of the infecting virus strain
Dynamics of the near response under natural viewing conditions with an open-view sensor
Chirre, Emmanuel; Prieto, Pedro; Artal, Pablo
2015-01-01
We have studied the temporal dynamics of the near response (accommodation, convergence and pupil constriction) in healthy subjects when accommodation was performed under natural binocular and monocular viewing conditions. A binocular open-view multi-sensor based on an invisible infrared Hartmann-Shack sensor was used for non-invasive measurements of both eyes simultaneously in real time at 25Hz. Response times for each process under different conditions were measured. The accommodative responses for binocular vision were faster than for monocular conditions. When one eye was blocked, accommodation and convergence were triggered simultaneously and synchronized, despite the fact that no retinal disparity was available. We found that upon the onset of the near target, the unblocked eye rapidly changes its line of sight to fix it on the stimulus while the blocked eye moves in the same direction, producing the equivalent to a saccade, but then converges to the (blocked) target in synchrony with accommodation. This open-view instrument could be further used for additional experiments with other tasks and conditions. PMID:26504666
Onaolapo, Olakunle James; Aremu, Olaleye Samuel; Onaolapo, Adejoke Yetunde
2017-07-01
The present study investigated changes in behaviour associated with oral monosodium glutamate (a flavouring agent), using the open field, elevated plus maze and conditioned place preference (CPP) paradigms, respectively. Mice were assigned to two groups for CPP [monosodium glutamate (MSG)-naïve (n = 40) and MSG-pretreated (n = 40)] and two groups for open field (OF) and elevated plus maze (EPM) tests [n = 40 each], respectively. Animals in respective groups were then divided into four subgroups (n = 10) (vehicle or MSG (80, 160 and 320 mg/kg)). MSG-naïve mice were observed in the CPP box in three phases (pre-conditioning, conditioning and post-conditioning). Mice were conditioned to MSG or an equivalent volume of saline. The MSG pretreatment group received vehicle or respective doses of MSG daily for 21 days, prior to conditioning. Mice in the OF or EPM groups received vehicle or doses of MSG (orally) for 21 days, at 10 ml/kg. Open field or EPM behaviours were assessed on days 1 and 21. At the end of the experiments, mice in the OF groups were sacrificed and brain homogenates used to assay glutamate and glutamine. Results showed that administration of MSG was associated with a decrease in rearing, dose-related mixed horizontal locomotor, grooming and anxiety-related response and an increase in brain glutamate/glutamine levels. Following exposure to the CPP paradigm, MSG-naïve and MSG-pretreated mice both showed 'drug-paired' chamber preference. The study concluded that MSG (at the administered doses) was associated with changes in open field activities, anxiety-related behaviours and brain glutamate/glutamine levels; its ingestion also probably leads to a stimulation of the brain reward system.
Universal parity effects in the entanglement entropy of XX chains with open boundary conditions
International Nuclear Information System (INIS)
Fagotti, Maurizio; Calabrese, Pasquale
2011-01-01
We consider the Rényi entanglement entropies in the one-dimensional XX spin-chains with open boundary conditions in the presence of a magnetic field. In the case of a semi-infinite system and a block starting from the boundary, we derive rigorously the asymptotic behavior for large block sizes on the basis of a recent mathematical theorem for the determinant of Toeplitz plus Hankel matrices. We conjecture a generalized Fisher–Hartwig form for the corrections to the asymptotic behavior of this determinant that allows the exact characterization of the corrections to the scaling at order o(l -1 ) for any n. By combining these results with conformal field theory arguments, we derive exact expressions also in finite chains with open boundary conditions and in the case when the block is detached from the boundary
An open-source automated continuous condition-based maintenance platform for commercial buildings
Energy Technology Data Exchange (ETDEWEB)
Katipamula, Srinivas; Gowri, Krishnan; Hernandez, George
2016-09-09
This paper describes one such reference process that can be deployed to provide continuous automated conditioned-based maintenance management for buildings that have BIM, a building automation system (BAS) and a computerized maintenance management software (CMMS) systems. The process can be deployed using an open source transactional network platform, VOLTTRON™, designed for distributed sensing and controls and supports both energy efficiency and grid services.
International Nuclear Information System (INIS)
Balasuriya, Udeni B.R.; Dobbe, Jessika C.; Heidner, Hans W.; Smalley, Victoria L.; Navarrette, Andrea; Snijder, Eric J.; MacLachlan, N. James
2004-01-01
We have used an infectious cDNA clone of equine arteritis virus (EAV) and reverse genetics technology to further characterize the neutralization determinants in the GP5 envelope glycoprotein of the virus. We generated a panel of 20 recombinant viruses, including 10 chimeric viruses that each contained the ORF5 (which encodes GP5) of different laboratory, field, and vaccine strains of EAV, a chimeric virus containing the N-terminal ectodomain of GP5 of a European strain of porcine reproductive and respiratory syndrome virus, and 9 mutant viruses with site-specific substitutions in their GP5 proteins. The neutralization phenotype of each recombinant chimeric/mutant strain of EAV was determined with EAV-specific monoclonal antibodies and EAV strain-specific polyclonal equine antisera and compared to that of their parental viruses from which the substituted ORF5 was derived. The data unequivocally confirm that the GP5 ectodomain contains critical determinants of EAV neutralization. Furthermore, individual neutralization sites are conformationally interactive, and the interaction of GP5 with the unglycosylated membrane protein M is likely critical to expression of individual epitopes in neutralizing conformation. Substitution of individual amino acids within the GP5 ectodomain usually resulted in differences in neutralization phenotype of the recombinant viruses, analogous to differences in the neutralization phenotype of field strains of EAV and variants generated during persistent infection of EAV carrier stallions
A stable penalty method for the compressible Navier-Stokes equations: I. Open boundary conditions
DEFF Research Database (Denmark)
Hesthaven, Jan; Gottlieb, D.
1996-01-01
The purpose of this paper is to present asymptotically stable open boundary conditions for the numerical approximation of the compressible Navier-Stokes equations in three spatial dimensions. The treatment uses the conservation form of the Navier-Stokes equations and utilizes linearization...
Weak openness and almost openness
Directory of Open Access Journals (Sweden)
David A. Rose
1984-01-01
Full Text Available Weak openness and almost openness for arbitrary functions between topological spaces are defined as duals to the weak continuity of Levine and the almost continuity of Husain respectively. Independence of these two openness conditions is noted and comparison is made between these and the almost openness of Singal and Singal. Some results dual to those known for weak continuity and almost continuity are obtained. Nearly almost openness is defined and used to obtain an improved link from weak continuity to almost continuity.
Directory of Open Access Journals (Sweden)
Dongyan Shi
2016-01-01
Full Text Available This paper presents free vibration analysis of open and closed shells with arbitrary boundary conditions using a spectro-geometric-Ritz method. In this method, regardless of the boundary conditions, each of the displacement components of open and closed shells is represented simultaneously as a standard Fourier cosine series and several auxiliary functions. The auxiliary functions are introduced to accelerate the convergence of the series expansion and eliminate all the relevant discontinuities with the displacement and its derivatives at the boundaries. The boundary conditions are modeled using the spring stiffness technique. All the expansion coefficients are treated equally and independently as the generalized coordinates and determined using Rayleigh-Ritz method. By using this method, a unified vibration analysis model for the open and closed shells with arbitrary boundary conditions can be established without the need of changing either the equations of motion or the expression of the displacement components. The reliability and accuracy of the proposed method are validated with the FEM results and those from the literature.
International Nuclear Information System (INIS)
Ehling, W.
1984-01-01
Fracture mechanics investigations carried out so far in laboratory conditions cover only part of the material stresses, as effects which occur in nuclear powerstations, in particular, such as corrosion and radioactive radiation are largely left out of account. Therefore experiments including these effects were recently carried out in autoclaves, test rigs simulating reactors (HRD experimental plant) and in experimental reactors. An important parameter of experimental fracture mechanics is the measurement of crack opening displacement (COD). The crack opening is measured with socalled clip gauges (transmitters based on strain gauges, which convert mechanical deformation of springs into electrical signals) on standard samples in the laboratory. It was therefore sensible to use these high temperature strain gauges (HTD) for the development of a measuring system for travel for pressurized water and boiling water reactor conditions. (orig.) [de
OpenCL-Based FPGA Accelerator for 3D FDTD with Periodic and Absorbing Boundary Conditions
Directory of Open Access Journals (Sweden)
Hasitha Muthumala Waidyasooriya
2017-01-01
Full Text Available Finite difference time domain (FDTD method is a very poplar way of numerically solving partial differential equations. FDTD has a low operational intensity so that the performances in CPUs and GPUs are often restricted by the memory bandwidth. Recently, deeply pipelined FPGA accelerators have shown a lot of success by exploiting streaming data flows in FDTD computation. In spite of this success, many FPGA accelerators are not suitable for real-world applications that contain complex boundary conditions. Boundary conditions break the regularity of the data flow, so that the performances are significantly reduced. This paper proposes an FPGA accelerator that computes commonly used absorbing and periodic boundary conditions in many 3D FDTD applications. Accelerator is designed using a “C-like” programming language called OpenCL (open computing language. As a result, the proposed accelerator can be customized easily by changing the software code. According to the experimental results, we achieved over 3.3 times and 1.5 times higher processing speed compared to the CPUs and GPUs, respectively. Moreover, the proposed accelerator is more than 14 times faster compared to the recently proposed FPGA accelerators that are capable of handling complex boundary conditions.
47 CFR 76.1504 - Rates, terms and conditions for carriage on open video systems.
2010-10-01
....1504 Rates, terms and conditions for carriage on open video systems. (a) Reasonable rate principle. An... operator will bear the burden of proof to demonstrate, using the principles set forth below, that the...; (2) Packaging, including marketing and other fees; (3) Talent fees; and (4) A reasonable overhead...
Identification of a divergent genotype of equine arteritis virus from South American donkeys.
Rivas, J; Neira, V; Mena, J; Brito, B; Garcia, A; Gutierrez, C; Sandoval, D; Ortega, R
2017-12-01
A novel equine arteritis virus (EAV) was isolated and sequenced from feral donkeys in Chile. Phylogenetic analysis indicates that the new virus and South African asinine strains diverged at least 100 years from equine EAV strains. The results indicate that asinine strains belonged to a different EAV genotype. © 2017 Blackwell Verlag GmbH.
Oblique radiation lateral open boundary conditions for a regional climate atmospheric model
Cabos Narvaez, William; De Frutos Redondo, Jose Antonio; Perez Sanz, Juan Ignacio; Sein, Dmitry
2013-04-01
The prescription of lateral boundary conditions in regional atmospheric models represent a very important issue for limited area models. The ill-posed nature of the open boundary conditions makes it necessary to devise schemes in order to filter spurious wave reflections at boundaries, being desirable to have one boundary condition per variable. On the other side, due to the essentially hyperbolic nature of the equations solved in state of the art atmospheric models, external data is required only for inward boundary fluxes. These circumstances make radiation lateral boundary conditions a good choice for the filtering of spurious wave reflections. Here we apply the adaptive oblique radiation modification proposed by Mikoyada and Roseti to each of the prognostic variables of the REMO regional atmospheric model and compare it to the more common normal radiation condition used in REMO. In the proposed scheme, special attention is paid to the estimation of the radiation phase speed, essential to detecting the direction of boundary fluxes. One of the differences with the classical scheme is that in case of outward propagation, the adaptive nudging imposed in the boundaries allows to minimize under and over specifications problems, adequately incorporating the external information.
Antiviral activity of a Bacillus sp: P34 peptide against pathogenic viruses of domestic animals
Directory of Open Access Journals (Sweden)
Débora Scopel e Silva
2014-09-01
Full Text Available P34 is an antimicrobial peptide produced by a Bacillus sp. strain isolated from the intestinal contents of a fish in the Brazilian Amazon basin with reported antibacterial activity. The aim of this work was to evaluate the peptide P34 for its in vitro antiviral properties against canine adenovirus type 2 (CAV-2, canine coronavirus (CCoV, canine distemper virus (CDV, canine parvovirus type 2 (CPV-2, equine arteritis virus (EAV, equine influenza virus (EIV, feline calicivirus (FCV and feline herpesvirus type 1 (FHV-1. The results showed that the peptide P34 exhibited antiviral activity against EAV and FHV-1. The peptide P34 inhibited the replication of EAV by 99.9% and FHV-1 by 94.4%. Virucidal activity was detected only against EAV. When P34 and EAV were incubated for 6 h at 37 °C the viral titer reduced from 10(4.5 TCID50 to 10(2.75 TCID50, showing a percent of inhibition of 98.6%. In conclusion, our results demonstrated that P34 inhibited EAV and FHV-1 replication in infected cell cultures and it showed virucidal activity against EAV. Since there is documented resistance to the current drugs used against herpesviruses and there is no treatment for equine viral arteritis, it is advisable to search for new antiviral compounds to overcome these infections.
Thermal condition of open KBS.3H tunnel
International Nuclear Information System (INIS)
Ikonen, Kari
2008-12-01
This report contains the temperature calculations of open KBS-3H type spent nuclear fuel repository, where the fuel canisters are disposed at horizontal position in horizontal tunnels according to the preliminary SKB (Swedish Nuclear Fuel and Waste Management Co) and Posiva plan. The objective of the study is to simulate the operation phase atmospheric conditions in open horizontal tunnels, where the KBS-3H type canister containers and distance blocks are installed. The analyses concern BWR type canisters. The analyses were made as heat conduction problem by taking into account radiation over gaps. A perforated steel plate surrounds a canister and bentonite. Heat transfer through a perforated plate and surrounding air gaps is a complicated three-dimensional heat transfer problem. To simplify the analysis, the gaps around a container and a distance block were taken into account by describing them by a homogenous layer having effective thermal properties. Convection due to natural circulation of humid air in horizontal gaps between the container and rock was not considered. Convection could reduce the temperature variation in the gap. On the other hand, the perforated steel plate has good conductivity and transfers quite well heat in horizontal gaps. Since the actual temperatures of disposal canisters depend in a complicated way on considered time and position, two extreme cases were studied to make the analyses easier. In the first extreme case an infinite queue of canisters are disposed simultaneously. This case overestimates temperatures, since the actual number of canisters is finite and they are not disposed simultaneously. In other extreme case only the first single canister and the first distance block are disposed. This case underestimates temperatures, since the actual number of canisters is greater than one and the canisters heat each other in later phase. The analysis showed that temperatures differ only a little from each other in the two extreme cases
Thermal condition of open KBS.3H tunnel
Energy Technology Data Exchange (ETDEWEB)
Ikonen, Kari (VTT Processes (Finland))
2008-12-15
This report contains the temperature calculations of open KBS-3H type spent nuclear fuel repository, where the fuel canisters are disposed at horizontal position in horizontal tunnels according to the preliminary SKB (Swedish Nuclear Fuel and Waste Management Co) and Posiva plan. The objective of the study is to simulate the operation phase atmospheric conditions in open horizontal tunnels, where the KBS-3H type canister containers and distance blocks are installed. The analyses concern BWR type canisters. The analyses were made as heat conduction problem by taking into account radiation over gaps. A perforated steel plate surrounds a canister and bentonite. Heat transfer through a perforated plate and surrounding air gaps is a complicated three-dimensional heat transfer problem. To simplify the analysis, the gaps around a container and a distance block were taken into account by describing them by a homogenous layer having effective thermal properties. Convection due to natural circulation of humid air in horizontal gaps between the container and rock was not considered. Convection could reduce the temperature variation in the gap. On the other hand, the perforated steel plate has good conductivity and transfers quite well heat in horizontal gaps. Since the actual temperatures of disposal canisters depend in a complicated way on considered time and position, two extreme cases were studied to make the analyses easier. In the first extreme case an infinite queue of canisters are disposed simultaneously. This case overestimates temperatures, since the actual number of canisters is finite and they are not disposed simultaneously. In other extreme case only the first single canister and the first distance block are disposed. This case underestimates temperatures, since the actual number of canisters is greater than one and the canisters heat each other in later phase. The analysis showed that temperatures differ only a little from each other in the two extreme cases
Retention of Text Material under Cued and Uncued Recall and Open and Closed Book Conditions
Nevid, Jeffrey S.; Pyun, Yea Seul; Cheney, Brianna
2016-01-01
Evidence supports the benefits of effortful processing in strengthening retention of newly learned material. The present study compared two forms of effortful processing, uncued (free) recall and cued recall, under both open and closed book conditions, on both immediate and delayed (one-week) test performance. Participants read a section of a…
Chraibi, S.; Lashina, T.A.; Shrubsole, P.; Aries, M.B.C.; van Loenen, E.J.; Rosemann, A.L.P.
2016-01-01
Workplace innovation has been changing the European office landscape into mostly open spaces, where enhanced interaction between people is combined by efficient use of space. However, challenges are found in offering individual preferred conditions in these multi-user spaces, especially when dealing
The role of energy planners in open-free market conditions
International Nuclear Information System (INIS)
Alminana, D. G.
2003-01-01
The evolution of the demand for electricity and natural gas usually follows seasonal patterns. In Mediterranean areas, in summer, a sharp increase in electricity needs in residential and commercial buildings coincides with a marked decrease in natural gas consumption. Air-conditioning systems are an increasingly significant factor in peak electricity demand in premises of all economic areas, particularly residential and commercial but also industrial sectors. Efforts made in recent years regarding the development of low cost air-conditioning equipment have produced in turn an increasing number of shortages due to lack of capacity in the production-transmission-distribution chain. Recent examples in Barcelona (June 2003) or Mallorca (July 2003) are just a reference for an ever-increasing problem. In open-free market conditions, how can this situation be overcome? Energy suppliers adopt strategies of Demand Side Management (DSM) in order to reduce negative impact of load curves which are not 'flat enough'. However, negative impacts are mainly seen in terms of economic operation, ignoring other effects such as energy or environmental collateral effects. From our point of view, Integrated Resources Planning (IRP) is a more powerful tool to take into account all three effects: economic, energy and environmental. IRP cannot be carried out by single energy suppliers, only by an Energy Planner. Two specific technologies can help balance energy loads from excess power demand (peak shaving) and reduced gas consumption (valley filling) in summer: High Efficiency Cogeneration / Trigeneration; High Efficiency Gas-Based Air-Conditioning. Recent COM(2003)416 final Directive 'on the promotion of cogeneration based on a useful heat demand in the internal energy market' (Brussels, July 23, 2003) can be adopted as a confirmation of the above issues. (author)
Stanislawski, Larry V.; Survila, Kornelijus; Wendel, Jeffrey; Liu, Yan; Buttenfield, Barbara P.
2018-01-01
This paper describes a workflow for automating the extraction of elevation-derived stream lines using open source tools with parallel computing support and testing the effectiveness of procedures in various terrain conditions within the conterminous United States. Drainage networks are extracted from the US Geological Survey 1/3 arc-second 3D Elevation Program elevation data having a nominal cell size of 10 m. This research demonstrates the utility of open source tools with parallel computing support for extracting connected drainage network patterns and handling depressions in 30 subbasins distributed across humid, dry, and transitional climate regions and in terrain conditions exhibiting a range of slopes. Special attention is given to low-slope terrain, where network connectivity is preserved by generating synthetic stream channels through lake and waterbody polygons. Conflation analysis compares the extracted streams with a 1:24,000-scale National Hydrography Dataset flowline network and shows that similarities are greatest for second- and higher-order tributaries.
Evaluation of comfort conditions in urban open spaces. Application in the island of Crete
International Nuclear Information System (INIS)
Tsitoura, Marianna; Tsoutsos, Theocharis; Daras, Tryfon
2014-01-01
Highlights: • Outdoor spaces field surveys carried out in four different urban open spaces. • A strong connection between the microclimate and the use of open space. • Human physical and psychological factors can optimize the urban space design. - Abstract: The thermal environment in outdoor public spaces and their level of use are strongly connected. The design of outdoor spaces, especially in urban areas, is very critical in Southern Europe due to their extended use during summertime where the urban heat island phenomenon deteriorates the microclimatic conditions. In this paper the main outcomes of outdoor spaces field surveys are presented, which were carried out in four different urban open spaces in Crete. On site measurements were implemented and a questionnaire was used in order to estimate the thermal comfort of visitors. Thermal indices like Predicted Mean Vote, Physiologically Equivalent Temperature, Standard Effective Temperature, Wet Bulb Globe Temperature are used to evaluate the features of urban microclimate and then are being compared in order to find the most suitable for the Mediterranean microclimate. This suggests another way of approach to the researcher and provides essential tools to the designer
International Nuclear Information System (INIS)
Nitschke, Matthias; Korte, Thomas; Tielesch, Claudia; Ter-Avetisyan, Gohar; Tuennemann, Gisela; Cardoso, M. Cristina; Veit, Michael; Herrmann, Andreas
2008-01-01
Equine arteritis virus (EAV) is an enveloped, positive-stranded RNA virus belonging to the family Arteriviridae. Infection by EAV requires the release of the viral genome by fusion with the respective target membrane of the host cell. We have investigated the entry pathway of EAV into Baby Hamster Kindey cells (BHK). Infection of cells assessed by the plaque reduction assay was strongly inhibited by substances which interfere with clathrin-dependent endocytosis and by lysosomotropic compounds. Furthermore, infection of BHK cells was suppressed when clathrin-dependent endocytosis was inhibited by expression of antisense RNA of the clathrin-heavy chain before infection. These results strongly suggest that EAV is taken up via clathrin-dependent endocytosis and is delivered to acidic endosomal compartments
A water soluble Cu(I)-NHC for CuAAC ligation of unprotected peptides under open air conditions.
Gaulier, Christelle; Hospital, Audrey; Legeret, Bertrand; Delmas, Agnès F; Aucagne, Vincent; Cisnetti, Federico; Gautier, Arnaud
2012-04-25
A reducing agent-free version of CuAAC able to operate under open air conditions is reported. A readily-synthesizable, hydrophilic and highly stable Cu(I)-NHC allows the clean ligations of unprotected peptides comprising sensitive side chains, at millimolar concentrations.
Energy Technology Data Exchange (ETDEWEB)
Lazarevic, J.; Keca, N.; Martinovie, A.
2012-07-01
Seedling mycorrhization acts as an efficient tool for improving the quality of seedlings. In this study, the effectiveness of Suillus granulatus, originating from Pinus heldreichii forests (Montenegro), to produce containerized ectomycorrhizal seedlings of autochthonous Pinus nigra in open field conditions was investigated. Spore (106, 107, 108) and vegetative (1:16, 1:8, 1:4) inoculation on ectomycorrhizal formation and seedling growth were tested. Spore and vegetative inoculums of autochthonous Pisolithus arhizus were used in the same trial as additional control treatments. The utilization of vegetative and spore inoculums of autochthonous S. granulatus has proven to be an effective method of obtaining containerized ectomycorrhizal P. nigra seedlings under open field conditions after 11 months. S. granulatus spore inoculations resulted in well developed ectomycorrhiza, decreasing the growth of the P. nigra seedlings in the first growing season. Mycelial inoculations resulted in slightly developed S. granulatus ectomycorrhiza, which increased the growth of the seedlings. Therefore, it would be feasible to use spore inocula of S. granulatus, with 10{sup 6} spores per plant, to produce ectomycorrhizal P. nigra plants on a large scale. Controlled mycorrhizal inoculation of seedlings is not a common practice in Montenegrin and Serbian nurseries; as such, the obtained results will contribute to the enhancement of nursery production of Pinus nigra and other conifers. This also could be assumed as a starting point for many further efforts and investigations with autochthonous fungal and plant material in this region. (Author) 47 refs.
Open absorption system for cooling and air conditioning using membrane contactors - Final report
Energy Technology Data Exchange (ETDEWEB)
Conde-Petit, M. [M. Conde Engineering, Zuerich (Switzerland); Weber, R.; Dorer, V. [Swiss Federal Laboratories for Materials Testing and Research (EMPA), Duebendorf (Switzerland)
2008-07-01
Air conditioning systems based upon the open absorption principle, essentially an absorption device operating at atmospheric pressure, have been proposed and investigated at many instances in the past eighty years. Their potential for improving energy efficiency is clearly recognized in the earliest research reports. By the mid 1950ies, solar thermal energy was being applied to drive open absorption-based air conditioning systems. For several reasons, however, the open absorption technology was not mature enough to take place in the mainstream. In the past two decades, vigorous efforts have been undertaken to reverse this situation, but success continued to elude, despite the fact that the main problems, such as corrosion, aerosols in the supply air, etc., have been identified. This report details the work and the main results from the MemProDEC Project. In this project innovative solutions were proposed, and successfully investigated, for the corrosion problem and the improvement of efficiency of the absorption process, in particular a new method to cool a very compact absorber. The practically uniform flow distribution for all three streams in the absorber (air, water and desiccant) warrants the contact of the air to be dehumidified with the desiccant over the whole surface of exchange (across a porous membrane). This, together with the cooling with water in counter flow to the air, are the key factors for the excellent effectiveness of the absorber. As the results show, the dehydration effectiveness of the prototype absorber is up to 150 % higher than that previously obtained by others. The solutions developed for compactness and modularity represent an important step in the way to flexible manufacturing, i.e. using a single element size to assemble autonomous air handling units of various nominal capacities. And although the manufacturing methods of the individual elements require improvement, namely by avoiding adhesive bonding, the choice of materials and the
International Nuclear Information System (INIS)
Al-Zeyoudi, Hend; Sasmito, Agus P.; Shamim, Tariq
2015-01-01
Highlights: • Performance evaluation of open-cathode PEM fuel cell stacks with forced air-convection. • Stack performance can vary up to 40% from winter to summer. • Hot and arid condition leads to membrane drying and performance deterioration. • Anode humidification improves the stack performance up to 40% during summer. - Abstract: The open-cathode polymer electrolyte membrane (PEM) fuel cell stack has been a promising candidate as a sustainable energy conversion system for replacing fossil fuel-based energy conversion devices in portable and automotive applications. As the ambient air is directly used to provide both oxidant and cooling, the complex cooling loop can be avoided which reduces the complexity and cost. However, the stack performance is highly affected by ambient conditions, i.e., ambient temperature and humidity. In this study, the effect of monthly ambient air conditions (temperature and humidity) is evaluated with respect to the stack’s power production performance as well as thermal, water and gas management by employing a validated three-dimensional open-cathode PEM fuel cell stack model. The annual climate data from the hot and arid environment of Abu Dhabi, United Arab Emirates (UAE) are used as a case study. The objective is to develop a better fundamental understanding of the interactions of physical phenomena in a fuel cell stack, which can assist in improving the performance and operation of an open-cathode PEM fuel cell-powered vehicle. The results indicate that the stack performance can vary significantly (up to 40%) from winter to summer, especially at high operating currents, with significant changes in the stack temperature and the water content at the membrane. Moreover, the anode humidification results in a significant improvement in the stack performance (up to 40%) in hot and dry conditions. However, a careful balance has to be struck between the humidifier parasitic load and the stack power.
Directory of Open Access Journals (Sweden)
Yonghong Cheng
2015-01-01
Full Text Available To examine when the manufacturer and dominant retailer open their own Internet stores and how setting prices to ensure opening Internet stores are profitable. We consider a two-echelon supply chain with one manufacturer and one dominant retailer. The retailer has a physical store in a monopolist market. Depending on whether the Internet stores are opened successfully by them, we firstly obtain equilibrium prices and profits under four possible supply chain structures. Secondly, we identify several strategic conditions when it is optimal to open an Internet store for the manufacturer and dominant retailer and discuss its implications. It is interesting to note that multichannel retailing is not necessarily the best strategy for the dominant retailer. In addition, we investigate the impacts of problem parameters (the dominant retailer’s bargaining power and consumers’ disutility of purchasing a product from Internet store on the manufacturer and dominant retailer’s pricing policies. We find that the manufacturer’s optimal price at her Internet store is not always being lower than the dominant retailer’s. Finally, we conduct numerical examples to illustrate the theoretical results.
Magic Garden of Bogosav Živković: The present state and proposed protection measures
Directory of Open Access Journals (Sweden)
Živković Nada
2017-01-01
Full Text Available The Magic Garden of Bogosav Živković in the Leskovac village is a 23.32 acres large complex, spontaneously formed in the 1970s. The spatial concept of the artist was to adjust the artistic creativity and presentation to daily household life. In addition to the valuable works of art exhibited in both the open space and interior, the residential and other buildings do not display particular architectural significance; yet, each of these buildings bears impressive marks of the artist in the form of paintings, reliefs, brass eaves or even household items that, when placed in an unusual setting, become exhibits. The aim of the paper is to present the condition of the site, to draw attention to the value of this space and to propose measures for its protection.
Directory of Open Access Journals (Sweden)
Seralathan Sivamani
2017-12-01
Full Text Available Performance and load testing data of a three bladed two stage LENZ type vertical axis wind turbine from the experiments conducted in an open environment condition at Hindustan Institute of Technology and Science, Chennai (location 23.2167°N, 72.6833°E are presented here. Low-wind velocity ranging from 2 to 11 m/s is available everywhere irrespective of climatic seasons and this data provides the support to the researchers using numerical tool to validate and develop an enhanced Lenz type design. Raw data obtained during the measurements are processed and presented in the form so as to compare with other typical outputs. The data is measured at different wind speeds prevalent in the open field condition ranging from 3 m/s to 9 m/s. Keywords: Vertical axis wind turbine, Lenz type, Performance, Two-stage, Open environment measurement
Cavitating Propeller Performance in Inclined Shaft Conditions with OpenFOAM: PPTC 2015 Test Case
Gaggero, Stefano; Villa, Diego
2018-05-01
In this paper, we present our analysis of the non-cavitating and cavitating unsteady performances of the Potsdam Propeller Test Case (PPTC) in oblique flow. For our calculations, we used the Reynolds-averaged Navier-Stokes equation (RANSE) solver from the open-source OpenFOAM libraries. We selected the homogeneous mixture approach to solve for multiphase flow with phase change, using the volume of fluid (VoF) approach to solve the multiphase flow and modeling the mass transfer between vapor and water with the Schnerr-Sauer model. Comparing the model results with the experimental measurements collected during the Second Workshop on Cavitation and Propeller Performance - SMP'15 enabled our assessment of the reliability of the open-source calculations. Comparisons with the numerical data collected during the workshop enabled further analysis of the reliability of different flow solvers from which we produced an overview of recommended guidelines (mesh arrangements and solver setups) for accurate numerical prediction even in off-design conditions. Lastly, we propose a number of calculations using the boundary element method developed at the University of Genoa for assessing the reliability of this dated but still widely adopted approach for design and optimization in the preliminary stages of very demanding test cases.
Sree, Dave
2015-01-01
Near-field acoustic power level analysis of F31A31 open rotor model has been performed to determine its noise characteristics at simulated cruise flight conditions. The non-proprietary parts of the test data obtained from experiments in the 8x6 supersonic wind tunnel were provided by NASA-Glenn Research Center. The tone and broadband components of total noise have been separated from raw test data by using a new data analysis tool. Results in terms of sound pressure levels, acoustic power levels, and their variations with rotor speed, freestream Mach number, and input shaft power, with different blade-pitch setting angles at simulated cruise flight conditions, are presented and discussed. Empirical equations relating models acoustic power level and input shaft power have been developed. The near-field acoustic efficiency of the model at simulated cruise conditions is also determined. It is hoped that the results presented in this work will serve as a database for comparison and improvement of other open rotor blade designs and also for validating open rotor noise prediction codes.
International Nuclear Information System (INIS)
Ishibashi, Nobuyuki; Onogi, Tetsuya
1989-01-01
Consistency conditions of open string theories, which can be a powerful tool in open string model building, are proposed. By making use of these conditions and assuming a simple prescription for the Chan-Paton factors, open string theories in several backgrounds are studied. We show that 1. there exist a large number of consistent bosonic open string theories on Z 2 orbifolds, 2. SO(32) type I superstring is the unique consistent model among fermionic string theories on the ten-dimensional flat Minkowski space, and 3. with our prescription for the Chan-Paton factors, there exist no consistent open superstring theories on (six-dimensional Minkowski space-time) x (Z 2 orbifold). (orig.)
Cruz, F; Fores, P; Mughini-Gras, L; Ireland, J; Moreno, M A; Newton, R
2016-09-01
Equine viral arteritis (EVA), a disease caused by infection with the equine arteritis virus (EAV), is present in many European countries. In Spain, the last confirmed outbreak was reported in 1992 and there is a paucity of seroprevalence studies. The disease has a major impact on the equine breeding industry, which is mainly represented by Spanish Purebred (SP) horses in Spain. To estimate the seroprevalence of EAV in the breeding SP horse population in central Spain and identify potential horse and studfarm level factors associated with seropositivity to EAV. Cross-sectional study. Individual serum samples from 555 SP horses, collected between September 2011 and November 2013 at 35 studfarms, were tested using a commercially available EAV antibody ELISA and seroneutralisation as the World Organisation for Animal Health reference confirmation test for samples with positive and equivocal results. Data on factors putatively associated with seropositivity to EAV were collected via a questionnaire and examined using random effects logistic regression for analysis of clustered data. Equine arteritis virus seroprevalence in the SP breeding population in central Spain standardised for the sex distribution of the reference horse population, was estimated to be 16.8% (95% confidence interval 5.2-28.5%). Increasing numbers of breeding mares on the studfarm and increasing percentage of mares with reproductive problems during the last 12 months were identified as being positively associated with EAV seropositivity. Mares vaccinated against Equine herpesvirus-1 (EHV-1) and/or -4 (EHV-4) were also positively associated with EAV seropositivity. These findings are of importance to ensure appropriate biosecurity measures for studfarms are carried out and may help facilitate the development of an EVA surveillance programme in the SP breeding horse population. © 2015 EVJ Ltd.
International Nuclear Information System (INIS)
Morita, Ryo; Inada, Fumio
2007-01-01
A steam control valve might cause vibrations of piping when the valve opening is in a middle condition. For rationalization of maintenance and management of the plant, the valve should be improved, but it is difficult to understand flow characteristics in detail by experiment because flow around the valve is complex 3D structure and becomes supersonic (M>1). Therefore, it is necessary to clarify the cause of the vibrations and to develop the countermeasures by CFD (Computational Fluid Dynamics) technology. In previous researches, we clarified a mechanism of the pressure fluctuations in the middle opening condition and suggested the new valve shape (named 'Extended Valve') that can suppress the pressure fluctuations by air experiments and CFD calculations. Then, we also conducted steam experiments and CFD calculations to understand the differences between air and the steam, and found that the pressure fluctuations in the middle opening condition also occurred in the steam tests and the differences between the air and steam were not remarkable. In this report, to clarify the effects of valve and valve seat shape in steam flow condition, we conduct the steam experiments with various valve and seat shape. As a result, we find the change of the valve seat can decrease the amplitude of pressure fluctuations, but can not quite suppress the pressure fluctuations in the middle opening condition. Then, we apply the 'Extended Valve' to clarify the valve shape effect, and find that the extended valve suppresses the pressure fluctuations in the middle opening condition completely and decreases the pressure amplitude drastically. (author)
International Nuclear Information System (INIS)
Gaspar, Pedro Dinis; Carrilho Goncalves, L.C.; Pitarma, R.A.
2011-01-01
The vertical open refrigerated display cabinets suffer alterations of their thermal performance and energy efficiency due to variations of ambient air conditions. The air curtain provides an aerothermodynamics insulation effect that can be evaluated by the thermal entrainment factor calculation as an engineering approximation or by the calculus of all sensible and latent thermal loads. This study presents the variation of heat transfer rate and thermal entrainment factor obtained through experimental tests carried out for different ambient air conditions, varying air temperature, relative humidity, velocity and its direction relatively to the display cabinet frontal opening. The thermal entrainment factor are analysed and compared with the total sensible and latent heats results for the experimental tests. From an engineering point of view, it is concluded that thermal entrainment factor cannot be used indiscriminately, although its use is suitable to design better cabinet under the same climate class condition.
Kalemkerian, P B; Metz, G E; Peral-Garcia, P; Echeverria, M G; Giovambattista, G; Díaz, S
2012-12-01
Polymorphisms at Major Histocompatibility Complex (MHC) genes have been associated with resistance/susceptibility to infectious diseases in domestic animals. The aim of this investigation was to evaluate whether polymorphisms of the DRA gene the Equine Lymphocyte Antigen is associated with susceptibility to Equine Arteritis Virus (EAV) infection in horses in Argentina. The equine DRA gene was screened for polymorphisms using Pyrosequencing® Technology which allowed the detection of three ELA-DRA exon 2 alleles. Neither allele frequencies nor genotypic differentiation exhibited any statistically significant (P-values=0.788 and 0.745) differences between the EAV-infected and no-infected horses. Fisher's exact test and OR calculations did not show any significant association. As a consequence, no association could be established between the serological condition and ELA-DRA. Copyright © 2012 Elsevier Ltd. All rights reserved.
Chinula, Dingani; Sikaala, Chadwick H; Chanda-Kapata, Pascalina; Hamainza, Busiku; Zulu, Reuben; Reimer, Lisa; Chizema, Elizabeth; Kiware, Samson; Okumu, Fredros O; Killeen, Gerry
2018-04-13
The effectiveness of long-lasting insecticidal-treated nets (LLINs) and indoor residual spraying (IRS) for malaria control is threatened by resistance to commonly used pyrethroid insecticides. Rotations, mosaics, combinations, or mixtures of insecticides from different complementary classes are recommended by the World Health Organization (WHO) for mitigating against resistance, but many of the alternatives to pyrethroids are prohibitively expensive to apply in large national IRS campaigns. Recent evaluations of window screens and eave baffles (WSEBs) treated with pirimiphos-methyl (PM), to selectively target insecticides inside houses, demonstrated malaria vector mortality rates equivalent or superior to IRS. However, the durability of efficacy when co-applied with polyacrylate-binding agents (BA) remains to be established. This study evaluated whether WSEBs, co-treated with PM and BA have comparable wash resistance to LLINs and might therefore remain insecticidal for years rather than months. WHO-recommended wire ball assays of insecticidal efficacy were applied to polyester netting treated with or without BA plus 1 or 2 g/sq m PM. They were then tested for insecticidal efficacy using fully susceptible insectary-reared Anopheles gambiae mosquitoes, following 0, 5, 10, 15, then 20 washes as per WHO-recommended protocols for accelerated ageing of LLINs. This was followed by a small-scale field trial in experimental huts to measure malaria vector mortality achieved by polyester netting WSEBs treated with BA and 2 g/sq m PM after 0, 10 and then 20 standardized washes, alongside recently applied IRS using PM. Co-treatment with BA and either dosage of PM remained insecticidal over 20 washes in the laboratory. In experimental huts, WSEBs treated with PM plus BA consistently killed similar proportions of Anopheles arabiensis mosquitoes to PM-IRS (both consistently ≥ 94%), even after 20 washes. Co-treating WSEBs with both PM and BA results in wash
Equine arteritis virus (EAV) and porcine reproductive and respiratory syndrome virus (PRRSV) are members of family Arteriviridae; they share many biological properties but differ significantly in cellular tropism. Using an infectious cDNA clone of EAV, we engineered a panel of six chimeric viruses b...
DEFF Research Database (Denmark)
Larsen, Lars Erik; Storgaard, Torben; Holm, Elisabeth
2001-01-01
The study describes for the first time the phylogenetic relationship between equine arteritis virus (EAV) isolated from asymptomatic virus-shedding stallions and fatal cases of equine viral arteritis (EVA) in an European country. EAV was isolated from three dead foals and an aborted foetus during...
Operational readiness review of the Low Level Waste vaults at Savannah River Site: A case study
International Nuclear Information System (INIS)
Ahmad, M.; McVay, C.; Venkatesh, S.
1994-01-01
Low Level radioactive Waste (LLW) at the Savannah River Site at Aiken, South Carolina, has traditionally been disposed of using engineered trenches in accordance with the guidelines and technology existing at the time. Recently, subgrade concrete vaults known as E-Area Vaults (EAV) have been constructed at SRS. The EAV project is a comprehensive effort for upgrading LLW disposal at SRS based on meeting the requirements of current Department of Energy (DOE) Orders, and addressing more stringent federal and state regulations. The EAV is a first of its kind state-of-the-art facility designed and built in the United States to receive LLW. Westinghouse Savannah River Company (WSRC) conducted an Operational Readiness Review (ORR) of the vaults prior to startup. The objective of the EAV ORR was to perform a comprehensive review of the operational readiness of the facilities per DOE guidelines including Defense Nuclear Facilities Safety Board (DNFSB) recommendations. This review included assessing construction of the vaults as per design, adequate approved procedures, and training of all the personnel associated with the facility operations. EAV ORR incorporated the lessons learned from other DOE ORRs, included DNFSB recommendations, used a graded approach, and utilized subject matter experts for each functional area of assessment
A modular open platform for systematic functional studies under physiological conditions
Mulholland, Christopher B.; Smets, Martha; Schmidtmann, Elisabeth; Leidescher, Susanne; Markaki, Yolanda; Hofweber, Mario; Qin, Weihua; Manzo, Massimiliano; Kremmer, Elisabeth; Thanisch, Katharina; Bauer, Christina; Rombaut, Pascaline; Herzog, Franz; Leonhardt, Heinrich; Bultmann, Sebastian
2015-01-01
Any profound comprehension of gene function requires detailed information about the subcellular localization, molecular interactions and spatio-temporal dynamics of gene products. We developed a multifunctional integrase (MIN) tag for rapid and versatile genome engineering that serves not only as a genetic entry site for the Bxb1 integrase but also as a novel epitope tag for standardized detection and precipitation. For the systematic study of epigenetic factors, including Dnmt1, Dnmt3a, Dnmt3b, Tet1, Tet2, Tet3 and Uhrf1, we generated MIN-tagged embryonic stem cell lines and created a toolbox of prefabricated modules that can be integrated via Bxb1-mediated recombination. We used these functional modules to study protein interactions and their spatio-temporal dynamics as well as gene expression and specific mutations during cellular differentiation and in response to external stimuli. Our genome engineering strategy provides a versatile open platform for efficient generation of multiple isogenic cell lines to study gene function under physiological conditions. PMID:26007658
Sivamani, Seralathan; T, Micha Premkumar; Sohail, Mohammed; T, Mohan; V, Hariram
2017-12-01
Performance and load testing data of a three bladed two stage LENZ type vertical axis wind turbine from the experiments conducted in an open environment condition at Hindustan Institute of Technology and Science, Chennai (location 23.2167°N, 72.6833°E) are presented here. Low-wind velocity ranging from 2 to 11 m/s is available everywhere irrespective of climatic seasons and this data provides the support to the researchers using numerical tool to validate and develop an enhanced Lenz type design. Raw data obtained during the measurements are processed and presented in the form so as to compare with other typical outputs. The data is measured at different wind speeds prevalent in the open field condition ranging from 3 m/s to 9 m/s.
Quasilocal conservation laws in XXZ spin-1/2 chains: Open, periodic and twisted boundary conditions
Directory of Open Access Journals (Sweden)
Tomaž Prosen
2014-09-01
Full Text Available A continuous family of quasilocal exact conservation laws is constructed in the anisotropic Heisenberg (XXZ spin-1/2 chain for periodic (or twisted boundary conditions and for a set of commensurate anisotropies densely covering the entire easy plane interaction regime. All local conserved operators follow from the standard (Hermitian transfer operator in fundamental representation (with auxiliary spin s=1/2, and are all even with respect to a spin flip operation. However, the quasilocal family is generated by differentiation of a non-Hermitian highest weight transfer operator with respect to a complex auxiliary spin representation parameter s and includes also operators of odd parity. For a finite chain with open boundaries the time derivatives of quasilocal operators are not strictly vanishing but result in operators localized near the boundaries of the chain. We show that a simple modification of the non-Hermitian transfer operator results in exactly conserved, but still quasilocal operators for periodic or generally twisted boundary conditions. As an application, we demonstrate that implementing the new exactly conserved operator family for estimating the high-temperature spin Drude weight results, in the thermodynamic limit, in exactly the same lower bound as for almost conserved family and open boundaries. Under the assumption that the bound is saturating (suggested by agreement with previous thermodynamic Bethe ansatz calculations we propose a simple explicit construction of infinite time averages of local operators such as the spin current.
Cook, R. Frank; Eberth, John; Chelvarajan, R. Lakshman; Artiushin, Sergey; Timoney, Peter J.
2016-01-01
Equine arteritis virus (EAV) is the causative agent of equine viral arteritis (EVA), a respiratory, systemic, and reproductive disease of horses and other equid species. Following natural infection, 10–70% of the infected stallions can become persistently infected and continue to shed EAV in their semen for periods ranging from several months to life. Recently, we reported that some stallions possess a subpopulation(s) of CD3+ T lymphocytes that are susceptible to in vitro EAV infection and that this phenotypic trait is associated with long-term carrier status following exposure to the virus. In contrast, stallions not possessing the CD3+ T lymphocyte susceptible phenotype are at less risk of becoming long-term virus carriers. A genome wide association study (GWAS) using the Illumina Equine SNP50 chip revealed that the ability of EAV to infect CD3+ T lymphocytes and establish long-term carrier status in stallions correlated with a region within equine chromosome 11. Here we identified the gene and mutations responsible for these phenotypes. Specifically, the work implicated three allelic variants of the equine orthologue of CXCL16 (EqCXCL16) that differ by four non-synonymous nucleotide substitutions (XM_00154756; c.715 A → T, c.801 G → C, c.804 T → A/G, c.810 G → A) within exon 1. This resulted in four amino acid changes with EqCXCL16S (XP_001504806.1) having Phe, His, Ile and Lys as compared to EqCXL16R having Tyr, Asp, Phe, and Glu at 40, 49, 50, and 52, respectively. Two alleles (EqCXCL16Sa, EqCXCL16Sb) encoded identical protein products that correlated strongly with long-term EAV persistence in stallions (P<0.000001) and are required for in vitro CD3+ T lymphocyte susceptibility to EAV infection. The third (EqCXCL16R) was associated with in vitro CD3+ T lymphocyte resistance to EAV infection and a significantly lower probability for establishment of the long-term carrier state (viral persistence) in the male reproductive tract. EqCXCL16Sa and Eq
Directory of Open Access Journals (Sweden)
Sanjay Sarkar
2016-12-01
Full Text Available Equine arteritis virus (EAV is the causative agent of equine viral arteritis (EVA, a respiratory, systemic, and reproductive disease of horses and other equid species. Following natural infection, 10-70% of the infected stallions can become persistently infected and continue to shed EAV in their semen for periods ranging from several months to life. Recently, we reported that some stallions possess a subpopulation(s of CD3+ T lymphocytes that are susceptible to in vitro EAV infection and that this phenotypic trait is associated with long-term carrier status following exposure to the virus. In contrast, stallions not possessing the CD3+ T lymphocyte susceptible phenotype are at less risk of becoming long-term virus carriers. A genome wide association study (GWAS using the Illumina Equine SNP50 chip revealed that the ability of EAV to infect CD3+ T lymphocytes and establish long-term carrier status in stallions correlated with a region within equine chromosome 11. Here we identified the gene and mutations responsible for these phenotypes. Specifically, the work implicated three allelic variants of the equine orthologue of CXCL16 (EqCXCL16 that differ by four non-synonymous nucleotide substitutions (XM_00154756; c.715 A → T, c.801 G → C, c.804 T → A/G, c.810 G → A within exon 1. This resulted in four amino acid changes with EqCXCL16S (XP_001504806.1 having Phe, His, Ile and Lys as compared to EqCXL16R having Tyr, Asp, Phe, and Glu at 40, 49, 50, and 52, respectively. Two alleles (EqCXCL16Sa, EqCXCL16Sb encoded identical protein products that correlated strongly with long-term EAV persistence in stallions (P<0.000001 and are required for in vitro CD3+ T lymphocyte susceptibility to EAV infection. The third (EqCXCL16R was associated with in vitro CD3+ T lymphocyte resistance to EAV infection and a significantly lower probability for establishment of the long-term carrier state (viral persistence in the male reproductive tract. EqCXCL16Sa and
Allen, Gina; Halsall, Crispin J; Ukpebor, Justina; Paul, Nigel D; Ridall, Gareth; Wargent, Jason J
2015-01-01
Crops grown under plastic-clad structures or in greenhouses may be prone to an increased frequency of pesticide residue detections and higher concentrations of pesticides relative to equivalent crops grown in the open field. To test this we examined pesticide data for crops selected from the quarterly reports (2004-2009) of the UK's Pesticide Residue Committee. Five comparison crop pairs were identified whereby one crop of each pair was assumed to have been grown primarily under some form of physical protection ('protected') and the other grown primarily in open field conditions ('open'). For each pair, the number of detectable pesticide residues and the proportion of crop samples containing pesticides were statistically compared (n=100 s samples for each crop). The mean concentrations of selected photolabile pesticides were also compared. For the crop pairings of cabbage ('open') vs. lettuce ('protected') and 'berries' ('open') vs. strawberries ('protected') there was a significantly higher number of pesticides and proportion of samples with multiple residues for the protected crops. Statistically higher concentrations of pesticides, including cypermethrin, cyprodinil, fenhexamid, boscalid and iprodione were also found in the protected crops compared to the open crops. The evidence here demonstrates that, in general, the protected crops possess a higher number of detectable pesticides compared to analogous crops grown in the open. This may be due to different pesticide-use regimes, but also due to slower rates of pesticide removal in protected systems. The findings of this study raise implications for pesticide management in protected-crop systems. Copyright © 2014 Elsevier Ltd. All rights reserved.
Rey-Martinez, Jorge; Pérez-Fernández, Nicolás
2016-12-01
The proposed validation goal of 0.9 in intra-class correlation coefficient was reached with the results of this study. With the obtained results we consider that the developed software (RombergLab) is a validated balance assessment software. The reliability of this software is dependent of the used force platform technical specifications. Develop and validate a posturography software and share its source code in open source terms. Prospective non-randomized validation study: 20 consecutive adults underwent two balance assessment tests, six condition posturography was performed using a clinical approved software and force platform and the same conditions were measured using the new developed open source software using a low cost force platform. Intra-class correlation index of the sway area obtained from the center of pressure variations in both devices for the six conditions was the main variable used for validation. Excellent concordance between RombergLab and clinical approved force platform was obtained (intra-class correlation coefficient =0.94). A Bland and Altman graphic concordance plot was also obtained. The source code used to develop RombergLab was published in open source terms.
T-Duality Group for Open String Theory
Kajiura, Hiroshige
2001-01-01
We study T-duality for open strings on tori $\\T^d$. The general boundary conditions for the open strings are constructed, and it is shown that T-duality group, which preserves the mass spectrum of closed strings, preserves also the mass spectrum of the open strings. The open strings are transformed to those with different boundary conditions by T-duality. We also discuss the T-duality for D-brane mass spectrum, and show that the D-branes and the open strings with both ends on them are transfo...
Energy Technology Data Exchange (ETDEWEB)
Futtersack, R., E-mail: romain.futtersack@cea.fr [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Universite Paul Sabatier Toulouse, LAPLACE, 118 Route de Narbonne, F-31062 Toulouse Cedex 9 (France); Tamain, P. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Hagelaar, G. [Universite Paul Sabatier Toulouse, LAPLACE, 118 Route de Narbonne, F-31062 Toulouse Cedex 9 (France); Ghendrih, Ph.; Simonin, A. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France)
2013-07-15
We investigate the impact of both parallel and transverse boundary conditions on the current and charge transport in open field line systems using the TOKAM2D code, which solves a minimal model for interchange turbulence. Various limit test cases are discussed and analyzed. In the parallel direction, the sheath conductivity is found to play an essential role in the stabilization of large-scale potential structures, leading to the formation of transport channel or transport barrier respectively for an insulating end wall or a wall with an enhanced sheath conductivity. On another hand, the addition of transverse boundary conditions intrinsically changes the transport characteristics, influencing both radial profiles and probability density functions. It underlines that in some cases a detailed description of the plasma-wall interaction process is required to get a proper description of the current loop pattern that determines electrostatic turbulent transport.
Dissipation and Residues of Pyrethrins in Leaf Lettuce under Greenhouse and Open Field Conditions.
Pan, Lixiang; Feng, Xiaoxiao; Zhang, Hongyan
2017-07-21
Pyrethrins are nowadays widely used for prevention and control of insects in leaf lettuce. However, there is a concern about the pesticide residue in leaf lettuce. A reliable analytical method for determination of pyrethrins (pyrethrin-and П, cinerin І and П, and jasmolin І and П) in leaf lettuce was developed by using gas chromatography-mass spectrometry (GC-MS). Recoveries of pyrethrins in leaf lettuce at three spiking levels were 99.4-104.0% with relative standard deviations of 0.9-3.1% ( n = 5). Evaluation of dissipation and final residues of pyrethrins in leaf lettuce were determined at six different locations, including the open field, as well as under greenhouse conditions. The initial concentration of pyrethrins in greenhouse (0.57 mg/kg) was higher than in open field (0.25 mg/kg) and the half-life for pyrethrins disappearance in field lettuce (0.7 days) was less than that greenhouse lettuce (1.1 days). Factors such as rainfall, solar radiation, wind speed, and crop growth rate are likely to have caused these results. The final residue in leaf lettuce was far below the maximum residue limits (MRLs) (1 mg/kg established by the European Union (EU), Australia, Korea, Japan).
OpenTURNS, an open source uncertainty engineering software
International Nuclear Information System (INIS)
Popelin, A.L.; Dufoy, A.
2013-01-01
The needs to assess robust performances for complex systems have lead to the emergence of a new industrial simulation challenge: to take into account uncertainties when dealing with complex numerical simulation frameworks. EDF has taken part in the development of an Open Source software platform dedicated to uncertainty propagation by probabilistic methods, named OpenTURNS for Open source Treatment of Uncertainty, Risk and Statistics. OpenTURNS includes a large variety of qualified algorithms in order to manage uncertainties in industrial studies, from the uncertainty quantification step (with possibilities to model stochastic dependence thanks to the copula theory and stochastic processes), to the uncertainty propagation step (with some innovative simulation algorithms as the ziggurat method for normal variables) and the sensitivity analysis one (with some sensitivity index based on the evaluation of means conditioned to the realization of a particular event). It also enables to build some response surfaces that can include the stochastic modeling (with the chaos polynomial method for example). Generic wrappers to link OpenTURNS to the modeling software are proposed. At last, OpenTURNS is largely documented to provide rules to help use and contribution
Open Rotor - Analysis of Diagnostic Data
Envia, Edmane
2011-01-01
NASA is researching open rotor propulsion as part of its technology research and development plan for addressing the subsonic transport aircraft noise, emission and fuel burn goals. The low-speed wind tunnel test for investigating the aerodynamic and acoustic performance of a benchmark blade set at the approach and takeoff conditions has recently concluded. A high-speed wind tunnel diagnostic test campaign has begun to investigate the performance of this benchmark open rotor blade set at the cruise condition. Databases from both speed regimes will comprise a comprehensive collection of benchmark open rotor data for use in assessing/validating aerodynamic and noise prediction tools (component & system level) as well as providing insights into the physics of open rotors to help guide the development of quieter open rotors.
OpenSR: An Open-Source Stimulus-Response Testing Framework
Directory of Open Access Journals (Sweden)
Carolyn C. Matheus
2015-01-01
Full Text Available Stimulus–response (S–R tests provide a unique way to acquire information about human perception by capturing automatic responses to stimuli and attentional processes. This paper presents OpenSR, a user-centered S–R testing framework providing a graphical user interface that can be used by researchers to customize, administer, and manage one type of S–R test, the implicit association test. OpenSR provides an extensible open-source Web-based framework that is platform independent and can be implemented on most computers using any operating system. In addition, it provides capabilities for automatically generating and assigning participant identifications, assigning participants to different condition groups, tracking responses, and facilitating collecting and exporting of data. The Web technologies and languages used in creating the OpenSR framework are discussed, namely, HTML5, CSS3, JavaScript, jQuery, Twitter Bootstrap, Python, and Django. OpenSR is available for free download.
Proceedings of the 12. forum: Croatian Energy Day: Energy consumers in open market conditions
International Nuclear Information System (INIS)
Granic, G.; Jelavic, B.
2003-01-01
The theme of the 12. Forum: Energy Day in Croatia is energy sector liberalisation and the new position of the consumers, changing rapidly and acquiring a completely new perspective. By means of market opening of various energy forms the consumer gains right to choose the energy supplier, quite a radical change in relation to the former, monopolistic relationship. This means that the consumer becomes the centre of attention, as has already been achieved at the mobile phone market. Within new market environment, the consumer becomes product buyer, buyer of the product in principle bearing market characteristics as any other product. However, energy markets reveal numerous peculiarities, distinguishing them from the markets of goods and services, as we have known them for centuries, which function according to well-known market conditions. While part of the energy sector will permanently remain a natural monopoly (transmission / transportation and distribution networks), the opening of the considered market requires information science development, which means it is necessary to apply advanced technology for e.g. measuring devices, etc. In view of such market circumstances it is essential to define the quality of the product including supply stability, voltage quality or agility in responding to customer complaints. On the other hand, these factors cannot be adjusted to each individual consumer-buyer at the moment or at least not ones. The position of the customers-buyers has been solved differently in various countries. The aim of this Forum is to put forward and explain experience and solutions connected to the new customer-buyer role in market circumstances. It is our wish that the participants discuss problems connected to the consumer-buyer position under the following aspects: Present status of market opening for various energy forms in the countries of the EU and in the transition countries; technical preconditions for energy market opening such as information
Conversion Method of the Balance Test Results in Open Jet Tunnel on the Free Flow Conditions
Directory of Open Access Journals (Sweden)
V. T. Bui
2015-01-01
Full Text Available The paper considers a problem of sizing a model and converting the balance test results in the low speed open-jet wind tunnel to free-flow conditions. The ANSYS Fluent commercial code performs flow model calculations in the test section and in the free flow, and the ANSYS ICEM CFD module is used to provide grid generation. A structured grid is generated in the free flow and an unstructured one is provided in the test section. The changes of aerodynamic coefficients are determined at the different values of the blockage factor for the segmental-conical and hemisphere cylinder-cone shapes of the model. The blockage factor values are found at which the interference of the test section – model is neglected. The paper presents a technique to convert the wind tunnel test results to the free flow conditions.
Control buildings for blast resistance
Energy Technology Data Exchange (ETDEWEB)
Brown, G.A.
1982-08-01
Offers advice on interior design for blast-resistant control buildings. Suggests that for the comfort and safety of occupants, special attention must be paid to internal finishes and color schemes. Considers external treatment (e.g. panels, cladding fixings, thermal insulation), air intakes and exhausts, internal finishes (e.g. stud lining method), and internal walls and partitions. Presents diagrams showing construction method for a control building; elimination of ''cold bridge'' at eaves level; staggering door openings to minimize blast effects; and flexure of concrete walls without affecting the inner lining.
Undecidability and Irreducibility Conditions for Open-Ended Evolution and Emergence.
Hernández-Orozco, Santiago; Hernández-Quiroz, Francisco; Zenil, Hector
2018-01-01
Is undecidability a requirement for open-ended evolution (OEE)? Using methods derived from algorithmic complexity theory, we propose robust computational definitions of open-ended evolution and the adaptability of computable dynamical systems. Within this framework, we show that decidability imposes absolute limits on the stable growth of complexity in computable dynamical systems. Conversely, systems that exhibit (strong) open-ended evolution must be undecidable, establishing undecidability as a requirement for such systems. Complexity is assessed in terms of three measures: sophistication, coarse sophistication, and busy beaver logical depth. These three complexity measures assign low complexity values to random (incompressible) objects. As time grows, the stated complexity measures allow for the existence of complex states during the evolution of a computable dynamical system. We show, however, that finding these states involves undecidable computations. We conjecture that for similar complexity measures that assign low complexity values, decidability imposes comparable limits on the stable growth of complexity, and that such behavior is necessary for nontrivial evolutionary systems. We show that the undecidability of adapted states imposes novel and unpredictable behavior on the individuals or populations being modeled. Such behavior is irreducible. Finally, we offer an example of a system, first proposed by Chaitin, that exhibits strong OEE.
Alekseev, Victor; Novikova, Nataliya; Levinskikh, Margarita; Sychev, Vladimir; Yusoff, Fatimah; Azuraidi, Osman
2012-07-01
Dormancy protects animals and plants in harsh environmental conditions from months up to hundred years. This phenomenon is perspective for space researches especially for interplanetary missions. Direct experiments in open space BYORYSK supported in principle the fact of survivorship of bacteria, fungi spores, seed of plants and crustacean dormant cysts. Even though the rate of survivorship in long-term treatments was low but good enough to conclude that biological invasion even to Mars is a real danger. As soon as the BYORYSK lunch was made of metal the possibility for resting stages to survive under UV treatment in vacuum without some protection was not clear. To test it an ESA and RSA equipment titled EXPOSE-R was applied. The EXPOSE-R facility was an external facility attached to the outside of the Zvezda Service Module in ISS in the end of November 2008. It had glace windows transparent for UV-radiation and possibility to measure temperature, space- and UV-radiation. Among a number of experiments requiring exposure to the open space environment it had a biological launch containing resting stages of terrestrial and aquatic organisms. These stages included dried ephippia of cladoceran Daphnia magna differentiated on size, dormant eggs of ostracode Eucypris ornate, cysts of fair-shrimp Streptocephalus torvicornis ( all from hemi desert Caspian area) and Artemis salina from salt lake Crimean populations. All dormant stages were kept in transparent to UV plastic bags placed in three layers. After about two years of exposing in open space dormant stages of 3 species A. salina, D. magna, S. torvicornis successfully survived at different scales but in second and third layers only . The highest level of survivorship was found in A. salina cysts. In preliminary land experiments that imitated land EXPOSE imitation of outside space station UV and vacuum conditions survivorship in resting eggs of D .magna, S. torvicornis and E. ornate was tested also. The total UV dose of
De Ron, Antonio M; Rodiño, Ana P; Santalla, Marta; González, Ana M; Lema, María J; Martín, Isaura; Kigel, Jaime
2016-01-01
Rapid and uniform seed germination and seedling emergence under diverse environmental conditions is a desirable characteristic for crops. Common bean genotypes (Phaseolus vulgaris L.) differ in their low temperature tolerance regarding growth and yield. Cultivars tolerant to low temperature during the germination and emergence stages and carriers of the grain quality standards demanded by consumers are needed for the success of the bean crop. The objectives of this study were (i) to screen the seedling emergence and the phenotypic response of bean germplasm under a range of temperatures in controlled chamber and field conditions to display stress-tolerant genotypes with good agronomic performances and yield potential, and (ii) to compare the emergence of bean seedlings under controlled environment and in open field conditions to assess the efficiency of genebanks standard germination tests for predicting the performance of the seeds in the field. Three trials were conducted with 28 dry bean genotypes in open field and in growth chamber under low, moderate, and warm temperature. Morpho-agronomic data were used to evaluate the phenotypic performance of the different genotypes. Cool temperatures resulted in a reduction of the rate of emergence in the bean genotypes, however, emergence and early growth of bean could be under different genetic control and these processes need further research to be suitably modeled. Nine groups arose from the Principal Component Analysis (PCA) representing variation in emergence time and proportion of emergence in the controlled chamber and in the open field indicating a trend to lower emergence in large and extra-large seeded genotypes. Screening of seedling emergence and phenotypic response of the bean germplasm under a range of temperatures in controlled growth chambers and under field conditions showed several genotypes, as landraces 272, 501, 593, and the cultivar Borlotto, with stress-tolerance at emergence, and high yield
Directory of Open Access Journals (Sweden)
Antonio M. DE RON
2016-08-01
Full Text Available Rapid and uniform seed germination and seedling emergence under diverse environmental conditions is a desirable characteristic for crops. Common bean genotypes (Phaseolus vulgaris L. differ in their low temperature tolerance regarding growth and yield. Cultivars tolerant to low temperature during the germination and emergence stages and carriers of the grain quality standards demanded by consumers are needed for the success of the bean crop. The objectives of this study were i to screen the seedling emergence and the phenotypic response of bean germplasm under a range of temperatures in controlled chamber and field conditions to display stress-tolerant genotypes with good agronomic performances and yield potential, and ii to compare the emergence of bean seedlings under controlled environment and in open field conditions to assess the efficiency of genebanks standard germination tests for predicting the performance of the seeds in the field. Three trials were conducted with 28 dry bean genotypes in open field and in growth chamber under low, moderate and warm temperature. Morpho-agronomic data were used to evaluate the phenotypic performance of the different genotypes. Cool temperatures resulted in a reduction of the rate of emergence in the bean genotypes, however, emergence and early growth of bean could be under different genetic control and these processes need further research to be suitably modeled. Nine groups arose from the Principal Component Analysis (PCA representing variation in emergence time and proportion of emergence in the controlled chamber and in the open field indicating a trend to lower emergence in large and extra-large seeded genotypes. Screening of seedling emergence and phenotypic response of the bean germplasm under a range of temperatures in controlled growth chambers and under field conditions showed several genotypes, as landraces 272, 501, 593 and the cultivar Borlotto, with stress-tolerance at emergence and high
Husáková, Iveta; Münzbergová, Zuzana
2014-01-01
In fragmented landscapes, plant species richness may depend not only on local habitat conditions but also on landscape structure. In addition, both present and past landscape structure may be important for species richness. There are, however, only a few studies that have investigated the relative importance of all of these factors. The aim of this study was to examine the effect of current and past landscape structures and habitat conditions on species richness at dry grassland-like forest openings in a forested landscape and to assess their relative importance for species richness. We analyzed information on past and present landscape structures using aerial photographs from 1938, 1973, 1988, 2000 and 2007. We calculated the area of each locality and its isolation in the present and in the past and the continuity of localities in GIS. At each locality, we recorded all vascular plant species (296 species in 110 forest openings) and information on abiotic conditions of the localities. We found that the current species richness of the forest openings was significantly determined by local habitat conditions as well as by landscape structure in the present and in the past. The highest species richness was observed on larger and more heterogeneous localities with rocks and shallow soils, which were already large and well connected to other localities in 1938. The changes in the landscape structure in the past can thus have strong effects on current species richness. Future studies attempting to understand determinants of species diversity in fragmented landscapes should also include data on past landscape structure, as it may in fact be more important than the present structure.
Business Models for Open Innovation
DEFF Research Database (Denmark)
Saebi, Tina; Foss, Nicolai Juul
Research on open innovation suggests that companies benefit differentially from adopting open innovation strategies; however, it is unclear why this is so. One possible explanation is that companies’ business models are not attuned to open strategies. Accordingly, we propose a contingency model o...... to the open innovation literature by specifying the conditions under which business models are conducive to the success of open innovation strategies.......Research on open innovation suggests that companies benefit differentially from adopting open innovation strategies; however, it is unclear why this is so. One possible explanation is that companies’ business models are not attuned to open strategies. Accordingly, we propose a contingency model...... of open business models by systematically linking open innovation strategies to core business model dimensions, notably the content, structure, governance of transactions. We further illustrate a continuum of open innovativeness, differentiating between four types of open business models. We contribute...
Business Models for Open Innovation
DEFF Research Database (Denmark)
Saebi, Tina; Foss, Nicolai J.
2015-01-01
Research on open innovation suggests that companies benefit differentially from adopting open innovation strategies; however, it is unclear why this is so. One possible explanation is that companies' business models are not attuned to open strategies. Accordingly, we propose a contingency model o...... to the open innovation literature by specifying the conditions under which business models are conducive to the success of open innovation strategies.......Research on open innovation suggests that companies benefit differentially from adopting open innovation strategies; however, it is unclear why this is so. One possible explanation is that companies' business models are not attuned to open strategies. Accordingly, we propose a contingency model...... of open business models by systematically linking open innovation strategies to core business model dimensions, notably the content, structure, governance of transactions. We further illustrate a continuum of open innovativeness, differentiating between four types of open business models. We contribute...
Energy Technology Data Exchange (ETDEWEB)
Conde-Petit, M. [M. Conde Engineering, Zuerich (Switzerland); Weber, R. [Materials Science and Technology (EMPA), Abteilung Bautechnologien, Duebendorf (Switzerland)
2006-11-15
This illustrated annual report for 2006 for the Swiss Federal Office of Energy (SFOE) reports on work being done on the development of an open absorption system for cooling and air-conditioning. The report reviews the construction of a first prototype and the manufacture of its components. The conceptual design of this new type of air handling unit (AHU), operating with a liquid desiccant, is discussed. The AHU is to be autonomous and the system will not require additional mechanical refrigeration. It is to be thermally driven at temperatures below 80 {sup o}C. Waste heat sources, solar collectors, district heating plants and co-generation systems are targeted as providers of thermal energy at this temperature level. Work carried out is reported on, including that on two-stream membrane contactors.
Zhou, X Y; Jiang, H; Bauer-Kugelmann, W; Duffy, J A; Koegel, G; Triftshaeuser, W
1997-01-01
The relationship between the open volume defects and the deposition conditions of superconducting thin-film YBa sub 2 Cu sub 3 O sub 7 sub - sub x was studied by the position lifetime technique. Using a low-energy pulsed positron system, positron lifetime as a function of implantation energy was measured on epitaxial superconducting thin-film YBa sub 2 Cu sub 3 O sub 7 sub - sub x deposited on yttrium stabilized cubic zirconia substrates (YSZ) with pulsed laser deposition in a partial pressure of air under different conditions. The results show that the type of open volume defect is independent of deposition conditions such as the substrate temperature, T sub s , and the air pressure, P sub a. The defect concentration increases with decreasing T sub s and increasing P sub a. (author). Letter-to-the-editor
International Nuclear Information System (INIS)
Morita, Ryo; Inada, Fumio
2006-01-01
A steam control valve might cause vibrations of piping when the valve opening is in a middle condition. For rationalization of maintenance and management of the plant, the valve should be improved, but it is difficult to understand flow characteristics in detail by experiment because flow around the valve is complex 3D structure and becomes supersonic (M>1). Therefore, it is necessary to clarify the cause of the vibrations and to develop improvements by Computational Fluid Dynamics (CFD) technology. In previous researches, we clarified a mechanism of the pressure fluctuations in the middle opening condition and suggested the way to prevent the pressure fluctuations by experiments and CFD calculations. But, as we used air as a working fluid in our previous research instead of steam that is used in the power plant, we couldn't consider effects of condensation and difference of change of the quantity of state between air and steam. In this report, we have conducted steam flow experiments by multi-purpose steam experiment apparatus 'WISSH' and CFD calculations by steam flow code 'MATIS-SC' to clarify those effects. As a result, in the middle opening condition, we have observed rotating pressure fluctuations in the experiment and valve-attached flow and local high-pressure region in the CFD result. These results show the pressure fluctuations in steam experiments and CFD is same kind of the fluctuations found in air experiment and CFD. (author)
Zhang, Ke; Cao, Ping; Ma, Guowei; Fan, Wenchen; Meng, Jingjing; Li, Kaihui
2016-07-01
Using the Chengmenshan Copper Mine as a case study, a new methodology for open pit slope design in karst-prone ground conditions is presented based on integrated stochastic-limit equilibrium analysis. The numerical modeling and optimization design procedure contain a collection of drill core data, karst cave stochastic model generation, SLIDE simulation and bisection method optimization. Borehole investigations are performed, and the statistical result shows that the length of the karst cave fits a negative exponential distribution model, but the length of carbonatite does not exactly follow any standard distribution. The inverse transform method and acceptance-rejection method are used to reproduce the length of the karst cave and carbonatite, respectively. A code for karst cave stochastic model generation, named KCSMG, is developed. The stability of the rock slope with the karst cave stochastic model is analyzed by combining the KCSMG code and the SLIDE program. This approach is then applied to study the effect of the karst cave on the stability of the open pit slope, and a procedure to optimize the open pit slope angle is presented.
Directory of Open Access Journals (Sweden)
Mirian Pezzini dos Santos
2014-07-01
Full Text Available Objetivo O estudo visa avaliar a técnica cognitiva substituição por imagem positiva (SIP no manejo do craving em dependentes de crack. Métodos Ensaio clínico do tipo quase-experimental de análise quantitativa. Amostra por conveniência, composta por 34 homens dependentes de cocaína/crack. Tinham o crack como a droga de escolha, haviam utilizado essa substância pela última vez entre 10 e 20 dias antes do início do tratamento. Os instrumentos aplicados foram: Cocaine Craving Questionnaire-Brief (CCQB, Escala Analógica Visual (EAV para avaliar o craving e o quanto a técnica ajudou e uma ficha com dados sociodemográficos (FSD. Foram realizadas intervenções individuais. Inicialmente, foram aplicados o CCQB, a EAV e a FSD. Depois, os pacientes foram expostos a objetos relacionados ao uso do crack e foram reaplicados os instrumentos CCQB e EAV para mensuração da fissura. A seguir, foi realizada a técnica cognitiva substituição por imagem positiva e foram aplicados, pela terceira vez, o CCQB e a EAV. Resultados Os resultados desta pesquisa demonstraram uma redução dos escores do CCQB e da EAV pela técnica cognitiva SIP em uma amostra cujo perfil corresponde ao padrão geral dos usuários de crack. Conclusão Este estudo, apesar de algumas limitações metodológicas, sugere que a técnica cognitiva substituição por imagem positiva pode ser uma estratégia efetiva no manejo do craving em dependentes de crack.
Energy Technology Data Exchange (ETDEWEB)
Inoue, K; Sunaga, N; Muro, K [Tokyo Metropolitan University, Tokyo (Japan)
1996-10-27
The thermal performance of direct gain passive solar houses was measured. Mr. M`s two-storied RC residence with double glazing windows and thermal storage floors, walls and ceilings of brick or concrete was provided for measurement. Its double eaves of the south window and both SE and SW overhanging exterior walls play a role in sunshade. Mr. I`s two-storied wooden residence with thermal storage RC floors and brick walls, and no eaves of the south window and no overhanging exterior walls was also provided. The summer and winter measurement results were in complete contrast between the residences. In summer, large thermal mass and eaves of Mr. M`s residence were effective, while in winter, small thermal mass and no eaves of Mr. I`s residence were effective. The following ideas are important in design from the viewpoint of indoor thermal environment: a movable sunshade for taking in solar radiation as much as possible in winter, well-balanced arrangement of thermal storage parts with suitable thermal mass corresponding to movement of the sun, a large screen door for cross ventilation in summer, and a night insulation shutter for reducing heat loss in winter. 2 refs., 10 figs., 1 tab.
Pressure-driven opening of carbon nanotubes
Chaban, Vitaly V.; Prezhdo, Oleg V.
2016-03-01
The closing and opening of carbon nanotubes (CNTs) is essential for their applications in nanoscale chemistry and biology. We report reactive molecular dynamics simulations of CNT opening triggered by internal pressure of encapsulated gas molecules. Confined argon generates 4000 bars of pressure inside capped CNT and lowers the opening temperature by 200 K. Chemical interactions greatly enhance the efficiency of CNT opening: fluorine-filled CNTs open by fluorination of carbon bonds at temperature and pressure that are 700 K and 1000 bar lower than for argon-filled CNTs. Moreover, pressure induced CNT opening by confined gases leaves the CNT cylinders intact and removes only the fullerene caps, while the empty CNT decomposes completely. In practice, the increase in pressure can be achieved by near-infrared light, which penetrates through water and biological tissues and is absorbed by CNTs, resulting in rapid local heating. Spanning over a thousand of bars and Kelvin, the reactive and non-reactive scenarios of CNT opening represent extreme cases and allow for a broad experimental control over properties of the CNT interior and release conditions of the confined species. The detailed insights into the thermodynamic conditions and chemical mechanisms of the pressure-induced CNT opening provide practical guidelines for the development of novel nanoreactors, catalysts, photo-catalysts, imaging labels and drug delivery vehicles.
Energy Technology Data Exchange (ETDEWEB)
Mejia D, David; Morillon G, David; Rodriguez V, Luis [Universidad Nacional Autonoma de Mexico (Mexico)
2001-09-01
In this article the evaluation of the solar heat gains through the transparent parts of a building (houses of social interest) is presented; with the purpose of determining the heat gains through windows during summer time and under the following conditions: without solar protection, with the use of eaves, solar breakers and, finally, with the use of both elements. With the determined percentage of the diminution of heat gains, the considered potential of energy saving in air conditioning was obtained that would be available if the houses were constructed with solar control. [Spanish] En este articulo se presenta la evaluacion de las ganancias de calor solar a traves de las partes transparentes de un edificio (viviendas de interes social); con el objeto de determinar las ganancias de calor a traves de ventanas para la epoca de verano y bajo las siguientes condiciones: sin proteccion solar, con el empleo de aleros, con quiebrasoles y, finalmente, con el empleo de ambos elementos. Con el porcentaje determinado de la disminucion de ganancias de calor, se obtuvo el potencial estimado de ahorro de energia en aire acondicionado que se tendria si las viviendas se construyen con control solar.
Directory of Open Access Journals (Sweden)
M. G. Echeverría
2010-02-01
Full Text Available Equine viral arteritis (EVA is a contagious viral disease that frequently causes mild or subclinical infections in adult horses. Only one EAV serotype has been described. However, there are differences in antigenicity, pathogenicity and neutralization characteristics of virus field strains. The interaction of two viral proteins, GP5 and M, is critical for infectivity and amino acid changes in the GP5 sequences have an effect on the neutralizing phenotype, regardless the effects of other viral proteins. The objective of the present study was to evaluate the neutralization phenotypes of the 5 unique Argentine EAV strains reported and to compare them with the neutralization phenotypes of the EAV-UCD reference strain, with special emphasis on the analysis of M and GP5 proteins. The strains had a similar neutralization phenotype pattern when anti-EAV serum, derived from EAV seropositive horses, was used in the analysis. Meanwhile, low titers were observed when equine polyclonal anti-EAV reference sera were used in the assay. Argentine strains have almost the same amino acid substitutions, with the exception of LP01 strain, that mainly involves the first variable region V1, especially in neutralization sites B and C. However, they are fairly different from the EAV-UCD strain. Nevertheless, the nucleotide and amino acid differences observed among the Argentine strains LP02/R, LP02/C, LP02/P and LP-LT-ARG did not show any variations in the neutralization phenotype.La arteritis viral equina (AVE ocasiona infecciones, en su mayoría subclínicas, pero puede causar abortos y enfermedad respiratoria. Si bien se ha descrito un solo serotipo de AVE, existen diferencias en cuanto a la antigenicidad, patogenicidad y patrones de neutralización en las cepas de campo. Los ORF5 y ORF6 del virus codifican las proteínas de envoltura GP5 y M; la interacción entre estas proteínas es crítica para la infectividad. Los cambios en las secuencias de aminoácidos en la
Modelling of RPV lower head under core melt severe accident condition using OpenFOAM
International Nuclear Information System (INIS)
Madokoro, Hiroshi; Kretzschmar, Frank; Miassoedov, Alexei
2017-01-01
Although six years have been passed since the tragic severe accident at Fukushima Daiichi, still large uncertainties exist in modeling of core degradation and reactor pressure vessel (RPV) failure. It is extremely important to obtain a better understanding of complex phenomena in the lower head in order to improve accident management measures. The possible failure mode of reactor pressure vessel and its failure time are especially a matter of importance. Thermal behavior of the molten pool can be simulated by the Phase-change Effective Convectivity Model (PECM), which is a distributed-parameter model developed in the Royal Institute of Technology (KTH), Sweden. The model calculates convective currents not using a pure CFD approach but based on so called “characteristic velocities” that are determined by empirical correlations depending on the geometry and physical properties of the molten pool. At the Karlsruhe Institute of Technology (KIT), the PECM has been implemented in the open-source CFD software OpenFOAM in order to receive detailed predictions of a core melt behavior in the RPV lower head under severe accident conditions. An advantage of using OpenFOAM is that it is very flexible to add and modify models and physical properties. In the current work, the solver is extended to couple PECM with a structure analysis model of the vessel wall. The model considers thermal expansion, plasticity, creep and damage. The model and physical properties are based on those implemented in ANSYS. Although the previous implementation had restriction that the amount of and geometry of the melt cannot be changed, our coupled model allows flexibility of the melt amount and geometry. The extended solver was used to simulate the LIVE-L1 and -L7V experiments and has demonstrated good prediction of the temperature distribution in the molten pool and heat flux distribution through the vessel wall. Regarding the vessel failure the model was applied to one of the FOREVER tests
Acoustic conditions in open plan offices – Pilot test results
Directory of Open Access Journals (Sweden)
Witold Mikulski
2016-10-01
Full Text Available Background: The main source of noise in open plan office are conversations. Office work standards in such premises are attained by applying specific acoustic adaptation. This article presents the results of pilot tests and acoustic evaluation of open space rooms. Material and Methods: Acoustic properties of 6 open plan office rooms were the subject of the tests. Evaluation parameters, measurement methods and criterial values were adopted according to the following standards: PN-EN ISO 3382- 3:2012, PN-EN ISO 3382-2:2010, PN-B-02151-4:2015-06 and PN-B-02151-3:2015-10. Results: The reverberation time was 0.33– 0.55 s (maximum permissible value in offices – 0.6 s; the criterion was met, sound absorption coefficient in relation to 1 m2 of the room’s plan was 0.77–1.58 m2 (minimum permissible value – 1.1 m2; 2 out of 6 rooms met the criterion, distraction distance was 8.5–14 m (maximum permissible value – 5 m; none of the rooms met the criterion, A-weighted sound pressure level of speech at a distance of 4 m was 43.8–54.7 dB (maximum permissible value – 48 dB; 2 out of 6 rooms met the criterion, spatial decay rate of the speech was 1.8–6.3 dB (minimum permissible value – 7 dB; none of the rooms met the criterion. Conclusions: Standard acoustic treatment, containing sound absorbing suspended ceiling, sound absorbing materials on the walls, carpet flooring and sound absorbing workplace barriers, is not sufficient. These rooms require specific advanced acoustic solutions. Med Pr 2016;67(5:653–662
Ecological niches of open ocean phytoplankton taxa
DEFF Research Database (Denmark)
Brun, Philipp Georg; Vogt, Meike; Payne, Mark
2015-01-01
We characterize the realized ecological niches of 133 phytoplankton taxa in the open ocean based on observations from the MAREDAT initiative and a statistical species distribution model (MaxEnt). The models find that the physical conditions (mixed layer depth, temperature, light) govern large...... conditions in the open ocean. Our estimates of the realized niches roughly match the predictions of Reynolds' C-S-R model for the global ocean, namely that taxa classified as nutrient stress tolerant have niches at lower nutrient and higher irradiance conditions than light stress tolerant taxa. Yet...
Directory of Open Access Journals (Sweden)
Helen Cheng
2017-06-01
Full Text Available This study set out to examine the associations between psychological, biomedical and socio-demographic factors in childhood and adulthood associated with the occurrence of self-reported eye conditions in adulthood. In total, 5706 participants with complete data on parental social class at birth, cognitive ability accessed at age 11 years, abnormal eye conditions by the age of 16 years diagnosed by medical professionals, educational qualifications obtained at age 33 years, the Big Five Factor personality traits measured at age 50 years, current occupational levels and self-reported eye conditions at age 54 years were included in the study. Logistic regression analysis showed that among all the factors examined early abnormal eye conditions, traits neuroticism and openness as well as sex were the significant predictors of self-reported eye conditions in adulthood.
Directory of Open Access Journals (Sweden)
Wuttichai Natongchai
2017-11-01
Full Text Available A simple, efficient, and environmentally benign approach for the synthesis of β-amino alcohols is herein described. YCl3 efficiently carried out the ring opening of epoxides by amines to produce β-amino alcohols under solvent-free conditions at room temperature. This catalytic approach is very effective, with several aromatic and aliphatic oxiranes and amines. A mere 1 mol % concentration of YCl3 is enough to deliver β-amino alcohols in good to excellent yields with high regioselectivity.
The Dynamical Invariant of Open Quantum System
Wu, S. L.; Zhang, X. Y.; Yi, X. X.
2015-01-01
The dynamical invariant, whose expectation value is constant, is generalized to open quantum system. The evolution equation of dynamical invariant (the dynamical invariant condition) is presented for Markovian dynamics. Different with the dynamical invariant for the closed quantum system, the evolution of the dynamical invariant for the open quantum system is no longer unitary, and the eigenvalues of it are time-dependent. Since any hermitian operator fulfilling dynamical invariant condition ...
Open strings in the SL(2, R) WZWN model with solution for a rigidly rotating string
DEFF Research Database (Denmark)
Lomholt, Michael Andersen; Larsen, A.L.
2003-01-01
Boundary conditions and gluing conditions for open strings and D-branes in the SL(2, R) WZWN model, corresponding to AdS , are discussed. Some boundary conditions and gluing conditions previously considered in the literature are shown to be incompatible with the variation principle. We then consi......Boundary conditions and gluing conditions for open strings and D-branes in the SL(2, R) WZWN model, corresponding to AdS , are discussed. Some boundary conditions and gluing conditions previously considered in the literature are shown to be incompatible with the variation principle. We...... then consider open string boundary conditions corresponding to a certain field-dependent gluing condition. This allows us to consider open strings with constant energy and angular momentum. Classically, these open strings naturally generalize the open strings in flat Minkowski space. For rigidly rotating open...
Experimental exposure of pregnant mares to the asinine-94 strain of equine arteritis virus
Directory of Open Access Journals (Sweden)
J.T. Paweska
1997-07-01
Full Text Available Clinical, virological and serological responses were evaluated in 10 pregnant mares after different challenge exposures to the asinine-94 strain of equine arteritis virus (EAV. The outcome of maternal infection on the progeny was also investigated. Mares were inoculated intranasally (n = 4, intramuscularly (n = 2, intravenously (n = 1, or contact-exposed (n = 3. All inoculated mares developed pyrexia, 5 showed mild clinical signs related to EAV infection and 2 remained asymptomatic. Viraemia was detected in all the inoculated animals and shedding of virus from the respiratory tract occurred in 6. Five mares were re-challenged intranasally 7 and 15 weeks after inoculation. Clinical signs of the disease in these mares were limited to mild conjunctivitis. After re-challenge, virus was recovered from buffy coat cultures of 2 mares 2-6 days after re-infection. EAV was not recovered from colostrum and milk samples during the 1st week post partum. All inoculated mares seroconverted to EAV 8-12 days post inoculation and also seroconverted after re-challenge. No clinical signs of EAV infection were observed in the 3 mares kept in close contact during the post-inoculation and re-challenge periods. Serum neutralising antibody to the virus was detected in 1 in-contact mare only, while a detectable concentration of specific IgG was found by ELISA in the colostrum of 1 of the other in-contact mares. Eight of the mares gave birth to clinically normal foals, although 1 was born prematurely. Shortly after birth, 7 foals developed fever and variable clinical signs; 5 foals became septicaemic and 3 of them died 2-5 days after birth, while the remaining 2 were euthanased at 1 month of age. EAV was not recovered from the placenta, from buffy coat fractions of blood collected from foals immediately after birth and 1-3 days later, or from a range of tissues taken from the 3 foals that died and 2 that were euthanased. Virus was not isolated from tissues collected from
Nilsson, H.; Cervantes, M. J.
2012-11-01
The flow in the Turbine-99 Kaplan draft tube was thoroughly investigated at three workshops (1999, 2001, 2005), which aimed at determining the state of the art of draft tube simulations. The flow is challenging due to the different flow phenomena appearing simultaneously such as unsteadiness, separation, swirl, turbulence, and a strong adverse pressure gradient. The geometry and the experimentally determined inlet boundary conditions were provided to the Turbine-99 workshop participants. At the final workshop, angular resolved inlet velocity boundary conditions were provided. The rotating non-axi-symmetry of the inlet flow due to the runner blades was thus included. The effect of the rotating angular resolution was however not fully investigated at that workshop. The first purpose of this work is to further investigate this effect. Several different inlet boundary conditions are applied - the angular resolved experimental data distributed at the Turbine-99 workshop, the angular resolved results of a runner simulation with interpolated values using different resolution in the tangential and radial directions, and an axi-symmetric variant of the same numerical data. The second purpose of this work is to compare the results from the OpenFOAM and CFX CFD codes, using as similar settings as possible. The present results suggest that the experimental angular inlet boundary conditions proposed to the workshop are not adequate to simulate accurately the flow in the T-99 draft tube. The reason for this is that the experimental phase-averaged data has some important differences compared to the previously measured time-averaged data. Using the interpolated data from the runner simulation as inlet boundary condition however gives good results as long as the resolution of that data is sufficient. It is shown that the difference between the results using the angular-resolved and the corresponding symmetric inlet data is very small, suggesting that the importance of the angular
International Nuclear Information System (INIS)
Nilsson, H; Cervantes, M J
2012-01-01
The flow in the Turbine-99 Kaplan draft tube was thoroughly investigated at three workshops (1999, 2001, 2005), which aimed at determining the state of the art of draft tube simulations. The flow is challenging due to the different flow phenomena appearing simultaneously such as unsteadiness, separation, swirl, turbulence, and a strong adverse pressure gradient. The geometry and the experimentally determined inlet boundary conditions were provided to the Turbine-99 workshop participants. At the final workshop, angular resolved inlet velocity boundary conditions were provided. The rotating non-axi-symmetry of the inlet flow due to the runner blades was thus included. The effect of the rotating angular resolution was however not fully investigated at that workshop. The first purpose of this work is to further investigate this effect. Several different inlet boundary conditions are applied – the angular resolved experimental data distributed at the Turbine-99 workshop, the angular resolved results of a runner simulation with interpolated values using different resolution in the tangential and radial directions, and an axi-symmetric variant of the same numerical data. The second purpose of this work is to compare the results from the OpenFOAM and CFX CFD codes, using as similar settings as possible. The present results suggest that the experimental angular inlet boundary conditions proposed to the workshop are not adequate to simulate accurately the flow in the T-99 draft tube. The reason for this is that the experimental phase-averaged data has some important differences compared to the previously measured time-averaged data. Using the interpolated data from the runner simulation as inlet boundary condition however gives good results as long as the resolution of that data is sufficient. It is shown that the difference between the results using the angular-resolved and the corresponding symmetric inlet data is very small, suggesting that the importance of the angular
Digital Repository Service at National Institute of Oceanography (India)
Joshi, S.A.; Savant, S.B.; Kulkarni, V.A.; Shenai-Tirodkar, P.; Emparanza, E.J.M.; Jagtap, T.G.
, T. J. and Koteeswaran, R., Ploidy induction and sex con- trol in fish. Hydrobiologia, 1998, 384, 167–243. 11. Rao, G. R., Tripathi, S. D. and Sahu, A. K., Breeding and seed production of the Asian catfish Clarias batrachus (Lin.). Central..., directed forward, lateral margin of eave concave. Eyestalk was short, slender, cornea con- cealed under eye, eave completely covering eye when apposed against carapace. Hepatic margin was produced to triangular, flat, broad, with blunt tip, posterior...
Energy Technology Data Exchange (ETDEWEB)
Chiruta, Daniel [GEMaC, Université de Versailles Saint-Quentin-en-Yvelines, CNRS-UVSQ (UMR 8635), 78035 Versailles Cedex (France); Faculty of Electrical Engineering and Computer Science, Stefan cel Mare University, Suceava 720229 (Romania); Linares, Jorge, E-mail: jorge.linares@uvsq.fr, E-mail: miya@spin.phys.s.u-tokyo.ac.jp; Boukheddaden, Kamel [GEMaC, Université de Versailles Saint-Quentin-en-Yvelines, CNRS-UVSQ (UMR 8635), 78035 Versailles Cedex (France); Miyashita, Seiji, E-mail: jorge.linares@uvsq.fr, E-mail: miya@spin.phys.s.u-tokyo.ac.jp [Department of Physics, Graduate School of Science, University of Tokyo, Bunkyo-Ku, Tokyo (Japan); CREST, JST, 4-1-8 Honcho Kawaguchi, Saitama 332-0012 (Japan)
2014-05-21
In order to explain clearly the role of the open boundary conditions (OBCs) on phase transition in one dimensional system, we consider an Ising model with both short-range (J) and long-range (G) interactions, which has allowed us to study the cooperative nature of spin-crossover (SCO) materials at the nanometer scale. At this end, we developed a transfer-matrix method for one-dimensional (1D) SCO system with free boundary conditions, and we give numerical evidences for how the thermal spin transition curves vary as a function of the physical parameters (J, G) or an applied pressure. Moreover for OBCs case, we have derived the bulk, surface and finite-size contributions to the free energy and we have investigated the variation of these energies as function of J and system size. We have found that the surface free energy behaves like J〈σ〉{sup 2}, where 〈σ〉 is the average magnetization per site. Since the properties of the nanometric scale are dramatically influenced by the system's size (N), our analytical outcomes for the size dependence represent a step to achieve new characteristic of the future devices and also a way to find various novel properties which are absent in the bulk materials.
OpenAPC. Open-Access-Publikationskosten als Open Data
Tullney, Marco
2015-01-01
Präsentationsfolien zum Vortrag „OpenAPC. Open-Access-Publikationskosten als Open Data“ in der Session „Ausgestaltung eines wissenschaftsadäquaten APC-Marktes: Grundsätze, Finanzierungsansätze und Management“ der Open-Access-Tage 2015 in Zürich (https://www.open-access.net/community/open-access-tage/open-access-tage-2015-zuerich/programm/#c1974)
High-gradient experiment on X-band disk-loaded structures
International Nuclear Information System (INIS)
Higo, T.; Taniuchi, T.; Yamamoto, M.; Odagiri, J.; Tokumoto, S.; Mizuno, H.; Takata, K.; Wilson, I.; Wuensch, W.
1993-09-01
The high-gradient performance of two travelling-wave X-band accelerating structures 20 cm long has been studied. One of the structures, KEK, was conditioned up to an average accelerating gradient (Eav) of 68 MV/m in 600 hours, while the other, CERN, reached 85 MV/m in 50 hours. In the latter case the maximum output power was fed from the SLED system and the maximum field inside the structure was 138 MV/m. This maximum level was limited by the available power from the klystron. Operation at the Eav=50 MV/m level was found to be stable for both structures. The associated dark current at this level was less than a few μA for CERN but 20 to 30 μA for KEK. Since the two electrical designs are almost the same the difference in dark current must be attributed to the difference in the two fabrication techniques. Modified Fowler-Northeim plots of downstream dark current showed a change of slope, a kink, around 50 to 60 MV/m above which the field enhancement factor was substantially increased. (author)
Liu, Jason; Lezama, Nicholas; Gasper, Joseph; Kawata, Jennifer; Morley, Sybil; Helmer, Drew; Ciminera, Paul
2016-07-01
The aim of this study was to determine how burn pit emissions exposure is associated with the incidence of respiratory and cardiovascular conditions. We examined the associations between assumed geographic and self-reported burn pit emissions exposure and respiratory and cardiovascular outcomes in participants of the Airborne Hazards and Open Burn Pit Registry. We found significant dose-response associations for higher risk of self-reported emphysema, chronic bronchitis, or chronic obstructive pulmonary disease with increased days of deployment within 2 miles of selected burn pits (P-trend = 0.01) and self-reported burn pit smoke exposure (P-trend = 0.0005). We found associations between burn pit emissions exposure and higher incidence of post-deployment self-reported respiratory and cardiovascular conditions, but these findings should be interpreted with caution because the surrogate measurements of burn pit emissions exposure in this analysis may not reflect individual exposure levels.
Open Standards, Open Source, and Open Innovation: Harnessing the Benefits of Openness
Committee for Economic Development, 2006
2006-01-01
Digitization of information and the Internet have profoundly expanded the capacity for openness. This report details the benefits of openness in three areas--open standards, open-source software, and open innovation--and examines the major issues in the debate over whether openness should be encouraged or not. The report explains each of these…
Topological defects in open string field theory
Kojita, Toshiko; Maccaferri, Carlo; Masuda, Toru; Schnabl, Martin
2018-04-01
We show how conformal field theory topological defects can relate solutions of open string field theory for different boundary conditions. To this end we generalize the results of Graham and Watts to include the action of defects on boundary condition changing fields. Special care is devoted to the general case when nontrivial multiplicities arise upon defect action. Surprisingly the fusion algebra of defects is realized on open string fields only up to a (star algebra) isomorphism.
International Nuclear Information System (INIS)
Bharuthram, R.; Misthry, S.S.; Yu, M.Y.
1996-01-01
Three points are discussed: (a) the models of boundary conditions; (b) the mean velocity of hot electrons and their density; (c) the validity of the term open-quote open-quote electron acoustic waves.close-quote close-quote
Open Ephys: an open-source, plugin-based platform for multichannel electrophysiology.
Siegle, Joshua H; López, Aarón Cuevas; Patel, Yogi A; Abramov, Kirill; Ohayon, Shay; Voigts, Jakob
2017-08-01
Closed-loop experiments, in which causal interventions are conditioned on the state of the system under investigation, have become increasingly common in neuroscience. Such experiments can have a high degree of explanatory power, but they require a precise implementation that can be difficult to replicate across laboratories. We sought to overcome this limitation by building open-source software that makes it easier to develop and share algorithms for closed-loop control. We created the Open Ephys GUI, an open-source platform for multichannel electrophysiology experiments. In addition to the standard 'open-loop' visualization and recording functionality, the GUI also includes modules for delivering feedback in response to events detected in the incoming data stream. Importantly, these modules can be built and shared as plugins, which makes it possible for users to extend the functionality of the GUI through a simple API, without having to understand the inner workings of the entire application. In combination with low-cost, open-source hardware for amplifying and digitizing neural signals, the GUI has been used for closed-loop experiments that perturb the hippocampal theta rhythm in a phase-specific manner. The Open Ephys GUI is the first widely used application for multichannel electrophysiology that leverages a plugin-based workflow. We hope that it will lower the barrier to entry for electrophysiologists who wish to incorporate real-time feedback into their research.
Directory of Open Access Journals (Sweden)
Agustín Góngora O.
2014-09-01
Full Text Available Objective. The goal of this study was to determine the current status of the Equine Arteritis virus (EAV in horse populations in the Orinoquia region of Colombia. Materials and methods. A transversal study was conducted by serological survey of equine (n=100 from 11 municipalities of the Colombian Orinoquia region. Serum samples were tested by virus seroneutralization assay according to the guidelines provided by the World Organization for Animal Health. Results. After testing was carried out no positives samples to EAV were found in the population analyzed. Conclusions. Although the sample size of the population screened in this study does not represent the total equine population size for the region or the country, data obtained has shown the absence of EAV infection in these animals. However, a wider study area including other regions of the country, with a feasible statistical design, would determine if this infection continues to be an exotic disease for Colombia.
Open-field exposure facilitates consummatory extinction.
Justel, Nadia; Psyrdellis, Mariana; Pautassi, Ricardo M
2016-12-07
During extinction, the organism learns that a conditioned stimulus or a conditioned response is no longer associated with an unconditioned stimulus, and as a consequence, a decrement in the response is presented. The exposure to novel situations (e.g. exploration of a novel open field) has been used widely to modulate (i.e. either enhance or deteriorate) learning and memory. The aim of the present study was to test whether open-field exposure could modulate consummatory extinction. The results indicated that open-field exposure accelerated the extinction response (i.e. experimental animals provided novelty exposure had lower consummatory behavior than control animals) when applied before - but not after - the first extinction trial, or when applied before the second extinction trial. The results suggest that environmental treatments such as novelty exposure provide a valuable, nonpharmacological alternative to potentially modulate extinction processes.
Bauer, David J; Kerr, Abigail L; Swain, Rodney A
2011-02-01
Recently identified pathways from the dentate nuclei of the cerebellum to the rostral cerebral cortex via the thalamus suggest a cerebellar role in frontal and prefrontal non-motor functioning. Disturbance of cerebellar morphology and connectivity, particularly involving these cerebellothalamocortical (CTC) projections, has been implicated in motivational and cognitive deficits. The current study explored the effects of CTC disruption on motivation in male Long Evans rats. The results of two experiments demonstrate that electrolytic lesions of the cerebellar dentate nuclei lower breaking points on an operant conditioning progressive ratio schedule and decrease open field exploration compared to sham controls. Changes occurred in the absence of motor impairment, assessed via lever pressing frequency and rotarod performance. Similar elevated plus maze performances between lesioned and sham animals indicated that anxiety did not influence task performance. Our results demonstrate hedonic and purposive motivational reduction and suggest a CTC role in global motivational processes. These implications are discussed in terms of psychiatric disorders such as schizophrenia and autism, in which cerebellar damage and motivational deficits often present concomitantly. Copyright © 2010 Elsevier Inc. All rights reserved.
Window opening behaviour modelled from measurements in Danish dwellings
DEFF Research Database (Denmark)
Andersen, Rune Korsholm; Fabi, Valentina; Toftum, Jorn
2013-01-01
environment.Measurements of occupant's window opening behaviour were conducted in 15 dwellings in Denmark during eight months. Indoor and outdoor environmental conditions were monitored in an effort to relate the behaviour of the occupants to the environmental conditions. The dwellings were categorized......A method of defining occupants' window opening behaviour patterns in simulation programs, based on measurements is proposed.Occupants' window opening behaviour has a strong effect on indoor environment and the energy consumed to sustain it. Only few models of window opening behaviour exist...... and these are solely based on the thermal indoor/outdoor environment. Consequently, users of simulation software are often left with little or no guidance for the modelling of occupants' window opening behaviour, resulting in potentially large discrepancies between real and simulated energy consumption and indoor...
International Nuclear Information System (INIS)
2003-08-01
This order defines the compulsory conditions for organisms to be empowered to measure the radon volume activity in areas open to the public. It concerns general information, the internal organization, information relative to the equipment and the personnel competence. (A.L.B.)
Stationary states of two-level open quantum systems
International Nuclear Information System (INIS)
Gardas, Bartlomiej; Puchala, Zbigniew
2011-01-01
A problem of finding stationary states of open quantum systems is addressed. We focus our attention on a generic type of open system: a qubit coupled to its environment. We apply the theory of block operator matrices and find stationary states of two-level open quantum systems under certain conditions applied on both the qubit and the surrounding.
Oriented open-closed string theory revisited
International Nuclear Information System (INIS)
Zwiebach, B.
1998-01-01
String theory on D-brane backgrounds is open-closed string theory. Given the relevance of this fact, we give details and elaborate upon our earlier construction of oriented open-closed string field theory. In order to incorporate explicitly closed strings, the classical sector of this theory is open strings with a homotopy associative A ∞ algebraic structure. We build a suitable Batalin-Vilkovisky algebra on moduli spaces of bordered Ricmann surfaces, the construction of which involves a few subtleties arising from the open string punctures and cyclicity conditions. All vertices coupling open and closed strings through disks are described explicitly. Subalgebras of the algebra of surfaces with boundaries are used to discuss symmetries of classical open string theory induced by the closed string sector, and to write classical open string field theory on general closed string backgrounds. We give a preliminary analysis of the ghost-dilaton theorem. copyright 1998 Academic Press, Inc
Energy Technology Data Exchange (ETDEWEB)
Umemiya, H; Hirosawa, K [Yamagata University, Yamagata (Japan)
1997-11-25
This paper reports a duct heat collecting system installed in the ECOLO-HOUSE for snow countries. This system is an air heat collecting system of the outside air introducing type utilizing as a solar heat collector the single pitch roof often seen in snow countries. Outside air is introduced from below eaves into a heat collecting duct made by nailing plywoods onto rafters from the attic side to collect heat on the roof. Operating a sirocco fan connected to the induction duct located on the high-floor foundation sucks outside air from an air intake opening under the eaves into the heat collecting duct. Air which has absorbed heat on the roof and been warmed in the heat collecting duct by insolation goes into a heat collecting chamber. The air is sent into the high-floor foundation through the induction duct laid from the heat collecting chamber. Air is exchanged 8.7 times by the fan when it is operated all day continuously. Condensation in the fuel chamber floor and walls during the rainy season has disappeared, and so has odor at the same time. As a result of the humidity measurement, a location into which warm air is sent has difference in humidity as great as 15% from a location where no warm air is sent. 2 refs., 6 figs., 2 tabs.
Directory of Open Access Journals (Sweden)
José Lourenço Kallás
2013-01-01
Full Text Available OBJECTIVES: To make a retrospective analysis and evaluate a clinical response to the control of disc degeneration related pain of 396 patients submitted to percutaneous lumbar nucleoplasty; and to make a record of visual analogical scale (VAS up to a three-year follow-up after the surgical procedure. METHODS: Analysis of VAS score in 396 patients with lumbar disc degeneration related pain, according to anamnesis, clinical examination and magnetic resonance imaging (MRI, without improvement of previous clinical treatment, submitted to percutaneous nucleoplasty. RESULTS: A total of 26% of the patients presented 100% remission of pain or paresthesia, of whom 75% showed at least 50% of pain improvement. The median VAS pain improvement was about 67%. CONCLUSIONS: The median VAS improvement in inferior disc levels was higher than four points. The VAS showed improvement of the pain and paresthesia up to a three-year follow up after the surgical procedure.OBJETIVOS: Analisar retrospectivamente a resposta clínica no controle da dor relacionada à degeneração discal em 396 pacientes submetidos à nucleoplastia percutânea lombar; e fazer um registro da escala analógica visual (EAV com seguimento de três anos após a cirurgia. MÉTODOS: Análise da EAV de 396 pacientes com diagnóstico de hérnia de disco, de acordo com anamnese, exame clínico e imagens por meio de ressonância magnética (RM, sendo que nenhum deles apresentou melhora com tratamento clínico prévio. Estes pacientes foram submetidos à nucleoplastia percutânea. O estudo utilizou, para avaliação, o registro de escala analógica visual (EAV durante seguimento de até três anos após o procedimento cirúrgico. RESULTADOS: Um total de 26% apresentou 100% de remissão da dor ou parestesia; 75% apresentaram pelo menos 50% de melhora da dor. A mediana da EAV de melhora da dor foi de aproximadamente 67%. CONCLUSÕES: Houve melhora da EAV, com mediana maior do que quatro pontos nos
46 CFR 45.143 - Hull openings above freeboard deck.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Hull openings above freeboard deck. 45.143 Section 45.143 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES GREAT LAKES LOAD LINES Conditions of Assignment § 45.143 Hull openings above freeboard deck. Closures for openings above...
A mechanism of midlatitude noontime foE long-term variations inferred from European observations
Mikhailov, A. V.; Perrone, L.; Nusinov, A. A.
2017-04-01
Manually scaled June noontime monthly median foE values at three European stations Rome, Juliusruh, and Slough/Chilton were used to understand the mechanism of foE long-term variations. The 11 year running mean smoothed foE manifests long-term (for some solar cycles) variations with the rising phase at the end of 1960-1985 and the falling phase after 1985. A close relationship (even in details) between (foEave)11y and (R12)11y variations with the correlation coefficient of 0.996 (absolutely significant according to Fisher F criterion) suggests that the Sun is the source of these (foEave)11y long-term variations. After removing solar activity long-term variations the residual (foEave)11y trend is very small ( 0.029% per decade) being absolutely insignificant. This means that all (foEave)11y variations are removed with one solar activity index, (R12)11y, i.e., this means that long-term variations are fully controlled by solar activity. Theory of midlatitude daytime E region tells us that long-term variations of solar EUV in two lines λ = 977 Å (CIII) and λ = 1025.7 Å (HLyβ) and X-ray radiation with λ foE long-term variations have a natural (not anthropogenic) origin related to long-term variations of solar activity. No peculiarities in relation with the last deep solar minimum in 2008-2009 have been revealed.
Simulation Of Aqua-Ammonia Refrigeration System Using The Cape-Open To Cape-Open COCO Simulator
Directory of Open Access Journals (Sweden)
Janavi Gohil
2017-03-01
Full Text Available In this paper we have simulated a flow sheet of aqua ammonia refrigeration system using Cape Open simulator. The main aim of writing this paper is to compare the results obtained from thermodynamic simulation of aqua ammonia refrigeration system and the results obtained from the flow sheet simulation in Cape-Open to Cape-Open COCO simulator. The corresponding COP values obtained from both the sources are calculated and compared. With the error being very minute the calculations using simulator prove to be more efficient and timesaving when compared to the results obtained by calculations done using tedious thermodynamic simulations and constant mass balance for different process conditions.
ORF Alignment: NC_004547 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ength = 381 ... Query: 2 ... KALHFGAGNIGRGFIGKLLADANVELTFADVNQPLLDALNSRKSYSVRIVGDNTQV...EAVS 61 ... KALHFGAGNIGRGFIGKLLADANVELTFADVNQPLLDALNSRKSYSVRIVGDNTQVEAVS Sbjct: 1 ... KALHFGAGNIGRGFIGKLLADANVEL
Effects of the window openings on the micro-environmental condition in a school bus
Li, Fei; Lee, Eon S.; Zhou, Bin; Liu, Junjie; Zhu, Yifang
2017-10-01
School bus is an important micro-environment for children's health because the level of in-cabin air pollution can increase due to its own exhaust in addition to on-road traffic emissions. However, it has been challenging to understand the in-cabin air quality that is associated with complex airflow patterns inside and outside a school bus. This study conducted Computational Fluid Dynamics (CFD) modeling analyses to determine the effects of window openings on the self-pollution for a school bus. Infiltration through the window gaps is modeled by applying variable numbers of active computational cells as a function of the effective area ratio of the opening. The experimental data on ventilation rates from the literature was used to validate the model. Ultrafine particles (UFPs) and black carbon (BC) concentrations were monitored in ;real world; field campaigns using school buses. This modeling study examined the airflow pattern inside the school bus under four different types of side-window openings at 20, 40, and 60 mph (i.e., a total of 12 cases). We found that opening the driver's window could allow the infiltration of exhaust through window/door gaps in the back of school bus; whereas, opening windows in the middle of the school bus could mitigate this phenomenon. We also found that an increased driving speed (from 20 mph to 60 mph) could result in a higher ventilation rate (up to 3.4 times) and lower mean age of air (down to 0.29 time) inside the bus.
HAPPY Team Entry to NIST OpenSAD Challenge
DEFF Research Database (Denmark)
Kinnunen, Tomi; Sholokhov, Alexey; Khoury, Elie
2016-01-01
Speech activity detection (SAD), the task of locating speech segments from a given recording, remains challenging under acoustically degraded conditions. In 2015, National Institute of Standards and Technology (NIST) coordinated OpenSAD bench-mark. We summarize “HAPPY” team effort to Open- SAD...
Herb, Ulrich
2011-01-01
The article discusses the principles of openess, open access and open availability of information based on the examples of open access to scientific information, open government data, open geographical data and open source software.
Dynamic preload indicators fail to predict fluid responsiveness in open-chest conditions
de Waal, Eric E. C.; Rex, Steffen; Kruitwagen, Cas L. J. J.; Kalkman, Cor J.; Buhre, Wolfgang F.
Objective: Dynamic preload indicators like pulse pressure variation (PPV) and stroke volume variation (SVV) are increasingly being used for optimizing cardiac preload since they have been demonstrated to predict fluid responsiveness in a variety of perioperative settings. However, in open-chest
Boundary conditions in random sequential adsorption
Cieśla, Michał; Ziff, Robert M.
2018-04-01
The influence of different boundary conditions on the density of random packings of disks is studied. Packings are generated using the random sequential adsorption algorithm with three different types of boundary conditions: periodic, open, and wall. It is found that the finite size effects are smallest for periodic boundary conditions, as expected. On the other hand, in the case of open and wall boundaries it is possible to introduce an effective packing size and a constant correction term to significantly improve the packing densities.
Udell, C.; Selker, J. S.
2017-12-01
The increasing availability and functionality of Open-Source software and hardware along with 3D printing, low-cost electronics, and proliferation of open-access resources for learning rapid prototyping are contributing to fundamental transformations and new technologies in environmental sensing. These tools invite reevaluation of time-tested methodologies and devices toward more efficient, reusable, and inexpensive alternatives. Building upon Open-Source design facilitates community engagement and invites a Do-It-Together (DIT) collaborative framework for research where solutions to complex problems may be crowd-sourced. However, barriers persist that prevent researchers from taking advantage of the capabilities afforded by open-source software, hardware, and rapid prototyping. Some of these include: requisite technical skillsets, knowledge of equipment capabilities, identifying inexpensive sources for materials, money, space, and time. A university MAKER space staffed by engineering students to assist researchers is one proposed solution to overcome many of these obstacles. This presentation investigates the unique capabilities the USDA-funded Openly Published Environmental Sensing (OPEnS) Lab affords researchers, within Oregon State and internationally, and the unique functions these types of initiatives support at the intersection of MAKER spaces, Open-Source academic research, and open-access dissemination.
openQ*D simulation code for QCD+QED
Campos, Isabel; Fritzsch, Patrick; Hansen, Martin; Krstić Marinković, Marina; Patella, Agostino; Ramos, Alberto; Tantalo, Nazario
2018-03-01
The openQ*D code for the simulation of QCD+QED with C* boundary conditions is presented. This code is based on openQCD-1.6, from which it inherits the core features that ensure its efficiency: the locally-deflated SAP-preconditioned GCR solver, the twisted-mass frequency splitting of the fermion action, the multilevel integrator, the 4th order OMF integrator, the SSE/AVX intrinsics, etc. The photon field is treated as fully dynamical and C* boundary conditions can be chosen in the spatial directions. We discuss the main features of openQ*D, and we show basic test results and performance analysis. An alpha version of this code is publicly available and can be downloaded from http://rcstar.web.cern.ch/.
Directory of Open Access Journals (Sweden)
Mario Fernando Posada Saldarriaga
2015-01-01
Full Text Available This report presents the results of the research on understandings Model for Education in Virtual Environments (Model EAV of the Universidad Pontificia Bolivariana UPB in teaching practices observed in teachers at Medellin. The research question investigates the Model EAV understandings that are evident in the teaching practices of teachers trained in the Diploma in higher education with emphasis in virtual environments for teaching and learning. Conceptually, the research question approaches the study of two proposals described in EAV Model: Pedagogical and Didactic Proposal for teaching in virtual environments in higher education and Formational Proposal for teachers of higher education for reflective articulation of ICT in their teaching practices. The methodological strategy presents a triangulation exercise between this conceptual framework, the discourse of teachers on their teaching practices mediated by ICT and non-participant observation of design and assembly of courses in the Aula Digital UPB. Finally, after the systematization and analysis of the information collected the identification of concepts and applications of the Model allowing supporting the conclusions and recommendations from this project.
Nasalance and nasality at experimental velopharyngeal openings in palatal prosthesis: a case study
LIMA-GREGIO, Aveliny Mantovan; MARINO, Viviane Cristina de Castro; PEGORARO-KROOK, Maria Inês; BARBOSA, Plinio Almeida; AFERRI, Homero Carneiro; DUTKA, Jeniffer de Cassia Rillo
2011-01-01
The use of prosthetic devices for correction of velopharyngeal insufficiency (VPI) is an alternative treatment for patients with conditions that preclude surgery and for those individuals with a hypofunctional velopharynx (HV) with a poor prognosis for the surgical repair of VPI. Understanding the role and measuring the outcome of prosthetic treatment of velopharyngeal dysfunction requires the use of tools that allow for documenting pre- and post-treatment outcomes. Experimental openings in speech bulbs have been used for simulating VPI in studies documenting changes in aerodynamic, acoustic and kinematics aspects of speech associated with the use of palatal prosthetic devices. The use of nasometry to document changes in speech associated with experimental openings in speech bulbs, however, has not been described in the literature. Objective This single-subject study investigated nasalance and nasality at the presence of experimental openings drilled through the speech bulb of a patient with HV. Material and Methods Nasometric recordings of the word "pato" were obtained under 4 velopharyngeal conditions: no-opening (control condition), no speech bulb, speech bulb with a 20 mm2 opening, and speech bulb with 30 mm2 opening. Five speech-language pathologists performed auditory-perceptual ratings while the subject read an oral passage under all conditions. Results Kruskal-Wallis test showed significant difference among conditions (p=0.0002), with Scheffé post hoc test indicating difference from the no-opening condition. Conclusion The changes in nasalance observed after drilling holes of known sizes in a speech bulb suggest that nasometry reflect changes in transfer of sound energy related to different sizes of velopharyngeal opening. PMID:22230996
Open access, open education resources and open data in Uganda ...
African Journals Online (AJOL)
As a follow up to OpenCon 2014, International Federation of Medical Students' Associations (IFMSA) students organized a 3 day workshop Open Access, Open Education Resources and Open Data in Kampala from 15-18 December 2014. One of the aims of the workshop was to engage the Open Access movement in ...
Li, Zhilin; Xiao, Li; Cai, Qin; Zhao, Hongkai; Luo, Ray
2015-08-15
In this paper, a new Navier-Stokes solver based on a finite difference approximation is proposed to solve incompressible flows on irregular domains with open, traction, and free boundary conditions, which can be applied to simulations of fluid structure interaction, implicit solvent model for biomolecular applications and other free boundary or interface problems. For some problems of this type, the projection method and the augmented immersed interface method (IIM) do not work well or does not work at all. The proposed new Navier-Stokes solver is based on the local pressure boundary method, and a semi-implicit augmented IIM. A fast Poisson solver can be used in our algorithm which gives us the potential for developing fast overall solvers in the future. The time discretization is based on a second order multi-step method. Numerical tests with exact solutions are presented to validate the accuracy of the method. Application to fluid structure interaction between an incompressible fluid and a compressible gas bubble is also presented.
Li, Zhilin; Xiao, Li; Cai, Qin; Zhao, Hongkai; Luo, Ray
2016-01-01
In this paper, a new Navier–Stokes solver based on a finite difference approximation is proposed to solve incompressible flows on irregular domains with open, traction, and free boundary conditions, which can be applied to simulations of fluid structure interaction, implicit solvent model for biomolecular applications and other free boundary or interface problems. For some problems of this type, the projection method and the augmented immersed interface method (IIM) do not work well or does not work at all. The proposed new Navier–Stokes solver is based on the local pressure boundary method, and a semi-implicit augmented IIM. A fast Poisson solver can be used in our algorithm which gives us the potential for developing fast overall solvers in the future. The time discretization is based on a second order multi-step method. Numerical tests with exact solutions are presented to validate the accuracy of the method. Application to fluid structure interaction between an incompressible fluid and a compressible gas bubble is also presented. PMID:27087702
Scenario evaluation of open pond microalgae production
Slegers, P.M.; Lösing, M.B.; Wijffels, R.H.; Straten, van G.; Boxtel, van A.J.B.
2013-01-01
To evaluate microalgae production in large scale open ponds under different climatologic conditions, a model-based framework is used to study the effect of light conditions, water temperature and reactor design on trends in algae productivity. Scenario analyses have been done for two algae species
Sree, Dave
2015-01-01
Far-field acoustic power level and performance analyses of open rotor model F31/A31 have been performed to determine its noise characteristics at simulated scaled takeoff, nominal takeoff, and approach flight conditions. The nonproprietary parts of the data obtained from experiments in 9- by 15-Foot Low-Speed Wind Tunnel (9?15 LSWT) tests were provided by NASA Glenn Research Center to perform the analyses. The tone and broadband noise components have been separated from raw test data by using a new data analysis tool. Results in terms of sound pressure levels, acoustic power levels, and their variations with rotor speed, angle of attack, thrust, and input shaft power have been presented and discussed. The effect of an upstream pylon on the noise levels of the model has been addressed. Empirical equations relating model's acoustic power level, thrust, and input shaft power have been developed. The far-field acoustic efficiency of the model is also determined for various simulated flight conditions. It is intended that the results presented in this work will serve as a database for comparison and improvement of other open rotor blade designs and also for validating open rotor noise prediction codes.
International Nuclear Information System (INIS)
Ianko, L.
1993-01-01
This short talk was the opening remarks to the attendees at this conference, presented by the Scientific Secretary, IWG-LMNPP, of the IAEA. This meeting is an effort to aid research on problems related to the general area of nuclear plant aging and life management. In particular it addresses fracture properties of reactor materials and components, both as installed, and at end of service condition. A major concern is relating measurements made on laboratory samples to properties displayed by actual reactor components
Transient flow analysis of integrated valve opening process
Energy Technology Data Exchange (ETDEWEB)
Sun, Xinming; Qin, Benke; Bo, Hanliang, E-mail: bohl@tsinghua.edu.cn; Xu, Xingxing
2017-03-15
Highlights: • The control rod hydraulic driving system (CRHDS) is a new type of built-in control rod drive technology and the integrated valve (IV) is the key control component. • The transient flow experiment induced by IV is conducted and the test results are analyzed to get its working mechanism. • The theoretical model of IV opening process is established and applied to get the changing rule of the transient flow characteristic parameters. - Abstract: The control rod hydraulic driving system (CRHDS) is a new type of built-in control rod drive technology and the IV is the key control component. The working principle of integrated valve (IV) is analyzed and the IV hydraulic experiment is conducted. There is transient flow phenomenon in the valve opening process. The theoretical model of IV opening process is established by the loop system control equations and boundary conditions. The valve opening boundary condition equation is established based on the IV three dimensional flow field analysis results and the dynamic analysis of the valve core movement. The model calculation results are in good agreement with the experimental results. On this basis, the model is used to analyze the transient flow under high temperature condition. The peak pressure head is consistent with the one under room temperature and the pressure fluctuation period is longer than the one under room temperature. Furthermore, the changing rule of pressure transients with the fluid and loop structure parameters is analyzed. The peak pressure increases with the flow rate and the peak pressure decreases with the increase of the valve opening time. The pressure fluctuation period increases with the loop pipe length and the fluctuation amplitude remains largely unchanged under different equilibrium pressure conditions. The research results lay the base for the vibration reduction analysis of the CRHDS.
Directory of Open Access Journals (Sweden)
ARASHLOO, R. S.
2014-05-01
Full Text Available Fault tolerant motor drives are an interesting subject for many applications such as automotive industries and wind power generation. Among different configurations of these systems, five-phase BLDC drives are gaining more importance which is because of their compactness and high efficiency. Due to replacement of field windings by permanent magnets in their rotor structure, the main sources of power losses in these drives are iron (core losses, copper (winding losses, and inverter unit (semiconductor losses. Although low amplitude of power losses in five-phase BLDC drives is an important aspect for many applications, but their efficiency under faulty conditions is not considered in previous studies. In this paper, the efficiency of an outer-rotor five phase BLDC drive is evaluated under normal and different faulty conditions. Open-circuit fault is considered for one, two adjacent and two non-adjacent faulty phases. Iron core losses are calculated via FEM simulations in Flux-Cedrat software, and moreover, inverter losses and winding copper losses are simulated in MATLAB� environment. Experimental evaluations are conducted to evaluate the efficiency of the entire BLDC drive which verifies the theoretical developments.
Adoption of open source digital library software packages: a survey
Jose, Sanjo
2007-01-01
Open source digital library packages are gaining popularity nowadays. To build a digital library under economical conditions open source software is preferable. This paper tries to identify the extent of adoption of open source digital library software packages in various organizations through an online survey. It lays down the findings from the survey.
Bartoletti, Theodore M; Jackman, Skyler L; Babai, Norbert; Mercer, Aaron J; Kramer, Richard H; Thoreson, Wallace B
2011-12-01
Light hyperpolarizes cone photoreceptors, causing synaptic voltage-gated Ca(2+) channels to open infrequently. To understand neurotransmission under these conditions, we determined the number of L-type Ca(2+) channel openings necessary for vesicle fusion at the cone ribbon synapse. Ca(2+) currents (I(Ca)) were activated in voltage-clamped cones, and excitatory postsynaptic currents (EPSCs) were recorded from horizontal cells in the salamander retina slice preparation. Ca(2+) channel number and single-channel current amplitude were calculated by mean-variance analysis of I(Ca). Two different comparisons-one comparing average numbers of release events to average I(Ca) amplitude and the other involving deconvolution of both EPSCs and simultaneously recorded cone I(Ca)-suggested that fewer than three Ca(2+) channel openings accompanied fusion of each vesicle at the peak of release during the first few milliseconds of stimulation. Opening fewer Ca(2+) channels did not enhance fusion efficiency, suggesting that few unnecessary channel openings occurred during strong depolarization. We simulated release at the cone synapse, using empirically determined synaptic dimensions, vesicle pool size, Ca(2+) dependence of release, Ca(2+) channel number, and Ca(2+) channel properties. The model replicated observations when a barrier was added to slow Ca(2+) diffusion. Consistent with the presence of a diffusion barrier, dialyzing cones with diffusible Ca(2+) buffers did not affect release efficiency. The tight clustering of Ca(2+) channels, along with a high-Ca(2+) affinity release mechanism and diffusion barrier, promotes a linear coupling between Ca(2+) influx and vesicle fusion. This may improve detection of small light decrements when cones are hyperpolarized by bright light.
Transient Simulation of Speed-No Load Conditions With An Open-Source Based C++ Code
Casartelli, E.; Mangani, L.; Romanelli, G.; Staubli, T.
2014-03-01
Modern reversible pump-turbines can start in turbine operation very quickly, i.e. within few minutes. Unfortunately no clear design rules for runners with a stable start-up are available, so that certain machines can present unstable characteristics which lead to oscillations in the hydraulic system during synchronization. The so-called S-shape, i.e. the unstable characteristic in turbine brake operation, is defined by the change of sign of the slope of the head curve. In order to assess and understand this kind of instabilities with CFD, fast and reliable methods are needed. Using a 360 degrees model including the complete machine from spiral casing to draft tube the capabilities of a newly developed in-house tool are presented. An ad-hoc simulation is performed from no-load conditions into the S-shape in transient mode and using moving-mesh capabilities, thus being able to capture the opening process of the wicket gates, for example like during start-up. Beside the presentation of the computational methodology, various phenomena encounterd are analyzed and discussed, comparing them with measured and previously computed data, in order to show the capabilities of the developed procedure. Insight in detected phenomena is also given for global data like frequencies of vortical structures and local flow patterns.
Transient Simulation of Speed-No Load Conditions With An Open-Source Based C++ Code
International Nuclear Information System (INIS)
Casartelli, E; Mangani, L; Romanelli, G; Staubli, T
2014-01-01
Modern reversible pump-turbines can start in turbine operation very quickly, i.e. within few minutes. Unfortunately no clear design rules for runners with a stable start-up are available, so that certain machines can present unstable characteristics which lead to oscillations in the hydraulic system during synchronization. The so-called S-shape, i.e. the unstable characteristic in turbine brake operation, is defined by the change of sign of the slope of the head curve. In order to assess and understand this kind of instabilities with CFD, fast and reliable methods are needed. Using a 360 degrees model including the complete machine from spiral casing to draft tube the capabilities of a newly developed in-house tool are presented. An ad-hoc simulation is performed from no-load conditions into the S-shape in transient mode and using moving-mesh capabilities, thus being able to capture the opening process of the wicket gates, for example like during start-up. Beside the presentation of the computational methodology, various phenomena encounterd are analyzed and discussed, comparing them with measured and previously computed data, in order to show the capabilities of the developed procedure. Insight in detected phenomena is also given for global data like frequencies of vortical structures and local flow patterns
International Nuclear Information System (INIS)
Salehi Arashloo, Ramin; Salehifar, Mehdi; Romeral, Luis; Sala, Vicent
2015-01-01
Highlights: • Model predictive deadbeat control of generator stator phase currents. • Fault tolerant control of five-phase BLDC generator. • Control of stator phase currents under normal and open-circuit faulty conditions. • MATLAB simulation and experimental verification of proposed control method. • Verification of robustness and fast respond of proposed controlling method. - Abstract: Fault tolerant control of five-phase brushless direct current (BLDC) machines is gaining more importance in high-safety applications such as offshore wind generators and automotive industries. In many applications, traditional controllers (such as PI controllers) are used to control the stator currents under faulty conditions. These controllers have good performance with dc signals. However, in the case of missing one or two of the phases, appropriate reference currents of these machines have oscillatory dynamics both in phase- and synchronous-reference frames. Non-constant nature of these reference values requires the implication of fast current controllers. In this paper, model predictive deadbeat controllers are proposed to control the stator currents of five-phase BLDC machines under normal and faulty conditions. Open circuit fault is considered for both one and two stator phases, and the behaviour of proposed controlling method is evaluated. This evaluation is generally focused on first, sensitivity of proposed controlling method and second, its speed in following reference current values under transient states. Proposed method is simulated and is verified experimentally on a five-phase BLDC drive
Perceived Speech Privacy in Computer Simulated Open-plan Offices
DEFF Research Database (Denmark)
Pop, Claudiu B.; Rindel, Jens Holger
2005-01-01
In open plan offices the lack of speech privacy between the workstations is one of the major acoustic problems. Improving the speech privacy in an open plan design is therefore the main concern for a successful open plan environment. The project described in this paper aimed to find an objective...... parameter that correlates well with the perceived degree of speech privacy and to derive a clear method for evaluating the acoustic conditions in open plan offices. Acoustic measurements were carried out in an open plan office, followed by data analysis at the Acoustic Department, DTU. A computer model...
Open System Tribology and Influence of Weather Condition.
Lyu, Yezhe; Bergseth, Ellen; Olofsson, Ulf
2016-08-30
The tribology of an open system at temperatures ranging between 3 °C and -35 °C, with and without snow, was investigated using a pin-on-disc tribometer mounted in a temperature-controlled environmental chamber. The relationship between the microstructure and ductility of the materials and the tribology at the contacting surfaces was investigated. The study shows that during continuous sliding, pressure causes snow particles to melt into a liquid-like layer, encouraging the generation of oxide flakes on the contact path. The friction coefficient and wear rate are dramatically reduced through an oxidative friction and wear mechanism. In the absence of snow, the tribological process is controlled by the low temperature brittleness of steel in the temperature range from 3 °C to -15 °C. At these temperatures, cracks are prone to form and extend on the worn surfaces, resulting in the spalling of bulk scraps, which are crushed into debris that increases the friction coefficient and wear rate due to strong abrasion. When the temperature falls to -25 °C, an ice layer condenses on the metal surfaces and relaxes the tribological process in the same way as the added snow particles, which significantly decreases the friction and wear.
Spectral curve for open strings attached to the Y=0 brane
International Nuclear Information System (INIS)
Bajnok, Zoltán; Kim, Minkyoo; Palla, László
2014-01-01
The concept of spectral curve is generalized to open strings in AdS/CFT with integrability preserving boundary conditions. Our definition is based on the logarithms of the eigenvalues of the open monodromy matrix and makes possible to determine all the analytic, symmetry and asymptotic properties of the quasimomenta. We work out the details of the whole construction for the Y=0 brane boundary condition. The quasimomenta of open circular strings are explicitly calculated. We use the asymptotic solutions of the Y-system and the boundary Bethe Ansatz equations to recover the spectral curve in the strong coupling scaling limit. Using the curve the quasiclassical fluctuations of some open string solutions are also studied
Open life science research, open software and the open century
Directory of Open Access Journals (Sweden)
Youhua Chen
2015-05-01
Full Text Available At the age of knowledge explosion and mass scientific information, I highlighted the importance of conducting open science in life and medical researches through the extensive usage of open software and documents. The proposal of conducting open science is to reduce the limited repeatability of researches in life science. I outlined the essential steps for conducting open life science and the necessary standards for creating, reusing and reproducing open materials. Different Creative Commons licenses were presented and compared of their usage scope and restriction. As a conclusion, I argued that open materials should be widely adopted in doing life and medical researches.
Open-geometry Fourier modal method: modeling nanophotonic structures in infinite domains
DEFF Research Database (Denmark)
Häyrynen, Teppo; de Lasson, Jakob Rosenkrantz; Gregersen, Niels
2016-01-01
We present an open-geometry Fourier modal method based on a new combination of open boundary conditions and an efficient k-space discretization. The open boundary of the computational domain is obtained using basis functions that expand the whole space, and the integrals subsequently appearing due...
Directory of Open Access Journals (Sweden)
C. Couder-Castañeda
2015-01-01
Full Text Available A serial source code for simulating a supersonic ejector flow is accelerated using parallelization based on OpenMP and OpenACC directives. The purpose is to reduce the development costs and to simplify the maintenance of the application due to the complexity of the FORTRAN source code. This research follows well-proven strategies in order to obtain the best performance in both OpenMP and OpenACC. OpenMP has become the programming standard for scientific multicore software and OpenACC is one true alternative for graphics accelerators without the need of programming low level kernels. The strategies using OpenMP are oriented towards reducing the creation of parallel regions, tasks creation to handle boundary conditions, and a nested control of the loop time for the programming in offload mode specifically for the Xeon Phi. In OpenACC, the strategy focuses on maintaining the data regions among the executions of the kernels. Experiments for performance and validation are conducted here on a 12-core Xeon CPU, Xeon Phi 5110p, and Tesla C2070, obtaining the best performance from the latter. The Tesla C2070 presented an acceleration factor of 9.86X, 1.6X, and 4.5X compared against the serial version on CPU, 12-core Xeon CPU, and Xeon Phi, respectively.
SEnviro: A Sensorized Platform Proposal Using Open Hardware and Open Standards
Directory of Open Access Journals (Sweden)
Sergio Trilles
2015-03-01
Full Text Available The need for constant monitoring of environmental conditions has produced an increase in the development of wireless sensor networks (WSN. The drive towards smart cities has produced the need for smart sensors to be able to monitor what is happening in our cities. This, combined with the decrease in hardware component prices and the increase in the popularity of open hardware, has favored the deployment of sensor networks based on open hardware. The new trends in Internet Protocol (IP communication between sensor nodes allow sensor access via the Internet, turning them into smart objects (Internet of Things and Web of Things. Currently, WSNs provide data in different formats. There is a lack of communication protocol standardization, which turns into interoperability issues when connecting different sensor networks or even when connecting different sensor nodes within the same network. This work presents a sensorized platform proposal that adheres to the principles of the Internet of Things and theWeb of Things. Wireless sensor nodes were built using open hardware solutions, and communications rely on the HTTP/IP Internet protocols. The Open Geospatial Consortium (OGC SensorThings API candidate standard was used as a neutral format to avoid interoperability issues. An environmental WSN developed following the proposed architecture was built as a proof of concept. Details on how to build each node and a study regarding energy concerns are presented.
SEnviro: a sensorized platform proposal using open hardware and open standards.
Trilles, Sergio; Luján, Alejandro; Belmonte, Óscar; Montoliu, Raúl; Torres-Sospedra, Joaquín; Huerta, Joaquín
2015-03-06
The need for constant monitoring of environmental conditions has produced an increase in the development of wireless sensor networks (WSN). The drive towards smart cities has produced the need for smart sensors to be able to monitor what is happening in our cities. This, combined with the decrease in hardware component prices and the increase in the popularity of open hardware, has favored the deployment of sensor networks based on open hardware. The new trends in Internet Protocol (IP) communication between sensor nodes allow sensor access via the Internet, turning them into smart objects (Internet of Things and Web of Things). Currently, WSNs provide data in different formats. There is a lack of communication protocol standardization, which turns into interoperability issues when connecting different sensor networks or even when connecting different sensor nodes within the same network. This work presents a sensorized platform proposal that adheres to the principles of the Internet of Things and theWeb of Things. Wireless sensor nodes were built using open hardware solutions, and communications rely on the HTTP/IP Internet protocols. The Open Geospatial Consortium (OGC) SensorThings API candidate standard was used as a neutral format to avoid interoperability issues. An environmental WSN developed following the proposed architecture was built as a proof of concept. Details on how to build each node and a study regarding energy concerns are presented.
Xunmin Ou; Xiaoyu Yan; Xu Zhang; Xiliang Zhang
2013-01-01
A life-cycle analysis (LCA) of greenhouse gas (GHG) emissions and energy use was performed to study bio-jet fuel (BJF) production from micro-algae grown in open ponds under Chinese conditions using the Tsinghua University LCA Model (TLCAM). Attention was paid to energy recovery through biogas production and cogeneration of heat and power (CHP) from the residual biomass after oil extraction, including fugitive methane (CH 4 ) emissions during the production of biogas and nitrous oxide (N 2 O) ...
International Nuclear Information System (INIS)
Jarmov, Gjorgi; Popovski, Ljubin; Aleksoski, Borko
2001-01-01
In this paper the basic characteristics of the electric power consumption in the R. Macedonia for the 2000 year are given. The large electric power consumers are presented, as well as possibilities of their participation in the conditions of an open electricity market in Macedonia and the Region
Performance of office workers under various enclosure conditions in state-of-the-art open workplaces
Yoon, Heakyung Cecilia
The objective of this thesis is to more firmly establish the importance of physical attributes of workstations on the performance of workers undertaking a range of complex tasks while subjected to the visual and noise distractions prevalent in state-of-the-art North American office settings. This study investigates objective and subjective evaluations of noise and performance given a range of current physical work environments. The study provides criteria for architects, interior designers and managers, to select distraction-free office environments to deliver better performance. The concluding chapter helps to establish the importance of designing more acoustically responsible work settings in state-of-the-art office projects. With 102 subjects (23 native speakers of English per each of three workstation types), controlled experiments were completed over a six month testing period in three different work settings---four foot partitions on two sides, seated privacy with six foot partitions on three sides, and a closed office with eight foot partitions, a door and a ceiling, with two acoustic environments (office sounds with and without speech at a controlled 45 dBA level at the receiver), the experimental results were statistically significant. Another finding was the lack of a significant effect of background sound variations on simple or complex task performance. That implies the current acoustical evaluation tool, the Articulation Index, may not be an appropriate tool to adequately and conclusively assess the acoustic impact of open workplaces on individual performance. Concerning the impact of acoustic conditions on occupant performance from the experiments, Articulation Index values do not reflect the potential relation of workstation designs and subjects' performance and moods. However, NIC connected with speech privacy rating has the potential to be a better evaluation tool than AI for open workplaces. From the results of this thesis, it is predicted that
Open Access Publishing in the Field of Medical Informatics.
Kuballa, Stefanie
2017-05-01
The open access paradigm has become an important approach in today's information and communication society. Funders and governments in different countries stipulate open access publications of funded research results. Medical informatics as part of the science, technology and medicine disciplines benefits from many research funds, such as National Institutes of Health in the US, Wellcome Trust in UK, German Research Foundation in Germany and many more. In this study an overview of the current open access programs and conditions of major journals in the field of medical informatics is presented. It was investigated whether there are suitable options and how they are shaped. Therefore all journals in Thomson Reuters Web of Science that were listed in the subject category "Medical Informatics" in 2014 were examined. An Internet research was conducted by investigating the journals' websites. It was reviewed whether journals offer an open access option with a subsequent check of conditions as for example the type of open access, the fees and the licensing. As a result all journals in the field of medical informatics that had an impact factor in 2014 offer an open access option. A predominantly consistent pricing range was determined with an average fee of 2.248 € and a median fee of 2.207 €. The height of a journals' open access fee did not correlate with the height of its Impact Factor. Hence, medical informatics journals have recognized the trend of open access publishing, though the vast majority of them are working with the hybrid method. Hybrid open access may however lead to problems in questions of double dipping and the often stipulated gold open access.
International Nuclear Information System (INIS)
Le Roux, W.G.; Bello-Ochende, T.; Meyer, J.P.
2011-01-01
The small-scale open and direct solar thermal Brayton cycle with recuperator has several advantages, including low cost, low operation and maintenance costs and it is highly recommended. The main disadvantages of this cycle are the pressure losses in the recuperator and receiver, turbomachine efficiencies and recuperator effectiveness, which limit the net power output of such a system. The irreversibilities of the solar thermal Brayton cycle are mainly due to heat transfer across a finite temperature difference and fluid friction. In this paper, thermodynamic optimisation is applied to concentrate on these disadvantages in order to optimise the receiver and recuperator and to maximise the net power output of the system at various steady-state conditions, limited to various constraints. The effects of wind, receiver inclination, rim angle, atmospheric temperature and pressure, recuperator height, solar irradiance and concentration ratio on the optimum geometries and performance were investigated. The dynamic trajectory optimisation method was applied. Operating points of a standard micro-turbine operating at its highest compressor efficiency and a parabolic dish concentrator diameter of 16 m were considered. The optimum geometries, minimum irreversibility rates and maximum receiver surface temperatures of the optimised systems are shown. For an environment with specific conditions and constraints, there exists an optimum receiver and recuperator geometry so that the system produces maximum net power output. -- Highlights: → Optimum geometries exist such that the system produces maximum net power output. → Optimum operating conditions are shown. → Minimum irreversibility rates and minimum entropy generation rates are shown. → Net power output was described in terms of total entropy generation rate. → Effects such as wind, recuperator height and irradiance were investigated.
Open Education and the Open Science Economy
Peters, Michael A.
2009-01-01
Openness as a complex code word for a variety of digital trends and movements has emerged as an alternative mode of "social production" based on the growing and overlapping complexities of open source, open access, open archiving, open publishing, and open science. This paper argues that the openness movement with its reinforcing structure of…
TSUNAMI LOADING ON BUILDINGS WITH OPENINGS
Directory of Open Access Journals (Sweden)
P. Lukkunaprasit
2009-01-01
Full Text Available Reinforced concrete (RC buildings with openings in the masonry infill panels have shown superior performance to those without openings in the devastating 2004 Indian Ocean Tsunami. Understanding the effect of openings and the resulting tsunami force is essential for an economical and safe design of vertical evacuation shelters against tsunamis. One-to-one hundred scale building models with square shape in plan were tested in a 40 m long hydraulic flume with 1 m x 1 m cross section. A mild slope of 0.5 degree representing the beach condition at Phuket, Thailand was simulated in the hydraulic laboratory. The model dimensions were 150 mm x 150 mm x 150 mm. Two opening configurations of the front and back walls were investigated, viz., 25% and 50% openings. Pressure sensors were placed on the faces of the model to measure the pressure distribution. A high frequency load cell was mounted at the base of the model to record the tsunami forces. A bi-linear pressure profile is proposed for determining the maximum tsunami force acting on solid square buildings. The influence of openings on the peak pressures on the front face of the model is found to be practically insignificant. For 25% and 50% opening models, the tsunami forces reduce by about 15% and 30% from the model without openings, respectively. The reduction in the tsunami force clearly demonstrates the benefit of openings in reducing the effect of tsunami on such buildings.
Fushimi, Akihiro; Saitoh, Katsumi; Hayashi, Kentaro; Ono, Keisuke; Fujitani, Yuji; Villalobos, Ana M.; Shelton, Brandon R.; Takami, Akinori; Tanabe, Kiyoshi; Schauer, James J.
2017-08-01
Open burning of crop residue is a major source of atmospheric fine particle emissions. We burned crop residues (rice straws, barley straws, wheat straws, and rice husks produced in Japan) in an outdoor chamber and measured particle mass, composition (elemental carbon: EC, organic carbon: OC, ions, elements, and organic species), and oxidative potential in the exhausts. The fine particulate emission factors from the literature were within the range of our values for rice straws but were 1.4-1.9 and 0.34-0.44 times higher than our measured values for barley straw and wheat straw, respectively. For rice husks and wheat straws, which typically lead to combustion conditions that are relatively mild, the EC content of the particles was less than 5%. Levoglucosan seems more suitable as a biomass burning marker than K+, since levoglucosan/OC ratios were more stable than K+/particulate mass ratios among crop species. Stigmasterol and β-sitosterol could also be used as markers of biomass burning with levoglucosan or instead of levoglucosan. Correlation analysis between chemical composition and combustion condition suggests that hot or flaming combustions enhance EC, K+, Cl- and polycyclic aromatic hydrocarbons emissions, while low-temperature or smoldering combustions enhance levoglucosan and water-soluble organic carbon emissions. Oxidative potential, measured with macrophage-based reactive oxygen species (ROS) assay and dithiothreitol (DTT) assay, of open burning fine particles per particulate mass as well as fine particulate emission factors were the highest for wheat straws and second highest for rice husks and rice straws. Oxidative potential per particulate mass was in the lower range of vehicle exhaust and atmosphere. These results suggest that the contribution of open burning is relatively small to the oxidative potential of atmospheric particles. In addition, oxidative potential (both ROS and DTT activities) correlated well with water-insoluble organic species
Hussain, Althaf I; Johnson, Jeffrey A; Da Silva Freire, Marcos; Heneine, Walid
2003-01-01
All currently licensed yellow fever (YF) vaccines are propagated in chicken embryos. Recent studies of chick cell-derived measles and mumps vaccines show evidence of two types of retrovirus particles, the endogenous avian retrovirus (EAV) and the endogenous avian leukosis virus (ALV-E), which originate from the chicken embryonic fibroblast substrates. In this study, we investigated substrate-derived avian retrovirus contamination in YF vaccines currently produced by three manufacturers (YF-vax [Connaught Laboratories], Stamaril [Aventis], and YF-FIOCRUZ [FIOCRUZ-Bio-Manguinhos]). Testing for reverse transcriptase (RT) activity was not possible because of assay inhibition. However, Western blot analysis of virus pellets with anti-ALV RT antiserum detected three distinct RT proteins in all vaccines, indicating that more than one source is responsible for the RTs present in the vaccines. PCR analysis of both chicken substrate DNA and particle-associated RNA from the YF vaccines showed no evidence of the long terminal repeat sequences of exogenous ALV subgroups A to D in any of the vaccines. In contrast, both ALV-E and EAV particle-associated RNA were detected at equivalent titers in each vaccine by RT-PCR. Quantitative real-time RT-PCR revealed 61,600, 348,000, and 1,665,000 ALV-E RNA copies per dose of Stamaril, YF-FIOCRUZ, and YF-vax vaccines, respectively. ev locus-specific PCR testing of the vaccine-associated chicken substrate DNA was positive both for the nondefective ev-12 locus in two vaccines and for the defective ev-1 locus in all three vaccines. Both intact and ev-1 pol sequences were also identified in the particle-associated RNA. To investigate the risks of transmission, serum samples from 43 YF vaccine recipients were studied. None of the samples were seropositive by an ALV-E-based Western blot assay or had detectable EAV or ALV-E RNA sequences by RT-PCR. YF vaccines produced by the three manufacturers all have particles containing EAV genomes and
Groundwater flow modelling of an abandoned partially open repository
Energy Technology Data Exchange (ETDEWEB)
Bockgaard, Niclas (Golder Associates AB (Sweden))
2010-12-15
As a part of the license application, according to the nuclear activities act, for a final repository for spent nuclear fuel at Forsmark, the Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken a series of groundwater flow modelling studies. These represent time periods with different hydraulic conditions and the simulations carried out contribute to the overall evaluation of the repository design and long-term radiological safety. The modelling study presented here serves as an input for analyses of so-called future human actions that may affect the repository. The objective of the work was to investigate the hydraulic influence of an abandoned partially open repository. The intention was to illustrate a pessimistic scenario of the effect of open tunnels in comparison to the reference closure of the repository. The effects of open tunnels were studied for two situations with different boundary conditions: A 'temperate' case with present-day boundary conditions and a generic future 'glacial' case with an ice sheet covering the repository. The results were summarized in the form of analyses of flow in and out from open tunnels, the effect on hydraulic head and flow in the surrounding rock volume, and transport performance measures of flow paths from the repository to surface
Groundwater flow modelling of an abandoned partially open repository
International Nuclear Information System (INIS)
Bockgaard, Niclas
2010-12-01
As a part of the license application, according to the nuclear activities act, for a final repository for spent nuclear fuel at Forsmark, the Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken a series of groundwater flow modelling studies. These represent time periods with different hydraulic conditions and the simulations carried out contribute to the overall evaluation of the repository design and long-term radiological safety. The modelling study presented here serves as an input for analyses of so-called future human actions that may affect the repository. The objective of the work was to investigate the hydraulic influence of an abandoned partially open repository. The intention was to illustrate a pessimistic scenario of the effect of open tunnels in comparison to the reference closure of the repository. The effects of open tunnels were studied for two situations with different boundary conditions: A 'temperate' case with present-day boundary conditions and a generic future 'glacial' case with an ice sheet covering the repository. The results were summarized in the form of analyses of flow in and out from open tunnels, the effect on hydraulic head and flow in the surrounding rock volume, and transport performance measures of flow paths from the repository to surface
International Nuclear Information System (INIS)
Hasloev, D.B.; Lorentzen, M.; Koed, J.
1994-08-01
It is pointed out that household windmills, being smaller and more delicate in construction than other types of wind turbines, are not so noticeable as their larger counterparts. The fact that they are usually located close to the buildings for which they provide electricity also limits their visibility in the open landscape. Some of these windmills have been standing for a great number of years and are regarded as of cultural interest and as being almost a natural part of the countryside. It is recommended that if the number of household windmills is to increase significantly, they should be of a light construction. The visual conditions and effects of the setting up of more examples of this type of windmill are dealt with. Photographs of parts of the open Danish countryside, to which drawings of windmills are added in strategic positions are presented in order to illustrate the aesthetic effects of their design and location. It is recommended that regulations should ensure that the smaller windmills are placed in close relation to the buildings which they serve so they appear as part of an aesthetically pleasing whole. Placing them in relation to tall trees also helps to mitigate the visual effects of windmills on the landscape. Such windmills should be as lightly built as possible. Regulations should be made with regard to maximum height and heaviness of construction etc. (AB)
Open Method of Co-Ordination for Demoi-Cracy?
DEFF Research Database (Denmark)
Borrás, Susana; Radaelli, Claudio
2014-01-01
Under which conditions does the open method of co-ordination match the standards for demoi-cracy? To answer this question, we need some explicit standards about demoi-cracy. In fact, open co-ordination serves three different but interrelated purposes in European Union policy: to facilitate...... convergence; to support learning processes; and to encourage exploration of policy innovation. By intersecting standards and purposes, we find open co-ordination is neither inherently ‘good’ nor ‘bad’ for demoi-cracy, as it depends on how it has been put into practice. Therefore, we qualify the answer...
Inhalation hazard from open containers of tritiated water
International Nuclear Information System (INIS)
Jalbert, R.A.; Killian, C.B.
1979-01-01
Experiments to measure the concentration of tritiated water vapour in the vicinity of open containers of tritiated water under ordinary laboratory conditions are described. Results of air sampling around three containers with different open neck areas are summarized in a table which lists the ratio of air to water tritium concentrations per unit neck area. The health physics implications of these results for a person handling tritiated water on an open bench are calculated and compared with those of an accidental spill involving the hands or forearms. (author)
The ethics of open access publishing.
Parker, Michael
2013-03-22
Should those who work on ethics welcome or resist moves to open access publishing? This paper analyses arguments in favour and against the increasing requirement for open access publishing and considers their implications for bioethics research. In the context of biomedical science, major funders are increasingly mandating open access as a condition of funding and such moves are also common in other disciplines. Whilst there has been some debate about the implications of open-access for the social sciences and humanities, there has been little if any discussion about the implications of open access for ethics. This is surprising given both the central role of public reason and critique in ethics and the fact that many of the arguments made for and against open access have been couched in moral terms. In what follows I argue that those who work in ethics have a strong interest in supporting moves towards more open publishing approaches which have the potential both to inform and promote richer and more diverse forms of public deliberation and to be enriched by them. The importance of public deliberation in practical and applied ethics suggests that ethicists have a particular interest in the promotion of diverse and experimental forms of publication and debate and in supporting new, more creative and more participatory approaches to publication.
International Nuclear Information System (INIS)
Hou Shaobo; Li Huacong; Zhang Hefei
2007-01-01
This paper presents an open air-vapor compression refrigeration system for air conditioning and hot water cooled by cool water and proves its feasibility through performance simulation. Pinch technology is used in analysis of heat exchange in the surface heat exchanger, and the temperature difference at the pinch point is selected as 6 o C. Its refrigeration depends mainly on both air and vapor, more efficient than a conventional air cycle, and the use of turbo-machinery makes this possible. This system could use the cool in the cool water, which could not be used to cool air directly. Also, the heat rejected from this system could be used to heat cool water to 33-40 o C. The sensitivity analysis of COP to η c and η t and the simulated results T 4 , T 7 , T 8 , q 1 , q 2 and W m of the cycle are given. The simulations show that the COP of this system depends mainly on T 7 , η c and η t and varies with T 3 or T wet and that this cycle is feasible in some regions, although the COP is sensitive to the efficiencies of the axial compressor and turbine. The optimum pressure ratio in this system could be lower, and this results in a fewer number of stages of the axial compressor. Adjusting the rotation speed of the axial compressor can easily control the pressure ratio, mass flow rate and the refrigerating capacity. The adoption of this cycle will make the air conditioned room more comfortable and reduce the initial investment cost because of the obtained very low temperature air. Humid air is a perfect working fluid for central air conditioning and no cost to the user. The system is more efficient because of using cool water to cool the air before the turbine. In addition, pinch technology is a good method to analyze the wet air heat exchange with water
Open hardware for open science
CERN Bulletin
2011-01-01
Inspired by the open source software movement, the Open Hardware Repository was created to enable hardware developers to share the results of their R&D activities. The recently published CERN Open Hardware Licence offers the legal framework to support this knowledge and technology exchange. Two years ago, a group of electronics designers led by Javier Serrano, a CERN engineer, working in experimental physics laboratories created the Open Hardware Repository (OHR). This project was initiated in order to facilitate the exchange of hardware designs across the community in line with the ideals of “open science”. The main objectives include avoiding duplication of effort by sharing results across different teams that might be working on the same need. “For hardware developers, the advantages of open hardware are numerous. For example, it is a great learning tool for technologies some developers would not otherwise master, and it avoids unnecessary work if someone ha...
Coupling of open to closed bosonic strings in four dimensions
International Nuclear Information System (INIS)
Bern, Z.; Dunbar, D.C.
1987-11-01
We study the construction of D < 26 open bosonic string theories using the fermionic formulation for the internal degrees of freedom. The various models are specified by the boundary conditions of the world sheet fermions on the annulus. Using the fact that open string loops can be transformed into closed string exchanges, we determine possible open string models which may be coupled to known D < 26 closed string models. Finally, as a verification of consistency, we examine particular open string non-planar amplitudes. (orig.)
Revista ORL at Open Science Ecosystem
Directory of Open Access Journals (Sweden)
Tránsito FERRERAS FERNÁNDEZ
2018-05-01
Full Text Available In October 2017 they were held at the University of Salamanca the congress Open Knowledge Ecosystems (ACE 2017 posed as an international meeting point for specialists in open access. The congress allowed to approach the open knowledge from the perspectives I + D + i, offering papers and communications on research related to Open Access, as well as experiences developed in repositories and institutions and approaches to innovative trends in any of the fields of open knowledge.The experience of Revista ORL was present in ECA 2017 through a joint communication of several authors titled Nuevas vías de publicación para revistas biomédicas. Proyecto Revista ORL de Ediciones Universidad de Salamanca, offering an overview of the history of the Revista as an open edition project. Although on that occasion it was called a project, now we should call it "reality" fully consolidated because the data on results obtained.Open Science represents a paradigm change in the way to make science. Although this doesn't change substantially with respect to its motivations and objectives, it changes its methods. The change lies in how it is done, not in what is done. It is an open science, collaborative and made with and for society.The concept of Open Science has been preceded by Open Access to academic content and this may have conditioned its understanding. Open Access has been assimilated only with open access to articles, while with Open Science it is considered that what must be open is any research result (articles + data as well as the auxiliary instruments used (for example, laboratory notebooks. However, the double meaning of "open" (free and free is the same for the two concepts.In this paper we pose questions such as What is Open Science? What are the motivations of governments for its promotion? What components does make up this ecosystem? What are the implications for agents of scientific research? What does represent all this for the edition of
Open access, open education resources and open data in Uganda.
Salvo, Ivana Di; Mwoka, Meggie; Kwaga, Teddy; Rukundo, Priscilla Aceng; Ernest, Dennis Ssesanga; Osaheni, Louis Aikoriogie; John, Kasibante; Shafik, Kasirye; de Sousa, Agostinho Moreira
2015-01-01
As a follow up to OpenCon 2014, International Federation of Medical Students' Associations (IFMSA) students organized a 3 day workshop Open Access, Open Education Resources and Open Data in Kampala from 15-18 December 2014. One of the aims of the workshop was to engage the Open Access movement in Uganda which encompasses the scientific community, librarians, academia, researchers and students. The IFMSA students held the workshop with the support of: Consortium for Uganda University Libraries (CUUL), The Right to Research Coalition, Electronic Information for Libraries (EIFL), Makerere University, International Health Sciences University (IHSU), Pan African Medical Journal (PAMJ) and the Centre for Health Human Rights and Development (CEHURD). All these organizations are based or have offices in Kampala. The event culminated in a meeting with the Science and Technology Committee of Parliament of Uganda in order to receive the support of the Ugandan Members of Parliament and to make a concrete change for Open Access in the country.
Hamidi Ghaleh Jigh, Behrang; Farsi, Mohammad Ali; Hosseini Toudeshky, Hossein
2018-04-01
The prediction of the mechanical behavior of metallic foams with realistic microstructure and the effects of various boundary conditions on the mechanical behavior is an important and challenging issue in modeling representative volume elements (RVEs). A numerical investigation is conducted to determine the effects of various boundary conditions and cell wall cross sections on the compressive mechanical properties of aluminum foam, including the stiffness, plateau stress and onset strain of densification. The open-cell AA6101-T6 aluminum foam Duocel is used in the analyses in this study. Geometrical characteristics including the cell size, foam relative density, and cross-sectional shape and thickness of the cell walls are extracted from images of the foam. Then, the obtained foam microstructure is analyzed as a 2D model. The ligaments are modeled as shear deformable beams with elastic-plastic material behavior. To prevent interpenetration of the nodes and walls inside the cells with large deformations, self-contact-type frictionless interaction is stipulated between the internal surfaces. Sensitivity analyses are performed using several boundary conditions and cells wall cross-sectional shapes. The predicted results from the finite element analyses are compared with the experimental results. Finally, the most appropriate boundary conditions, leading to more consistent results with the experimental data, are introduced.
Hamidi Ghaleh Jigh, Behrang; Farsi, Mohammad Ali; Hosseini Toudeshky, Hossein
2018-05-01
The prediction of the mechanical behavior of metallic foams with realistic microstructure and the effects of various boundary conditions on the mechanical behavior is an important and challenging issue in modeling representative volume elements (RVEs). A numerical investigation is conducted to determine the effects of various boundary conditions and cell wall cross sections on the compressive mechanical properties of aluminum foam, including the stiffness, plateau stress and onset strain of densification. The open-cell AA6101-T6 aluminum foam Duocel is used in the analyses in this study. Geometrical characteristics including the cell size, foam relative density, and cross-sectional shape and thickness of the cell walls are extracted from images of the foam. Then, the obtained foam microstructure is analyzed as a 2D model. The ligaments are modeled as shear deformable beams with elastic-plastic material behavior. To prevent interpenetration of the nodes and walls inside the cells with large deformations, self-contact-type frictionless interaction is stipulated between the internal surfaces. Sensitivity analyses are performed using several boundary conditions and cells wall cross-sectional shapes. The predicted results from the finite element analyses are compared with the experimental results. Finally, the most appropriate boundary conditions, leading to more consistent results with the experimental data, are introduced.
Olfactory source localization in the open field using one or both nostrils.
Welge-Lussen, A; Looser, G L; Westermann, B; Hummel, T
2014-03-01
This study aims to examine humans ́ abilities to localize odorants within the open field. Young participants were tested on a localization task using a relatively selective olfactory stimulus (2-phenylethyl-alcohol, PEA) and cineol, an odorant with a strong trigeminal component. Participants were blindfolded and had to localize an odorant source at 2 m distance (far-field condition) and a 0.4 m distance (near-field condition) with either two nostrils open or only one open nostril. For the odorant with trigeminal properties, the number of correct trials did not differ when one or both nostrils were used, while more PEA localization trials were correctly completed with both rather than one nostril. In the near-field condition, correct localization was possible in 72-80% of the trials, irrespective of the odorant and the number of nostrils used. Localization accuracy, measured as spatial deviation from the olfactory source, was significantly higher in the near-field compared to the far-field condition, but independent of the odorant being localized. Odorant localization within the open field is difficult, but possible. In contrast to the general view, humans seem to be able to exploit the two-nostril advantage with increasing task difficulty.
Kansa, Sarah Whitcher; Kansa, Eric C.
2007-01-01
This article presents the challenges and rewards of sharing research content through a discussion of Open Context, a new open access data publication system for field sciences and museum collections. Open Context is the first data repository of its kind, allowing self-publication of research data, community commentary through tagging, and clear…
Openness, Web 2.0 Technology, and Open Science
Peters, Michael A.
2010-01-01
Open science is a term that is being used in the literature to designate a form of science based on open source models or that utilizes principles of open access, open archiving and open publishing to promote scientific communication. Open science increasingly also refers to open governance and more democratized engagement and control of science…
Acoustic design of open plan schools and comparison of requirements
DEFF Research Database (Denmark)
Møller Petersen, Claus; Rasmussen, Birgit
2012-01-01
between groups and satisfac¬tory speech intelligibility internally in groups. This paper describes the newest Danish requirements and recommendations for such open plan areas and presents the design, measurements and subjective evaluation of two newer Danish schools. According to the users, the general...... conditions at both schools are satisfactory due to both optimized acoustical conditions and teaching methods adapted to the special open environment. The results from room acoustical modelling, verification measurements and questionnaire survey are presented and evaluated in relation to the newest Danish...
Steady-state capabilities for hydroturbines with OpenFOAM
Page, M.; Beaudoin, M.; Giroux, A. M.
2010-08-01
The availability of a high quality Open Source CFD simulation platform like OpenFOAM offers new R&D opportunities by providing direct access to models and solver implementation details. Efforts have been made by Hydro-Québec to adapt OpenFOAM to hydroturbines for the development of steady-state capabilities. The paper describes the developments that have been made to implement new turbomachinery related capabilities: Multiple Frame of Reference solver, domain coupling interfaces (GGI, cyclicGGI and mixing plane) and specialized boundary conditions. Practical use of the new turbomachinery capabilities are demonstrated for the analysis of a 195-MW Francis hydroturbine.
Steady-state capabilities for hydroturbines with OpenFOAM
Energy Technology Data Exchange (ETDEWEB)
Page, M; Beaudoin, M; Giroux, A M, E-mail: page.maryse@ireq.c [Hydro-Quebec, Institut de recherche 1800 Lionel-Boulet, Varennes, Quebec J3X 1S1 (Canada)
2010-08-15
The availability of a high quality Open Source CFD simulation platform like OpenFOAM offers new R and D opportunities by providing direct access to models and solver implementation details. Efforts have been made by Hydro-Quebec to adapt OpenFOAM to hydroturbines for the development of steady-state capabilities. The paper describes the developments that have been made to implement new turbomachinery related capabilities: Multiple Frame of Reference solver, domain coupling interfaces (GGI, cyclicGGI and mixing plane) and specialized boundary conditions. Practical use of the new turbomachinery capabilities are demonstrated for the analysis of a 195-MW Francis hydroturbine.
Steady-state capabilities for hydroturbines with OpenFOAM
International Nuclear Information System (INIS)
Page, M; Beaudoin, M; Giroux, A M
2010-01-01
The availability of a high quality Open Source CFD simulation platform like OpenFOAM offers new R and D opportunities by providing direct access to models and solver implementation details. Efforts have been made by Hydro-Quebec to adapt OpenFOAM to hydroturbines for the development of steady-state capabilities. The paper describes the developments that have been made to implement new turbomachinery related capabilities: Multiple Frame of Reference solver, domain coupling interfaces (GGI, cyclicGGI and mixing plane) and specialized boundary conditions. Practical use of the new turbomachinery capabilities are demonstrated for the analysis of a 195-MW Francis hydroturbine.
Mechanism of titanocene-mediated epoxide opening through homolytic substitution
DEFF Research Database (Denmark)
Gansäuer, Andreas; Barchuk, Andriy; Keller, Florian
2007-01-01
−titanocene complexes, the transition states of epoxide opening, and the β-titanoxy radicals formed. The results obtained provide a structural basis for the understanding of the factors determining the regioselectivity of ring opening and match the experimentally determined values. By employing substituted titanocenes...... of monomeric and dimeric Ti(III) species was found to be strongly affected by the exact steric conditions. The overall rate constants of the reductive epoxide opening were determined for the first time. These data were employed as the basis for computational studies of the structure and energies of the epoxide...... even more selective epoxide openings could be realized. Moreover, by properly adjusting the steric demands of the catalysts and the substrates the first examples of reversible epoxide openings were designed....
Linker, J. A.; Caplan, R. M.; Downs, C.; Riley, P.; Mikic, Z.; Lionello, R.; Henney, C. J.; Arge, C. N.; Liu, Y.; Derosa, M. L.; Yeates, A.; Owens, M. J.
2017-10-01
The heliospheric magnetic field is of pivotal importance in solar and space physics. The field is rooted in the Sun’s photosphere, where it has been observed for many years. Global maps of the solar magnetic field based on full-disk magnetograms are commonly used as boundary conditions for coronal and solar wind models. Two primary observational constraints on the models are (1) the open field regions in the model should approximately correspond to coronal holes (CHs) observed in emission and (2) the magnitude of the open magnetic flux in the model should match that inferred from in situ spacecraft measurements. In this study, we calculate both magnetohydrodynamic and potential field source surface solutions using 14 different magnetic maps produced from five different types of observatory magnetograms, for the time period surrounding 2010 July. We have found that for all of the model/map combinations, models that have CH areas close to observations underestimate the interplanetary magnetic flux, or, conversely, for models to match the interplanetary flux, the modeled open field regions are larger than CHs observed in EUV emission. In an alternative approach, we estimate the open magnetic flux entirely from solar observations by combining automatically detected CHs for Carrington rotation 2098 with observatory synoptic magnetic maps. This approach also underestimates the interplanetary magnetic flux. Our results imply that either typical observatory maps underestimate the Sun’s magnetic flux, or a significant portion of the open magnetic flux is not rooted in regions that are obviously dark in EUV and X-ray emission.
Energy Technology Data Exchange (ETDEWEB)
Linker, J. A.; Caplan, R. M.; Downs, C.; Riley, P.; Mikic, Z.; Lionello, R. [Predictive Science Inc., 9990 Mesa Rim Road, Suite 170, San Diego, CA 92121 (United States); Henney, C. J. [Air Force Research Lab/Space Vehicles Directorate, 3550 Aberdeen Avenue SE, Kirtland AFB, NM (United States); Arge, C. N. [Science and Exploration Directorate, NASA/GSFC, Greenbelt, MD 20771 (United States); Liu, Y. [W. W. Hansen Experimental Physics Laboratory, Stanford University, Stanford, CA 94305 (United States); Derosa, M. L. [Lockheed Martin Solar and Astrophysics Laboratory, 3251 Hanover Street B/252, Palo Alto, CA 94304 (United States); Yeates, A. [Department of Mathematical Sciences, Durham University, Durham, DH1 3LE (United Kingdom); Owens, M. J., E-mail: linkerj@predsci.com [Space and Atmospheric Electricity Group, Department of Meteorology, University of Reading, Earley Gate, P.O. Box 243, Reading RG6 6BB (United Kingdom)
2017-10-10
The heliospheric magnetic field is of pivotal importance in solar and space physics. The field is rooted in the Sun’s photosphere, where it has been observed for many years. Global maps of the solar magnetic field based on full-disk magnetograms are commonly used as boundary conditions for coronal and solar wind models. Two primary observational constraints on the models are (1) the open field regions in the model should approximately correspond to coronal holes (CHs) observed in emission and (2) the magnitude of the open magnetic flux in the model should match that inferred from in situ spacecraft measurements. In this study, we calculate both magnetohydrodynamic and potential field source surface solutions using 14 different magnetic maps produced from five different types of observatory magnetograms, for the time period surrounding 2010 July. We have found that for all of the model/map combinations, models that have CH areas close to observations underestimate the interplanetary magnetic flux, or, conversely, for models to match the interplanetary flux, the modeled open field regions are larger than CHs observed in EUV emission. In an alternative approach, we estimate the open magnetic flux entirely from solar observations by combining automatically detected CHs for Carrington rotation 2098 with observatory synoptic magnetic maps. This approach also underestimates the interplanetary magnetic flux. Our results imply that either typical observatory maps underestimate the Sun’s magnetic flux, or a significant portion of the open magnetic flux is not rooted in regions that are obviously dark in EUV and X-ray emission.
Naval open systems architecture
Guertin, Nick; Womble, Brian; Haskell, Virginia
2013-05-01
For the past 8 years, the Navy has been working on transforming the acquisition practices of the Navy and Marine Corps toward Open Systems Architectures to open up our business, gain competitive advantage, improve warfighter performance, speed innovation to the fleet and deliver superior capability to the warfighter within a shrinking budget1. Why should Industry care? They should care because we in Government want the best Industry has to offer. Industry is in the business of pushing technology to greater and greater capabilities through innovation. Examples of innovations are on full display at this conference, such as exploring the impact of difficult environmental conditions on technical performance. Industry is creating the tools which will continue to give the Navy and Marine Corps important tactical advantages over our adversaries.
OpenQ∗D simulation code for QCD+QED
DEFF Research Database (Denmark)
Campos, Isabel; Fritzsch, Patrick; Hansen, Martin
2018-01-01
The openQ∗D code for the simulation of QCD+QED with C∗ boundary conditions is presented. This code is based on openQCD-1.6, from which it inherits the core features that ensure its efficiency: the locally-deflated SAP-preconditioned GCR solver, the twisted-mass frequency splitting of the fermion....... An alpha version of this code is publicly available and can be downloaded from http://rcstar.web.cern.ch/....
OpenAPS Data Commons on Open Humans
Lewis, Dana M.; Ball, Madeleine
2017-01-01
Poster describing OpenAPS, Open Humans, and joint work creating a data commons for OpenAPS data in the Open Humans platform. Presented at the 2017 Sage Assembly Bionetworks Assembly and recipient of a Young Innovator/Investigator award.
Open bite in prematurely born children.
Harila, V; Heikkinen, T; Grön, M; Alvesalo, L
2007-01-01
The aims of this study were to: examine the expression of open bite in prematurely born children and discuss the etiological factors that may lead to bite it. The subjects were 328 prematurely born (cross-sectional study of the Collaborative Perinatal Project in the 1960s and 1970s. Dental documents, including casts and photographs, were taken once at the age of 6-12 years in the mixed dentition. The occlusion was recorded by examining and measuring the hard stone casts. Vertical open bite was recorded only for full erupted teeth. The statistical method used was chi-square analysis. Significant differences in the incidence of anterior open bite (from left to right canine) was found between the preterm and control groups and between gender and ethnic groups. The prevalence of anterior open bite was nearly 9% in the preterm group and almost 7% in the control group. African Americans (9%) had a significantly greater incidence of open bite than Caucasians (3%; Pbite than boys (8% vs 6%; Pbite was increased--especially in preterm African American boys compared to controls (11% vs 8%). The results show differences in the development of anterior open bite between ethnic and gender groups. Premature birth may also influence dental occlusal development. Of importance are the patient's: general health condition; respiratory infections; inadequate nasal- and mouth-breathing; oral habits; and other medical problems. Preterm children may be relatively more predisposed to etiological factors for the development of anterior open bite.
Open innovation with an effective open innovation team.
Vanvoorden, Jonas
2014-01-01
This master's thesis explores how open innovation teams can successfully support open innovation inside of an organisation. Open innovation is a paradigm introduced by Henry Chesbrough (2003) a decade ago. It expands the innovation potential of organisations by opening them up to new ways of working with external partners. To implement open innovation, many companies rely on a small group of managers named open innovation teams. Although open innovation teams can potentially be vital for impl...
From Open Source Software to Open Source Hardware
Viseur , Robert
2012-01-01
Part 2: Lightning Talks; International audience; The open source software principles progressively give rise to new initiatives for culture (free culture), data (open data) or hardware (open hardware). The open hardware is experiencing a significant growth but the business models and legal aspects are not well known. This paper is dedicated to the economics of open hardware. We define the open hardware concept and determine intellectual property tools we can apply to open hardware, with a str...
Dynamics of Open Systems with Affine Maps
International Nuclear Information System (INIS)
Zhang Da-Jian; Liu Chong-Long; Tong Dian-Min
2015-01-01
Many quantum systems of interest are initially correlated with their environments and the reduced dynamics of open systems are an interesting while challenging topic. Affine maps, as an extension of completely positive maps, are a useful tool to describe the reduced dynamics of open systems with initial correlations. However, it is unclear what kind of initial state shares an affine map. In this study, we give a sufficient condition of initial states, in which the reduced dynamics can always be described by an affine map. Our result shows that if the initial states of the combined system constitute a convex set, and if the correspondence between the initial states of the open system and those of the combined system, defined by taking the partial trace, is a bijection, then the reduced dynamics of the open system can be described by an affine map. (paper)
Energy Technology Data Exchange (ETDEWEB)
Ma, Fanhua; Wang, Mingyue; Jiang, Long; Deng, Jiao; Chen, Renzhe; Naeve, Nashay; Zhao, Shuli [State Key Laboratory of Automotive Safety and Energy, Tsinghua University, Beijing 100084 (China)
2010-11-15
This paper investigates the effect of various hydrogen ratios in HCNG (hydrogen-enriched compressed natural gas) fuels on performance and emission characteristics at wide open throttle operating conditions using a turbocharged spark-ignition natural gas engine. The experimental data was taken at hydrogen fractions of 0%, 30% and 55% by volume and was conducted under different excess air ratio ({lambda}) at MBT operating conditions. It is found that under various {lambda}, the addition of hydrogen can significantly reduce CO, CH{sub 4} emissions and the NO{sub x} emission remain at an acceptable level when ignition timing is optimized. Using the same excess air ratio, as more hydrogen is added the power, exhaust temperatures and max cylinder pressure decrease slowly until the mixture's lower heating value remains unchanged with the hydrogen enrichment, then they rise gradually. In addition, the early flame development period and the flame propagation duration are both shorter, and the indicated thermal efficiency and maximum heat release rate both increase with more hydrogen addition. (author)
Mechanical Seal Opening Condition Monitoring Based on Acoustic Emission Technology
Directory of Open Access Journals (Sweden)
Erqing Zhang
2014-06-01
Full Text Available Since the measurement of mechanical sealing film thickness and just-lift-off time is very difficult, the sealing film condition monitoring method based on acoustic emission signal is proposed. The mechanical seal acoustic emission signal present obvious characteristics of time-varying nonlinear and pulsating. In this paper, the acoustic emission signal is used to monitor the seal end faces just-lift-off time and friction condition. The acoustic emission signal is decomposed by empirical mode decomposition into a series of intrinsic mode function with independent characteristics of different time scales and different frequency band. The acoustic emission signal only generated by end faces friction is obtained by eliminating the false intrinsic mode function components. The correlation coefficient of acoustic emission signal and Multi-scale Laplace Wavelet is calculated. It is proved that the maximum frequency (8000 Hz of the correlation coefficient is appeared at the spindle speed of 300 rpm. And at this time (300 rpm the end faces have just lifted off. By a set of mechanical oil seal running test, it is demonstrated that this method could accurately identify mechanical seal end faces just-lift-off time and friction condition.
Open string T-duality in a weakly curved background
International Nuclear Information System (INIS)
Davidovic, Ljubica
2016-01-01
We consider a theory of an open string moving in a weakly curved background, composed of a constant metric and a linearly coordinate dependent Kalb-Ramond field with an infinitesimal field strength. We find its T-dual using the generalized Buscher procedure developed for the closed string moving in a weakly curved background, and the fact that solving the boundary conditions, the open string theory transforms to the effective closed string theory. So, T-dualizing the effective theory along all effective directions we obtain its T-dual theory and resume the open string theory which has such an effective theory. In this way we obtain the open string theory T-dual. (orig.)
Effect of Galleries on Thermal Conditions of Urban Open Areas
Directory of Open Access Journals (Sweden)
Shahab Kariminia
2016-06-01
Full Text Available Computer simulations were performed by ENVI-met model along with physical measurements in two urban squares under hot summer conditions in Isfahan, central Iran. Each scenario concentrated on adding or extending galleries in each square. The results confirmed the role of galleries on thermal conditions; however, it was found that the effectiveness of this strategy depends on the square geometry. It presented higher efficiency for the small square with higher H/W ratio. This solution is advisable for smaller squares and when the peripheral parts are frequently used compared to the middle areas. Galleries are most efficient when allowing enough natural ventilation.
Occupants' window opening behaviour
DEFF Research Database (Denmark)
Fabi, Valentina; Andersen, Rune Korsholm; Corgnati, Stefano
2012-01-01
Energy consumption in buildings is influenced by several factors related to the building properties and the building controls, some of them highly connected to the behaviour of their occupants.In this paper, a definition of items referring to occupant behaviour related to the building control...... systems is proposed, based on studies presented in literature and a general process leading to the effects on energy consumptions is identified.Existing studies on the topic of window opening behaviour are highlighted and a theoretical framework to deal with occupants' interactions with building controls......, aimed at improving or maintaining the preferred indoor environmental conditions, is elaborated. This approach is used to look into the drivers for the actions taken by the occupants (windows opening and closing) and to investigate the existing models in literature of these actions for both residential...
Zhan, L.; Wang, Z.; Zhao, X.; Liu, Z.; Liu, G.
2017-08-01
The painting is one of the most decorative elements of ancient Chinese architecture and it is sensitive to the natural environment. The outdoor painting is very easily to be affected by the natural environment and its color is easily to decay. In order to study the relationship between the painting decay and the physical environment, the two paintings on both east and west inner eaves of Jilan Pavilion beside the Kunming Lake in Summer Palace are taken as the research objects, because these two paintings are painted at the same period but their decay degrees are greatly different. Since 2013, the research group regularly monitors the color decay of these two paintings. Meanwhile, the physical environment around these two paintings has been monitored. Based on the analysis of the monitor data, it can be seen that the illumination is the major factor that causes the decay of the painting. Meanwhile, by using the ECOTECT software to stimulate the light environment around the Jilan Pavilion, it can be seen that it is the mirror reflection of the lake that causes the result that the illumination of the west eave (face east) is stronger than that of the east eave (face west).
Directory of Open Access Journals (Sweden)
L. Zhan
2017-08-01
Full Text Available The painting is one of the most decorative elements of ancient Chinese architecture and it is sensitive to the natural environment. The outdoor painting is very easily to be affected by the natural environment and its color is easily to decay. In order to study the relationship between the painting decay and the physical environment, the two paintings on both east and west inner eaves of Jilan Pavilion beside the Kunming Lake in Summer Palace are taken as the research objects, because these two paintings are painted at the same period but their decay degrees are greatly different. Since 2013, the research group regularly monitors the color decay of these two paintings. Meanwhile, the physical environment around these two paintings has been monitored. Based on the analysis of the monitor data, it can be seen that the illumination is the major factor that causes the decay of the painting. Meanwhile, by using the ECOTECT software to stimulate the light environment around the Jilan Pavilion, it can be seen that it is the mirror reflection of the lake that causes the result that the illumination of the west eave (face east is stronger than that of the east eave (face west.
International Nuclear Information System (INIS)
Hafttananian, M.; Ramiar, A.; Ranjbar, A.A.
2016-01-01
Highlights: • Oxygen bleeding as a treatment of poisoned fuel cells is simulated. • Oxygen bleeding, depended on impurity concentration, has an optimize range. • Three novel techniques of oxygen bleeding are introduced. • The OBME parameter is introduced to compare oxygen bleeding methods. • Pulsating and sinusoidal methods lead to 2.74 and 1.74 effectiveness, respectively. - Abstract: PEM fuel cells fed by steam methane reformate (SMR) and water gas shift reformate (WGSR) are always subjected to catalyst poisoning due to trace amounts of carbon monoxide in the fuel stream. Air or oxygen bleeding are the most common, cost-effective and easy-to-implement methods of mitigation for such conditions. In the present work, important restrictions of oxygen bleeding and disadvantages of continuous constant O_2 bleeding are introduced. In order to simulating the problem, a mathematical model containing reaction kinetics, governing equations, boundary conditions and constitutive relations are presented and according to these, a comprehensive OpenFOAM transient multicomponent solver having the capability of simulating anode side of PEM fuel cell is developed, introduced and validated with existing experimental data. In addition, three novel methods of oxygen bleeding: namely pulsating, exponential and sinusoidal methods are introduced which are practical for both open-end and dead-end fuel cells. A quantitative criterion, Oxygen Bleeding Method Effectiveness (OBME), is also introduced to attain comparability of novel methods with continuous constant O_2 bleeding as common method. Results showed up to more than 5% increase in recovery ratio accompanied with up to 63% save in oxygen consumption.
International Nuclear Information System (INIS)
Longenbaugh, R.S.; Sanchez, L.C.; Gregory, J.J.
1987-08-01
This report presents the two-dimensional heat transfer analysis of an open pool fire surrounding a modified radioactive materials transport cask. The cask is an older cask that was used by the Hallum Nuclear Power Facility (HNPF). The HNPF cask did not have a neutron shielding region but was modified to include one for testing purposes. Analysis of the thermal effects of an engulfing open pool fire was performed with the use of the heat transfer code Q/TRAN, which had previously been used in thermal benchmarking problems for spent nuclear fuel casks. Boundary condition data for the analysis were derived from experimental open pool fire tests of large-scale calorimeter test articles performed at SNL that produced information about cask surface heat flux versus surface temperature relationships. Data analysis was directed toward a determination of the thermal response of the cask, particularly the extent of lead melt since lead is used within the HNPF cask's gamma-shielding region. Parameters, such as surface emissivity and internal heat generation rate, can affect the results of the thermal analysis which control the amount of lead melt. A parameter sensitivity analysis was performed using a one-dimensional model to describe how surface emissivity and internal heat generation rates affect the temperature distribution within the cask. The information from this analysis was used to determine the range of parameters for the two-dimensional thermal analysis. 13 refs., 57 figs., 8 tabs
Energy Technology Data Exchange (ETDEWEB)
Mejia D, David; Morillon G, David; Rodriguez V, Luis [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)
2001-07-01
In here it is presented the analysis of the impact of the solar gains through the transparent parts of a prototype house of social interest, located in a dry warm climate. This analysis was made to determine the gains through windows for the summer time and under the following conditions: without outside solar protections, with the use of eaves, solar breakers and finally with the use of both systems of solar protection. The results were compared to obtain the considered potential of energy saving in cooling equipment, that could be obtained in future houses to build. [Spanish] Se presenta el analisis del impacto de las ganancias solares a traves de las partes transparentes de un prototipo de vivienda de interes social, ubicado en un clima calido seco. Dicho analisis se realizo para determinar las ganancias a traves de ventanas para la epoca de verano y bajo las siguientes condiciones: sin protecciones solares exteriores, con el empleo de aleros, con quiebrasoles y finalmente con el empleo de ambos sistemas de proteccion solar. Se compararon los resultados para obtener el potencial estimado de ahorro de energia en equipo de enfriamiento, que se tendria en las futuras viviendas por construir.
A Gauged Open 2-Brane String in the p-Brane Background
International Nuclear Information System (INIS)
Monemzadeh, Majid; Sarvi, Fahimeh; Abarghouei Nejad, Salman
2016-01-01
We make a gauge theory from the Open p-brane system and map it into the Open 2-Brane one. Due to the presence of second-class constraints in this model, we encounter some problems during the procedure of quantization. In this regard, considering boundary conditions as Dirac conditions, one can drive the constrained structure of the model at first. Then, with the help of BFT formalism of constraint systems, the Open 2-Brane model is embedded into an extended phase space. For this purpose, we introduce some tensor fields to convert ungauged theory into the gauged one. This is the novel part of our research, while mostly scalar and vector fields are used to convert second-class constraints into first ones.
COEXISTENCE OF PRIVATE FIRMS AND OPEN SOURCE FIRMS UNDER SPILLOVERS AND CONSUMER BIAS
Directory of Open Access Journals (Sweden)
Murat YILMAZ
2017-12-01
Full Text Available Open source technologies have been an important divergence from the private produc- tion, and some markets have accommodated both open source firms and private firms. We explore the conditions under which such a coexistence of both type of firms can be seen. Through a simple and tractable game theoretical model, with spillovers on the open source production and positive consumer bias for the privately produced good, we analyze the conditions for which, in the equilibrium, a private firm and an open source firm share the market. We find that for large enough consumer bias, the two types cannot coexist, however when the consumer bias is relatively low and the spillover effect is not too strong, then we get a coexistence result.
The experimental investigation of explosive opening switch
Energy Technology Data Exchange (ETDEWEB)
Jiande, Zhang; Huihuang, Zhong; Chuanlu, Li; Yonggui, Liu; Dongqun, Cheng; Xianyang, Peng [National Univ. of Defense Technology, Changsha (China). Dept. of Applied Physics
1997-12-31
The explosive opening switch (EOS) used in explosive-driven magnetic-flux compression generator (EMCG) circuits was investigated. It is shown that (1) under certain conditions, the EOS voltage is hardly dependent on the size of the explosive and aluminium foil used in EOS; (2) with the explosive coated by an insulator pipe, the opening effect of EOS is better; (3) by use of EOS, a pulse with 5 kA current, 100 kV voltage and 250 ns risetime has been transferred into a resistance load. (author). 12 figs., 5 refs.
The experimental investigation of explosive opening switch
International Nuclear Information System (INIS)
Zhang Jiande; Zhong Huihuang; Li Chuanlu; Liu Yonggui; Cheng Dongqun; Peng Xianyang
1996-01-01
The explosive opening switch (EOS) used in explosive-driven magnetic-flux compression generator (EMCG) circuits was investigated. It is shown that (1) under certain conditions, the EOS voltage is hardly dependent on the size of the explosive and aluminium foil used in EOS; (2) with the explosive coated by an insulator pipe, the opening effect of EOS is better; (3) by use of EOS, a pulse with 5 kA current, 100 kV voltage and 250 ns risetime has been transferred into a resistance load. (author). 12 figs., 5 refs
From Open Source to Open Collaboration
CERN. Geneva
2015-01-01
Open source is the right to modify, not the right to contribute. Are external contributions absent from your project? Have you ever thought about what is it like to be a new contributor on your project? I challenge you to transform your project from Open Source to an Open Collaboration.
Open string fluctuations in AdS space with and without torsion
DEFF Research Database (Denmark)
Larsen, A.L.; Lomholt, Michael Andersen
2003-01-01
The equations of motion and boundary conditions for the fluctuations around a classical open string, in a curved space-time with torsion, are considered in compact and world-sheet covariant form. The rigidly rotating open strings in anti-de Sitter space with and without torsion are investigated...
Open channels in fractures maintained by deposition and erosion of colloids
International Nuclear Information System (INIS)
Kessler, J.H.; Hunt, J.R.
1993-01-01
Material in the colloidal size range is present in many natural groundwater systems at existing or proposed radioactive waste storage locations. Colloids initially suspended in the water in fractures can deposit onto the fracture surfaces, and will partially or fully clog the fracture. The amount of clogging will depend on whether the deposited colloidal material can erode from the fracture surfaces. If the fracture remains only partially clogged the unclogged regions take the form of open channels. The purpose of this paper is to assess under what conditions these open channels form. An analytical model of a steady state, average open channel width is presented which is a function of the fluid flow rate and viscosity, fracture aperture, and the permeability and shear strength of the deposited colloidal material. The implications of the presence of open channels for colloidal transport is also discussed. However, for most repository conditions the fractures are expected to fully clog with colloids
Entropy favours open colloidal lattices
Mao, Xiaoming; Chen, Qian; Granick, Steve
2013-03-01
Burgeoning experimental and simulation activity seeks to understand the existence of self-assembled colloidal structures that are not close-packed. Here we describe an analytical theory based on lattice dynamics and supported by experiments that reveals the fundamental role entropy can play in stabilizing open lattices. The entropy we consider is associated with the rotational and vibrational modes unique to colloids interacting through extended attractive patches. The theory makes predictions of the implied temperature, pressure and patch-size dependence of the phase diagram of open and close-packed structures. More generally, it provides guidance for the conditions at which targeted patchy colloidal assemblies in two and three dimensions are stable, thus overcoming the difficulty in exploring by experiment or simulation the full range of conceivable parameters.
Microalgae community shifts during the biogas upgrading in an alkaline open photobioreactor.
Granada-Moreno, C I; Aburto-Medina, A; de Los Cobos Vasconcelos, D; González-Sánchez, A
2017-10-01
To achieve the functional specialization of a microalgae community through operational tuning of an open photobioreactor used for biogas upgrading under alkaline conditions. An open photobioreactor was inoculated with an indigenous microalgae sample from the Texcoco Soda Lake. A microalgae community was adapted to fix CO 2 from synthetic biogas through different culture conditions reaching a maximum of 220 mg CO 2 l -1 per day. Picochlorum sp. and Scenedesmus sp. were identified as the prominent microalgae genera by molecular fingerprinting (partial sequencing of 16S rRNA and 18S rRNA genes) but only the first was detected by microscopy screening. Changes in the microalgae community profile were monitored by a range-weighted richness index, reaching the lowest value when biogas was upgraded. A robust microalgae community in the open photobioreactor was obtained after different culture conditions. The specialization of microalgae community for CO 2 fixation under H 2 S presence was driven by biogas upgrading conditions. The alkaline conditions enhance the CO 2 absorption from biogas and could optimize specialized microalgae communities in the open photobioreactor. Denaturing gradient gel electrophoresis fingerprinting and richness index comparison are useful methods for the evaluation of microalgae community shifts and photosynthetic activity performance, particularly in systems intended for CO 2 removal from biogas where the CO 2 assimilation potential can be related to the microbial richness. © 2017 The Society for Applied Microbiology.
Brookhaven collider opens its quest for Big Bang conditions
Nadis, S
2000-01-01
The collision of two gold nuclei releasing 10 x 10 to the power 12 electron volts of energy, marked the debut of the Relativistic Heavy Ion Collider. Over the next few weeks, scientists hope to increase the accelerator's power to generate collisions 40 x 10 to the power 12 eVs of energy to simulate the conditions that existed immediately after the Big Bang (1 page).
Open Source, Openness, and Higher Education
Wiley, David
2006-01-01
In this article David Wiley provides an overview of how the general expansion of open source software has affected the world of education in particular. In doing so, Wiley not only addresses the development of open source software applications for teachers and administrators, he also discusses how the fundamental philosophy of the open source…
Open Government and (Linked (Open (Government (Data
Directory of Open Access Journals (Sweden)
Christian Philipp Geiger
2012-12-01
Full Text Available This article explores the opening and the free usage of stored public sector data, supplied by state. In the age of Open Government and Open Data it’s not enough just to put data online. It should be rather weighed out whether, how and which supplied public sector data can be published. Open Data are defined as stored data which could be made accessible in a public interest without any restrictions for usage and distribution. These Open Data can possibly be statistics, geo data, maps, plans, environmental data and weather data in addition to materials of the parliaments, ministries and authorities. The preparation and the free access to existing data permit varied approaches to the reuse of data, discussed in the article. In addition, impulses can be given for Open Government – the opening of state and administration, to more transparency, participation and collaboration as well as to innovation and business development. The Open Data movement tries to get to the bottom of current publication processes in the public sector which could be formed even more friendly to citizens and enterprises.
International Nuclear Information System (INIS)
Kern, R.; Sastrawan, R.; Ferber, J.; Stangl, R.; Luther, J.
2002-01-01
Electrical impedance spectroscopy (EIS) was applied in order to investigate electrochemical nanocrystalline TiO 2 dye solar cells (DSC). Typically, three characteristic frequency peaks were observed in the spectra. These frequency peaks could be explained by variations of cell parameters and by comparison with intensity-modulated photovoltage spectroscopy (IMVS). It was shown that the low-frequency peak (in the mHz range) corresponds to the Nernstian diffusion within the electrolyte, while the middle-frequency peak (in the 10-100 Hz range) reflects the properties of the photoinjected electrons within the TiO 2 . The high-frequency peak (in the kHz range) corresponds to the charge-transfer at the platinum counter electrode. For a detailed analysis of the spectra, a model was developed which allows the evaluation of EIS spectra, measured under bias illumination and under open-circuit conditions. The influence of cell parameters such as the TiO 2 layer thickness, cell thickness, charge-transfer resistance of the platinum counter electrode, and the lifetime of the photoinjected electrons, on the impedance spectra was studied both experimentally and theoretically. Finally, it is shown that EIS is a measurement method suited well for the investigation of the long-term stability of DSC, as changes of the inner cell parameters can be revealed
Robust boundary treatment for open-channel flows in divergence-free incompressible SPH
Pahar, Gourabananda; Dhar, Anirban
2017-03-01
A robust Incompressible Smoothed Particle Hydrodynamics (ISPH) framework is developed to simulate specified inflow and outflow boundary conditions for open-channel flow. Being purely divergence-free, the framework offers smoothed and structured pressure distribution. An implicit treatment of Pressure Poison Equation and Dirichlet boundary condition is applied on free-surface to minimize error in velocity-divergence. Beyond inflow and outflow threshold, multiple layers of dummy particles are created according to specified boundary condition. Inflow boundary acts as a soluble wave-maker. Fluid particles beyond outflow threshold are removed and replaced with dummy particles with specified boundary velocity. The framework is validated against different cases of open channel flow with different boundary conditions. The model can efficiently capture flow evolution and vortex generation for random geometry and variable boundary conditions.
Alachioti, Xanthippi Sofia; Dimopoulou, Eleni; Vlasakidou, Anatoli; Athanasiou, Athanasios E
2014-01-01
Although amelogenesis imperfecta is not a common dental pathological condition, its etiological, classification, clinical and management aspects have been addressed extensively in the scientific literature. Of special clinical consideration is the frequent co-existence of amelogenesis imperfecta with the anterior open bite. This paper provides an updated review on amelogenesis imperfecta as well as anterior open bite, in general, and documents the association of these two separate entities, in particular. Diagnosis and treatment of amelogenesis imperfecta patients presenting also with anterior open bite require a lengthy, comprehensive and multidisciplinary approach, which should aim to successfully address all dental, occlusal, developmental, skeletal and soft tissue problems associated with these two serious clinical conditions.
Van Loenen, B.
2012-01-01
Netwerkbedrijf Alliander was begin 2011 zich aan het oriënteren naar de mogelijkheid om haar gegevens als open data ter beschikking te stellen aan een ieder. Echter wat open data nu precies is, welke mogelijke knelpunten moeten worden opgelost om open data te implementeren, de impact die open data
The OpenPMU Platform for Open Source Phasor Measurements
Laverty, David M.; Best, Robert J.; Brogan, Paul; Al-Khatib, Iyad; Vanfretti, Luigi; Morrow, D John
2013-01-01
OpenPMU is an open platform for the development of phasor measurement unit (PMU) technology. A need has been identified for an open-source alternative to commercial PMU devices tailored to the needs of the university researcher and for enabling the development of new synchrophasor instruments from this foundation. OpenPMU achieves this through open-source hardware design specifications and software source code, allowing duplicates of the OpenPMU to be fabricated under open-source licenses. Th...
Assimilation of satellite altimeter data into an open ocean model
Vogeler, Armin; SchröTer, Jens
1995-08-01
Geosat sea surface height data are assimilated into an eddy-resolving quasi-geostrophic open ocean model using the adjoint technique. The method adjusts the initial conditions for all layers and is successful on the timescale of a few weeks. Time-varying values for the open boundaries are prescribed by a much larger quasi-geostrophic model of the Antarctic Circumpolar Current (ACC). Both models have the same resolution of approximately 20×20 km (1/3°×1/6°), have three layers, and include realistic bottom topography and coastlines. The open model box is embedded in the African sector of the ACC. For continuous assimilation of satellite data into the larger model the nudging technique is applied. These results are used for the adjoint optimization procedure as boundary conditions and as a first guess for the initial condition. For the open model box the difference between model and satellite sea surface height that remains after the nudging experiment amounts to a 19-cm root-mean-square error (rmse). By assimilation into the regional model this value can be reduced to a 6-cm rmse for an assimilation period of 20 days. Several experiments which attempt to improve the convergence of the iterative optimization method are reported. Scaling and regularization by smoothing have to be applied carefully. Especially during the first 10 iterations, the convergence can be improved considerably by low-pass filtering of the cost function gradient. The result of a perturbation experiment shows that for longer assimilation periods the influence of the boundary values becomes dominant and they should be determined inversely by data assimilation into the open ocean model.
Open Data, Open Source and Open Standards in chemistry: The Blue Obelisk five years on
2011-01-01
Background The Blue Obelisk movement was established in 2005 as a response to the lack of Open Data, Open Standards and Open Source (ODOSOS) in chemistry. It aims to make it easier to carry out chemistry research by promoting interoperability between chemistry software, encouraging cooperation between Open Source developers, and developing community resources and Open Standards. Results This contribution looks back on the work carried out by the Blue Obelisk in the past 5 years and surveys progress and remaining challenges in the areas of Open Data, Open Standards, and Open Source in chemistry. Conclusions We show that the Blue Obelisk has been very successful in bringing together researchers and developers with common interests in ODOSOS, leading to development of many useful resources freely available to the chemistry community. PMID:21999342
Increasing energy efficiency by geometric modification of hoe-type furrow opener
Directory of Open Access Journals (Sweden)
R Rahimzadeh
2016-09-01
Full Text Available Introduction Direct planting becomes more common in the recent years, because it conserves soil and water as well as it saves energy and time. However, this technology needs special implements such as seed planter. Given that direct planting is practiced in undisturbed lands, so it was needed to design a special furrow opener. In order to obtain a suitable furrow opener this experiment was conducted in rain-fed Agricultural Research Institute in Maragheh. Materials and Methods Most of seed planters that are used for cultivation in rain fed conditions are equipped by hoe-type furrow opener. Hoe-type furrow openers have good penetration in hard and dry soils. However, they do not have the ability for direct planting. Hoe-type furrow opener was chosen as a model. Then by changing the geometric form of the depth to width ratio (d/w, the two openers were designed. In the first design, which was called O1 two wings and a narrow blade acting as a coulter were added in front of the hoe-type furrow opener. In the second design, which was called O2, in addition to the O1 modification, furrow opener width was decreased and a disk blade was added for seed sowing (Fig. 1. The performance of O1 and O2 openers were compared with the conventional hoe-type furrow opener (check in soil bin and in field conditions. At three different forward speeds (1, 1.5 and 2 m.s-1 with 3 replications, the effects of the openers designs of vertical and horizontal soil forces were evaluated in soil-bin conditions. In order to evaluate the performance of the furrow opener in field conditions, an experiment was conducted using a split plot design based on RCBD at 4 replications. Furrow openers formed the main plots and forward speeds formed the sub plots. Each plot size was 22 meters long in two rows for each treatment. After germination of wheat crop, the numbers of seedlings in two rows were counted (along a one meter. After crop maturity, all plots were harvested by hand and
Safari, Leila; Patrick, Jon D
2013-01-01
This paper reports on the issues in mapping the terms of a query to the field names of the schema of an Entity Relationship (ER) model or to the data part of the Entity Attribute Value (EAV) model using similarity based Top-K algorithm in clinical information system together with an extension of EAV mapping for medication names. In addition, the details of the mapping algorithm and the required pre-processing including NLP (Natural Language Processing) tasks to prepare resources for mapping are explained. The experimental results on an example clinical information system demonstrate more than 84 per cent of accuracy in mapping. The results will be integrated into our proposed Clinical Data Analytics Language (CliniDAL) to automate mapping process in CliniDAL.
Naderloo, Reza
2015-03-02
Menaethiops abumusa n. sp. is closely similar to M. bicornis Alcock, 1985, and M. gadaniensis Kazmi & Tirmizi, 1999, regarding the relatively contiguous rostral spines. The new species is easily distinguishable from its two congeners by having distinctly round angles of orbital eaves and distally divergent rostral spines. Whereas in M. bicornis, and M. gadaniensis, the angles of orbital eaves are anteriorly produced and rostral spines are closely attached to each other along their entire length. Other morphological differences include the carapace spination/granulation, basal antennal segments, and morphology of the male's first gonopod. Menaethiops gadaniensis was described from Gadani, Pakistan and was only known from the type locality, but is here recorded for the first time from the Gulf of Oman.
46 CFR 45.135 - Hull openings at or below freeboard deck.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Hull openings at or below freeboard deck. 45.135 Section 45.135 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES GREAT LAKES LOAD LINES Conditions of Assignment § 45.135 Hull openings at or below freeboard deck. Closures for hull...
Entanglement in open quantum systems
International Nuclear Information System (INIS)
Isar, A.
2007-01-01
In the framework of the theory of open systems based on quantum dynamical semigroups, we solve the master equation for two independent bosonic oscillators interacting with an environment in the asymptotic long-time regime. We give a description of the continuous-variable entanglement in terms of the covariance matrix of the quantum states of the considered system for an arbitrary Gaussian input state. Using the Peres-Simon necessary and sufficient condition for separability of two-mode Gaussian states, we show that the two non-interacting systems immersed in a common environment and evolving under a Markovian, completely positive dynamics become asymptotically entangled for certain environments, so that their non-local quantum correlations exist in the long-time regime. (author) Key words: quantum information theory, open systems, quantum entanglement, inseparable states
Hasenkopf, C. A.
2017-12-01
Increasingly, open data, open-source projects are unearthing rich datasets and tools, previously impossible for more traditional avenues to generate. These projects are possible, in part, because of the emergence of online collaborative and code-sharing tools, decreasing costs of cloud-based services to fetch, store, and serve data, and increasing interest of individuals to contribute their time and skills to 'open projects.' While such projects have generated palpable enthusiasm from many sectors, many of these projects face uncharted paths for sustainability, visibility, and acceptance. Our project, OpenAQ, is an example of an open-source, open data community that is currently forging its own uncharted path. OpenAQ is an open air quality data platform that aggregates and universally formats government and research-grade air quality data from 50 countries across the world. To date, we make available more than 76 million air quality (PM2.5, PM10, SO2, NO2, O3, CO and black carbon) data points through an open Application Programming Interface (API) and a user-customizable download interface at https://openaq.org. The goal of the platform is to enable an ecosystem of users to advance air pollution efforts from science to policy to the private sector. The platform is also an open-source project (https://github.com/openaq) and has only been made possible through the coding and data contributions of individuals around the world. In our first two years of existence, we have seen requests for data to our API skyrocket to more than 6 million datapoints per month, and use-cases as varied as ingesting data aggregated from our system into real-time models of wildfires to building open-source statistical packages (e.g. ropenaq and py-openaq) on top of the platform to creating public-friendly apps and chatbots. We will share a whirl-wind trip through our evolution and the many lessons learned so far related to platform structure, community engagement, organizational model type
Assessment of crack opening area for leak rates
International Nuclear Information System (INIS)
Sharples, J.K.; Bouchard, P.J.
1997-01-01
This paper outlines the background to recommended crack opening area solutions given in a proposed revision to leak before break guidance for the R6 procedure. Comparisons with experimental and analytical results are given for some selected cases of circumferential cracks in cylinders. It is shown that elastic models can provide satisfactory estimations of crack opening displacement (and area) but they become increasingly conservative for values of L r greater than approximately 0.4. The Dugdale small scale yielding model gives conservative estimates of crack opening displacement with increasing enhancement for L r values greater than 0.4. Further validation of the elastic-plastic reference stress method for up to L r values of about 1.0 is presented by experimental and analytical comparisons. Although a more detailed method, its application gives a best estimate of crack opening displacement which may be substantially greater than small scale plasticity models. It is also shown that the local boundary conditions in pipework need to be carefully considered when evaluating crack opening area for through-wall bending stresses resulting from welding residual stresses or geometry discontinuities
DEFF Research Database (Denmark)
Wessel, Michael; Thies, Ferdinand; Benlian, Alexander
2017-01-01
-faire approach and let the market determine winners and losers? In this study, we compare the market conditions on Kickstarter, one of the world’s largest crowdfunding platforms, before and after a policy change that relaxed the previously stringent screening process for new campaigns. By analyzing over 230......,000 crowdfunding campaigns with a combined funding of over $1.9 billion that cover a 4-year period around the policy change, we find that increasing platform openness was a double-edged sword for the platform’s ecosystem. While Kickstarter’s revenue from commissions surged after the policy change due...
Sign Language Translator Application Using OpenCV
Triyono, L.; Pratisto, E. H.; Bawono, S. A. T.; Purnomo, F. A.; Yudhanto, Y.; Raharjo, B.
2018-03-01
This research focuses on the development of sign language translator application using OpenCV Android based, this application is based on the difference in color. The author also utilizes Support Machine Learning to predict the label. Results of the research showed that the coordinates of the fingertip search methods can be used to recognize a hand gesture to the conditions contained open arms while to figure gesture with the hand clenched using search methods Hu Moments value. Fingertip methods more resilient in gesture recognition with a higher success rate is 95% on the distance variation is 35 cm and 55 cm and variations of light intensity of approximately 90 lux and 100 lux and light green background plain condition compared with the Hu Moments method with the same parameters and the percentage of success of 40%. While the background of outdoor environment applications still can not be used with a success rate of only 6 managed and the rest failed.
Developing a Successful Open Source Training Model
Directory of Open Access Journals (Sweden)
Belinda Lopez
2010-01-01
Full Text Available Training programs for open source software provide a tangible, and sellable, product. A successful training program not only builds revenue, it also adds to the overall body of knowledge available for the open source project. By gathering best practices and taking advantage of the collective expertise within a community, it may be possible for a business to partner with an open source project to build a curriculum that promotes the project and supports the needs of the company's training customers. This article describes the initial approach used by Canonical, the commercial sponsor of the Ubuntu Linux operating system, to engage the community in the creation of its training offerings. We then discuss alternate curriculum creation models and some of the conditions that are necessary for successful collaboration between creators of existing documentation and commercial training providers.
International Nuclear Information System (INIS)
Borlaf, J.
1997-01-01
We study T-duality for open strings in arbitrary background fields including the abelian electromagnetic one. We focus in the mapping of the boundary conditions in the disk and the crosscap topologies and we discuss in detail the consistency of the gauging procedure for the bosonic and the N = 1 supersymmetric theories. A brief account is made on the dilaton transformation and global issues in higher genus. (orig.)
Design and Evaluation of a Proxy-Based Monitoring System for OpenFlow Networks.
Taniguchi, Yoshiaki; Tsutsumi, Hiroaki; Iguchi, Nobukazu; Watanabe, Kenzi
2016-01-01
Software-Defined Networking (SDN) has attracted attention along with the popularization of cloud environment and server virtualization. In SDN, the control plane and the data plane are decoupled so that the logical topology and routing control can be configured dynamically depending on network conditions. To obtain network conditions precisely, a network monitoring mechanism is necessary. In this paper, we focus on OpenFlow which is a core technology to realize SDN. We propose, design, implement, and evaluate a network monitoring system for OpenFlow networks. Our proposed system acts as a proxy between an OpenFlow controller and OpenFlow switches. Through experimental evaluations, we confirm that our proposed system can capture packets and monitor traffic information depending on administrator's configuration. In addition, we show that our proposed system does not influence significant performance degradation to overall network performance.
Design and Evaluation of a Proxy-Based Monitoring System for OpenFlow Networks
Directory of Open Access Journals (Sweden)
Yoshiaki Taniguchi
2016-01-01
Full Text Available Software-Defined Networking (SDN has attracted attention along with the popularization of cloud environment and server virtualization. In SDN, the control plane and the data plane are decoupled so that the logical topology and routing control can be configured dynamically depending on network conditions. To obtain network conditions precisely, a network monitoring mechanism is necessary. In this paper, we focus on OpenFlow which is a core technology to realize SDN. We propose, design, implement, and evaluate a network monitoring system for OpenFlow networks. Our proposed system acts as a proxy between an OpenFlow controller and OpenFlow switches. Through experimental evaluations, we confirm that our proposed system can capture packets and monitor traffic information depending on administrator’s configuration. In addition, we show that our proposed system does not influence significant performance degradation to overall network performance.
Design, construction and initial state of the underground openings
International Nuclear Information System (INIS)
2010-12-01
The report is included in a set of Production reports, presenting how the KBS-3 repository is designed, produced and inspected. The set of reports is included in the safety report for the KBS-3 repository and repository facility. The report provides input on the initial state of the underground openings for the assessment of the long-term safety, SR-Site. The initial state refers to the properties of the underground openings at final disposal, backfilling or closure. In addition, the report provides input to the operational safety report, SR-Operation, on how the underground openings shall be constructed and inspected. The report presents the design premises and the methodology applied to design the underground openings and adapt them the to the site conditions so that they conform to the design premises. It presents the reference design at Forsmark and its conformity to the design premises. It also describes the reference methods to be applied to construct and inspect the different kinds of underground openings. Finally, the initial state of the underground openings and its conformity to the design premises is presented
Design, construction and initial state of the underground openings
Energy Technology Data Exchange (ETDEWEB)
2010-12-15
The report is included in a set of Production reports, presenting how the KBS-3 repository is designed, produced and inspected. The set of reports is included in the safety report for the KBS-3 repository and repository facility. The report provides input on the initial state of the underground openings for the assessment of the long-term safety, SR-Site. The initial state refers to the properties of the underground openings at final disposal, backfilling or closure. In addition, the report provides input to the operational safety report, SR-Operation, on how the underground openings shall be constructed and inspected. The report presents the design premises and the methodology applied to design the underground openings and adapt them the to the site conditions so that they conform to the design premises. It presents the reference design at Forsmark and its conformity to the design premises. It also describes the reference methods to be applied to construct and inspect the different kinds of underground openings. Finally, the initial state of the underground openings and its conformity to the design premises is presented
78 FR 2996 - Federal Open Market Committee; Domestic Policy Directive of December 11-12, 2012
2013-01-15
...'s Annual Report. The Federal Open Market Committee seeks monetary and financial conditions that will... Open Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of December 11-12...
76 FR 43687 - Federal Open Market Committee; Domestic Policy Directive of June 21-22, 2011
2011-07-21
... Report. The Federal Open Market Committee seeks monetary and financial conditions that will foster price... Open Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of June 21-22...
Mathematical modeling of the heat frozen earth in OpenFOAM
International Nuclear Information System (INIS)
Kudryashov, N.A.; Chmykhov, M.A.; Kartashev, A.P.
2015-01-01
A mathematical model of heating permafrost has been presented with allowance for the Stefan condition at the boundary melting. A numerical algorithm has been proposed for analyzing this process. A computation module has been developed on an open architecture with the use of object-oriented programming language OpenFOAM. The computation module has been verified on the known exact solutions of simplified problems [ru
Energy Technology Data Exchange (ETDEWEB)
Rian, Kjell Erik
2003-07-01
In numerical simulations of turbulent reacting compressible flows, artificial boundaries are needed to obtain a finite computational domain when an unbounded physical domain is given. Artificial boundaries which fluids are free to cross are called open boundaries. When calculating such flows, non-physical reflections at the open boundaries may occur. These reflections can pollute the solution severely, leading to inaccurate results, and the generation of spurious fluctuations may even cause the numerical simulation to diverge. Thus, a proper treatment of the open boundaries in numerical simulations of turbulent reacting compressible flows is required to obtain a reliable solution for realistic conditions. A local quasi-one-dimensional characteristic-based open-boundary treatment for the Favre-averaged governing equations for time-dependent three-dimensional multi-component turbulent reacting compressible flow is presented. A k-{epsilon} model for turbulent compressible flow and Magnussen's EDC model for turbulent combustion is included in the analysis. The notion of physical boundary conditions is incorporated in the method, and the conservation equations themselves are applied on the boundaries to complement the set of physical boundary conditions. A two-dimensional finite-difference-based computational fluid dynamics code featuring high-order accurate numerical schemes was developed for the numerical simulations. Transient numerical simulations of the well-known, one-dimensional shock-tube problem, a two-dimensional pressure-tower problem in a decaying turbulence field, and a two-dimensional turbulent reacting compressible flow problem have been performed. Flow- and combustion-generated pressure waves seem to be well treated by the non-reflecting subsonic open-boundary conditions. Limitations of the present open-boundary treatment are demonstrated and discussed. The simple and solid physical basis of the method makes it both favourable and relatively easy to
Using open sidewalls for modelling self-consistent lithosphere subduction dynamics
Directory of Open Access Journals (Sweden)
M. V. Chertova
2012-10-01
Full Text Available Subduction modelling in regional model domains, in 2-D or 3-D, is commonly performed using closed (impermeable vertical boundaries. Here we investigate the merits of using open boundaries for 2-D modelling of lithosphere subduction. Our experiments are focused on using open and closed (free slip sidewalls while comparing results for two model aspect ratios of 3:1 and 6:1. Slab buoyancy driven subduction with open boundaries and free plates immediately develops into strong rollback with high trench retreat velocities and predominantly laminar asthenospheric flow. In contrast, free-slip sidewalls prove highly restrictive on subduction rollback evolution, unless the lithosphere plates are allowed to move away from the sidewalls. This initiates return flows pushing both plates toward the subduction zone speeding up subduction. Increasing the aspect ratio to 6:1 does not change the overall flow pattern when using open sidewalls but only the flow magnitude. In contrast, for free-slip boundaries, the slab evolution does change with respect to the 3:1 aspect ratio model and slab evolution does not resemble the evolution obtained with open boundaries using 6:1 aspect ratio. For models with open side boundaries, we could develop a flow-speed scaling based on energy dissipation arguments to convert between flow fields of different model aspect ratios. We have also investigated incorporating the effect of far-field generated lithosphere stress in our open boundary models. By applying realistic normal stress conditions to the strong part of the overriding plate at the sidewalls, we can transfer intraplate stress to influence subduction dynamics varying from slab roll-back, stationary subduction, to advancing subduction. The relative independence of the flow field on model aspect ratio allows for a smaller modelling domain. Open boundaries allow for subduction to evolve freely and avoid the adverse effects (e.g. forced return flows of free-slip boundaries. We
VALUATION OF OPEN SOURCE SOFTWARE: HOW DO YOU PUT A VALUE ON FREE?
Directory of Open Access Journals (Sweden)
Jesús García-García
2013-04-01
Full Text Available The aim of this study is to assess the financial reporting framework applied to open source software. Open sourcing software developments means sharing technology and resources with communities worldwide to help eliminate the digital divide, create economic opportunity, and support equal access to technology. Therefore, a methodological approach is needed to assess properly the performance and the value generation potential and to put such measure into organizational reports. International financial reporting framework is checked over conditions to allow value recognition of open sourced assets. Linux kernel development value is estimated to reflect worth of open source developments despite absence of book value due to inexistence of a single cost source. Several attempts to estimate a valuation of open source software have been performed previously. However, this study is the first to judge suitability of accounting framework to report on this value. The main finding is that open sourced assets do not fully accomplish conditions to be included in financial reports. We seek to stimulate academic and professional debate about the pursuit of valuation of a large and efficient ecosystem of software innovation, freely available to society.
Limited Mouth Opening Secondary to Diffuse Systemic Sclerosis
Directory of Open Access Journals (Sweden)
Tomoko Wada
2013-01-01
Full Text Available Systemic sclerosis (SSc is a relatively rare condition with an immunologically mediated pathogenesis. For reasons that are not clearly understood, dense collagen is deposited in the connective tissues of the body in extraordinary amounts. Although its dramatic effects are seen in association with the skin, the disease is often quite serious with visceral organ involvement. We describe a case of limited mouth opening secondary to diffuse SSc, improvement in mouth opening with passive jaw stretch exercises, and the challenges involved in performing dental procedures for such patients.
Reflection of Alfven waves at an open magnetopause
International Nuclear Information System (INIS)
Cao, F.; Kan, J.R.
1990-01-01
Reflection of an Alfven wave incident on an open magnetopause form the magnetospheric side is examined. An open magnetopause, whose structure is different from the standard rotational discontinuity, is assumed to be a parameterized discontinuity with a nonzero normal field component. When an Alfven wave is incident on the open magnetopause, reflected and transmitted waves are generated. The emanating waves can be analyzed using linearized MHD conservation relations across the magnetopause, together with Snell's law. Under the assumption that the magnetic fields on the two sides of the open magnetopause are coplanar with the normal direction of the magnetopause, the governing equations are solved numerically. The results show that the electric fields of emanating Alfven waves depend mainly on the number density and the magnetic field jumps across the magnetopause. Under conditions representing the open magnetopause, it turns out that the open magnetopause behaves like a near perfect reflector. The corresponding reflection coefficient for the wave electric field can be approximated by R E = E r /E i ∼ -1 as has been deduced by Kan and Sun (1985) based on physical arguments. In other words, the solar wind flow is more or less unchanged by the loading effect of the Alfven wave incident on the magnetopause from the magnetospheric side. Therefore, under the assumptions of the model, the open magnetopause can be viewed as a constant voltage source
Close connections between open science and open-source software
Directory of Open Access Journals (Sweden)
YouHua Chen
2014-09-01
Full Text Available Open science is increasingly gaining attention in recent years. In this mini-review, we briefly discuss and summarize the reasons of introducing open science into academic publications for scientists. We argue that open-source software (like R and Python software can be the universal and important platforms for doing open science because of their appealing features: open source, easy-reading document, commonly used in various scientific disciplines like statistics, chemistry and biology. At last, the challenges and future perspectives of performing open science are discussed.
Open NASA Earth Exchange (OpenNEX): A Public-Private Partnership for Climate Change Research
Nemani, R. R.; Lee, T. J.; Michaelis, A.; Ganguly, S.; Votava, P.
2014-12-01
NASA Earth Exchange (NEX) is a data, computing and knowledge collaborative that houses satellite, climate and ancillary data where a community of researchers can come together to share modeling and analysis codes, scientific results, knowledge and expertise on a centralized platform with access to large supercomputing resources. As a part of broadening the community beyond NASA-funded researchers, NASA through an agreement with Amazon Inc. made available to the public a large collection of Climate and Earth Sciences satellite data. The data, available through the Open NASA Earth Exchange (OpenNEX) platform hosted by Amazon Web Services (AWS) public cloud, consists of large amounts of global land surface imaging, vegetation conditions, climate observations and climate projections. In addition to the data, users of OpenNEX platform can also watch lectures from leading experts, learn basic access and use of the available data sets. In order to advance White House initiatives such as Open Data, Big Data and Climate Data and the Climate Action Plan, NASA over the past six months conducted the OpenNEX Challenge. The two-part challenge was designed to engage the public in creating innovative ways to use NASA data and address climate change impacts on economic growth, health and livelihood. Our intention was that the challenges allow citizen scientists to realize the value of NASA data assets and offers NASA new ideas on how to share and use that data. The first "ideation" challenge, closed on July 31st attracted over 450 participants consisting of climate scientists, hobbyists, citizen scientists, IT experts and App developers. Winning ideas from the first challenge will be incorporated into the second "builder" challenge currently targeted to launch mid-August and close by mid-November. The winner(s) will be formally announced at AGU in December of 2014. We will share our experiences and lessons learned over the past year from OpenNEX, a public-private partnership for
A proof that Witten's open string theory gives a single cover of moduli space
International Nuclear Information System (INIS)
Zwiebach, B.; Massachusetts Inst. of Tech., Cambridge
1991-01-01
We show that Witten's open string diagrams are surfaces with metrics of minimal area under the condition that all nontrivial open Jordan curves be longer or equal to π. The minimal area property is used together with a mini-max problem to establish a new existence and uniqueness theorem for quadratic differentials in open Riemann surfaces with or without punctures on the boundaries. This theorem implies that the Feynman rules of open string theory give a single cover of the moduli of open Riemann surfaces. (orig.)
NCBI nr-aa BLAST: CBRC-XTRO-01-0585 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0585 ref|ZP_01577174.1| binding-protein-dependent transport systems in...ner membrane component [Delftia acidovorans SPH-1] gb|EAV76695.1| binding-protein-dependent transport systems
Integrable open spin chain in Super Yang-Mills and the plane-wave/SYM duality
International Nuclear Information System (INIS)
Chen Bin; Wang Xiaojun; Wu Yongshi
2004-01-01
We investigate the integrable structures in an N = 2 superconfomal Sp(N) Yang-Mills theory with matter, which is dual to an open+closed string system. We restrict ourselves to the BMN operators that correspond to free string states. In the closed string sector, an integrable structure is inherited from its parent theory, N = 4 SYM. For the open string sector, the planar one-loop mixing matrix for gauge invariant holomorphic operators is identified with the Hamiltonian of an integrable SU(3) open spin chain. Using the K-matrix formalism we identify the integrable open-chain boundary conditions that correspond to string boundary conditions. The solutions to the algebraic Bethe ansatz equations (ABAE) with a few impurities are shown to recover the anomalous dimensions that exactly match the spectrum of free open string in the plane-wave background. We also discuss the properties of the solutions of ABAE beyond the BMN regime. (author)
Closing small open economy models
Schmitt-Grohe, Stephanie; Uribe, Martín
2001-01-01
The small open economy model with incomplete asset markets features a steady state that depends on initial conditions and equilibrium dynamics that possess a random walk component. A number of modifications to the standard model have been proposed to induce stationarity. This paper presents a quantitative comparison of these alternative approaches. Five different specifications are considered: (1) A model with an endogenous discount factor (Uzawa-type preferences); (2) A model with a debt-ela...
A Rotational Pressure-Correction Scheme for Incompressible Two-Phase Flows with Open Boundaries
Dong, S.; Wang, X.
2016-01-01
Two-phase outflows refer to situations where the interface formed between two immiscible incompressible fluids passes through open portions of the domain boundary. We present several new forms of open boundary conditions for two-phase outflow simulations within the phase field framework, as well as a rotational pressure correction based algorithm for numerically treating these open boundary conditions. Our algorithm gives rise to linear algebraic systems for the velocity and the pressure that involve only constant and time-independent coefficient matrices after discretization, despite the variable density and variable viscosity of the two-phase mixture. By comparing simulation results with theory and the experimental data, we show that the method produces physically accurate results. We also present numerical experiments to demonstrate the long-term stability of the method in situations where large density contrast, large viscosity contrast, and backflows occur at the two-phase open boundaries. PMID:27163909
Sharing open hardware through ROP, the robotic open platform
Lunenburg, J.; Soetens, R.P.T.; Schoenmakers, F.; Metsemakers, P.M.G.; van de Molengraft, M.J.G.; Steinbuch, M.; Behnke, S.; Veloso, M.; Visser, A.; Xiong, R.
2014-01-01
The robot open source software community, in particular ROS, drastically boosted robotics research. However, a centralized place to exchange open hardware designs does not exist. Therefore we launched the Robotic Open Platform (ROP). A place to share and discuss open hardware designs. Among others
Sharing open hardware through ROP, the Robotic Open Platform
Lunenburg, J.J.M.; Soetens, R.P.T.; Schoenmakers, Ferry; Metsemakers, P.M.G.; Molengraft, van de M.J.G.; Steinbuch, M.
2013-01-01
The robot open source software community, in particular ROS, drastically boosted robotics research. However, a centralized place to exchange open hardware designs does not exist. Therefore we launched the Robotic Open Platform (ROP). A place to share and discuss open hardware designs. Among others
2013-05-13
... Federal Advisory Committee: Notice of Open Meeting for the Commercial HVAC, WH, and Refrigeration.... ACTION: Notice of open meeting. SUMMARY: This notice announces an open meeting of the Commercial Heating, Ventilation, and Air-conditioning (HVAC), Water Heating (WH), and Refrigeration Certification Working Group...
Open stone surgery: a still-in-use approach for complex stone burden.
Çakici, Özer Ural; Ener, Kemal; Keske, Murat; Altinova, Serkan; Canda, Abdullah Erdem; Aldemir, Mustafa; Ardicoglu, Arslan
2017-06-30
Urinary stone disease is a major urological condition. Endourologic techniques have influenced the clinical approach and outcomes. Open surgery holds a historic importance in the management of most conditions. However, complex kidney stone burden may be amenable to successful results with open stone surgery. In this article, we report our eighteen cases of complex urinary stone disease who underwent open stone removal. A total of 1701 patients have undergone surgical treatment for urinary stone disease in our clinic between July 2012 and July 2016, comprising eighteen patients who underwent open stone surgery. Patients' demographic data, stone analysis results, postoperative clinical data, and stone status were evaluated retrospectively. The choice of surgical approach is mostly dependent on the surgeon's preference. In two patients, open surgery was undertaken because of perioperative complications. We did not observe any Clavien-Dindo grade 4 or 5 complications. Three patients were managed with a course of antibiotics due to postoperative fever. One patient had postoperative pleurisy, one patient had urinoma, and two patients had postoperative ileus. Mean operation time was 84 (57-124) minutes and mean hospitalization time was 5.5 (3-8) days. Stone-free status was achieved in 15 patients (83.3%). Endourologic approaches are the first options for treatment of urinary stone disease. However, open stone surgery holds its indispensable position in complicated cases and in complex stone burden. Open stone surgery is also a valid alternative to endourologic techniques in all situations.
Directory of Open Access Journals (Sweden)
WANG Minhao
2017-08-01
Full Text Available Plate structures with openings are common in many engineering structures. The study of the vibration characteristics of such structures is directly related to the vibration reduction, noise reduction and stability analysis of an overall structure. This paper conducts research into the free vibration characteristics of a thin elastic plate with a rectangular opening parallel to the plate in an arbitrary position. We use the improved Fourier series to represent the displacement tolerance function of the rectangular plate with an opening. We can divide the plate into an eight zone plate to simplify the calculation. We then use linear springs, which are uniformly distributed along the boundary, to simulate the classical boundary conditions and the boundary conditions of the boundaries between the regions. According to the energy functional and variational method, we can obtain the overall energy functional. We can also obtain the generalized eigenvalue matrix equation by studying the extremum of the unknown improved Fourier series expansion coefficients. We can then obtain the natural frequencies and corresponding vibration modes of the rectangular plate with an opening by solving the equation. We then compare the calculated results with the finite element method to verify the accuracy and effectiveness of the method proposed in this paper. Finally, we research the influence of the boundary condition, opening size and opening position on the vibration characteristics of a plate with an opening. This provides a theoretical reference for practical engineering application.
ScienceSoft: Open software for open science
Di Meglio, Alberto
2012-01-01
Most of the software developed today by research institutes, university, research projects, etc. is typically stored in local source and binary repositories and available for the duration of a project lifetime only. Finding software based on given functional characteristics is almost impossible and binary packages are mostly available from local university or project repositories rather than the open source community repositories like Fedora/EPEL or Debian. Furthermore general information about who develops, contributes to and most importantly uses a given software program is very difficult to find out and yet the widespread availability of such information would give more visibility and credibility to the software products. The creation of links or relationships not only among pieces of software, but equally among the people interacting with the software across and beyond specific project and communities would foster a more active community and create the conditions for sharing ideas and skills, a ...
Building the Open Elements of an Open Data Competition
d'Aquin, Mathieu; Dietze, Stefan; Drachsler, Hendrik; Guy, Marieke; Herder, Eelco; Parodi, Elisabetta
2014-01-01
The European Union is increasingly committed to pushing forward open approaches as indicated by the G8 Open Data Charter, the Opening Up Education initiative, the launch of the Open Education Europa Portal for OER resources and other similar initiatives. The EU-funded LinkedUp Project (Linking Web
NCBI nr-aa BLAST: CBRC-AGAM-07-0060 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-07-0060 ref|ZP_01507056.1| diguanylate cyclase [Burkholderia phytofirmans... PsJN] gb|EAV08201.1| diguanylate cyclase [Burkholderia phytofirmans PsJN] ZP_01507056.1 6e-21 28% ...
NCBI nr-aa BLAST: CBRC-AGAM-07-0060 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-07-0060 ref|ZP_01512692.1| diguanylate cyclase [Burkholderia phytofirmans... PsJN] gb|EAV02625.1| diguanylate cyclase [Burkholderia phytofirmans PsJN] ZP_01512692.1 2e-23 29% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0279 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0279 ref|ZP_01559467.1| binding-protein-dependent transport systems in...ner membrane component [Burkholderia ambifaria MC40-6] gb|EAV47973.1| binding-protein-dependent transport systems
NCBI nr-aa BLAST: CBRC-XTRO-01-0737 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0737 ref|ZP_01555242.1| binding-protein-dependent transport systems in...ner membrane component [Burkholderia ambifaria MC40-6] gb|EAV51825.1| binding-protein-dependent transport systems
Assessment of crack opening area for leak rates
Energy Technology Data Exchange (ETDEWEB)
Sharples, J.K.; Bouchard, P.J.
1997-04-01
This paper outlines the background to recommended crack opening area solutions given in a proposed revision to leak before break guidance for the R6 procedure. Comparisons with experimental and analytical results are given for some selected cases of circumferential cracks in cylinders. It is shown that elastic models can provide satisfactory estimations of crack opening displacement (and area) but they become increasingly conservative for values of L{sub r} greater than approximately 0.4. The Dugdale small scale yielding model gives conservative estimates of crack opening displacement with increasing enhancement for L{sub r} values greater than 0.4. Further validation of the elastic-plastic reference stress method for up to L{sub r} values of about 1.0 is presented by experimental and analytical comparisons. Although a more detailed method, its application gives a best estimate of crack opening displacement which may be substantially greater than small scale plasticity models. It is also shown that the local boundary conditions in pipework need to be carefully considered when evaluating crack opening area for through-wall bending stresses resulting from welding residual stresses or geometry discontinuities.
Helium-air exchange flows through partitioned opening and two-opening
International Nuclear Information System (INIS)
Kang, T. I.
1997-01-01
This paper describes experimental investigations of helium-air exchange flows through partitioned opening and two-opening. Such exchange flows may occur following rupture accident of stand pipe in high temperature engineering test reactor. A test vessel with the two types of small opening on top of test cylinder is used for experiments. An estimation method of mass increment is developed to measure the exchange flow rate. Upward flow of the helium and downward flow of the air in partitioned opening system interact out of entrance and exit of the opening. Therefore, an experiment with two-opening system is made to investigate effect of the fluids interaction of partitioned opening system. As a result of comparison of the exchange flow rates between two types of the opening system, it is demonstrated that the exchange flow rate of the two-opening system is larger than that of the partitioned opening system because of absence of the effect of fluids interaction. (author)
Cholecystectomy - open; Gallbladder - open cholecystectomy; Cholecystitis - open cholecystectomy; Gallstones - open cholecystectomy ... a medical instrument called a laparoscope ( laparoscopic ... Open gallbladder surgery is used when laparoscopic surgery cannot ...
Computer Simulation of Complex Power System Faults under various Operating Conditions
International Nuclear Information System (INIS)
Khandelwal, Tanuj; Bowman, Mark
2015-01-01
A power system is normally treated as a balanced symmetrical three-phase network. When a fault occurs, the symmetry is normally upset, resulting in unbalanced currents and voltages appearing in the network. For the correct application of protection equipment, it is essential to know the fault current distribution throughout the system and the voltages in different parts of the system due to the fault. There may be situations where protection engineers have to analyze faults that are more complex than simple shunt faults. One type of complex fault is an open phase condition that can result from a fallen conductor or failure of a breaker pole. In the former case, the condition is often accompanied by a fault detectable with normal relaying. In the latter case, the condition may be undetected by standard line relaying. The effect on a generator is dependent on the location of the open phase and the load level. If an open phase occurs between the generator terminals and the high-voltage side of the GSU in the switchyard, and the generator is at full load, damaging negative sequence current can be generated. However, for the same operating condition, an open conductor at the incoming transmission lines located in the switchyard can result in minimal negative sequence current. In 2012, a nuclear power generating station (NPGS) suffered series or open phase fault due to insulator mechanical failure in the 345 kV switchyard. This resulted in both reactor units tripping offline in two separate incidents. Series fault on one of the phases resulted in voltage imbalance that was not detected by the degraded voltage relays. These under-voltage relays did not initiate a start signal to the emergency diesel generators (EDG) because they sensed adequate voltage on the remaining phases exposing a design vulnerability. This paper is intended to help protection engineers calculate complex circuit faults like open phase condition using computer program. The impact of this type of
Numerical Predictions of Mode Reflections in an Open Circular Duct: Comparison with Theory
Dahl, Milo D.; Hixon, Ray
2015-01-01
The NASA Broadband Aeroacoustic Stator Simulation code was used to compute the acoustic field for higher-order modes in a circular duct geometry. To test the accuracy of the results computed by the code, the duct was terminated by an open end with an infinite flange or no flange. Both open end conditions have a theoretical solution that was used to compare with the computed results. Excellent comparison for reflection matrix values was achieved after suitable refinement of the grid at the open end. The study also revealed issues with the level of the mode amplitude introduced into the acoustic held from the source boundary and the amount of reflection that occurred at the source boundary when a general nonreflecting boundary condition was applied.
Avendaño-Reyes, Leonel; Fuquay, John W; Moore, Reuben B; Liu, Zhanglin; Clark, Bruce L; Vierhout, C
2010-02-01
To estimate the relationship between heat stress during the last 60 days prepartum, body condition score and certain reproductive traits in the subsequent lactation of Holstein cows, 564 multiparous cows and 290 primiparous cows from four dairy herds were used in a hot, humid region. Maximum prepartum degree days were estimated to quantify the degree of heat stress. Multiple regressions analyses and logistic regression analysis were performed to determine the effect of prepartum heat stress and body condition change on reproductive parameters, which were obtained from DHIA forms at the end of the lactation. Multiparous and primiparous cows which gained body condition score from calving to 60 d postpartum exhibited 28 and 27 fewer days open (P 0.05) of heat stress measurement on days open or services per conception in either multiparous or primiparous cows. During hotter months of calving, multiparous cows showed higher services per conception and primiparous cows showed higher days open and services per conception (P score. Multiparous cows with high body condition score at calving were 1.47 times more likely to present a very difficult calving than cows that calved in October (P reproductive performance was not affected by cumulative prepartum heat stress although it was associated with very difficult calving score.
CATEGORY OF "OPEN EDUCATION" IN THE WORKS OF NATIVE AND FOREIGN SCIENTISTS
Directory of Open Access Journals (Sweden)
Maria P. Leshchenko
2014-02-01
Full Text Available In the publication the historical background of the emergence of the category of "open education" is reflected, the scientific publications of native and foreign researchers are analyzed, the synthesis of scientific literature on the concept of "open education" is implemented, the genesis of the use of this concept is investigated, as well as the main problems of the development of open education are outlined. The usefulness of the use of open education technologies in educational process is justified, the directions of implementation of open education elements prospective for Ukraine are considered. It is determined that open education is an integral part of the informational society, and reflects the general trend of coherent transition of the educational processes from one condition to another, forming a determinant information and communication basis for education development.
Open meta-search with OpenSearch: a case study
O'Riordan, Adrian P.
2007-01-01
The goal of this project was to demonstrate the possibilities of open source search engine and aggregation technology in a Web environment by building a meta-search engine which employs free open search engines and open protocols. In contrast many meta-search engines on the Internet use proprietary search systems. The search engines employed in this case study are all based on the OpenSearch protocol. OpenSearch-compliant systems support XML technologies such as RSS and Atom for aggregation a...
DEFF Research Database (Denmark)
Häyrynen, Teppo; Østerkryger, Andreas Dyhl; de Lasson, Jakob Rosenkrantz
2017-01-01
Recently, an open geometry Fourier modal method based on a new combination ofan open boundary condition and a non-uniform $k$-space discretization wasintroduced for rotationally symmetric structures providing a more efficientapproach for modeling nanowires and micropillar cavities [J. Opt. Soc. A...... moreaccurate and efficient modeling of open 3D nanophotonic structures....
Influence of Seismic Loading on Segment Opening of a Shield Tunnel
Chun-shan, Yang; Hai-hong, Mo; Jun-sheng, Chen; Yi-zhao, Wang
2014-01-01
The influence of seismic loading on segment opening of a shield tunnel was explored using the dynamic finite element method to analyze the distribution of segment opening under multidirectional seismic loading, combined with a typical engineering installation. The calculation of segment opening was deduced from equivalent continuous theory and segment opening was obtained through calculations. The results show that the scope of influence of the foundation excavation on segment opening is mainly resigned to within 5 segment rings next to the diaphragm wall and 4 joints nearest the working well when the tunnel is first excavated followed by the working well in the excavation order. The effect of seismic loading on segment opening is significant, and the minimum increase of the maximal segment opening owing to seismic loading is 16%, while that of the average opening is 27%. Segment opening under bidirectional coupled seismic loading is significantly greater than that under one-dimensional seismic loading. On the basis of the numerical calculations, the seismic acceleration and segment opening caused by seismic action were normalized, and a new calculation method was proposed for predicting the maximal segment opening of a shield tunnel at different depths under conditions of seismic loading. PMID:24955398
Elliott, Colin; Fabbro, Elaine
2015-01-01
To address challenges that learners, course creators, librarians and academics involved with OER and MOOCs are facing when looking for scholarly materials, Athabasca University Library has initiated the development of "the Open Library at AU." This open library is a full library website that provides easy access to open and free…
OpenMx: An Open Source Extended Structural Equation Modeling Framework
Boker, Steven; Neale, Michael; Maes, Hermine; Wilde, Michael; Spiegel, Michael; Brick, Timothy; Spies, Jeffrey; Estabrook, Ryne; Kenny, Sarah; Bates, Timothy; Mehta, Paras; Fox, John
2011-01-01
OpenMx is free, full-featured, open source, structural equation modeling (SEM) software. OpenMx runs within the "R" statistical programming environment on Windows, Mac OS-X, and Linux computers. The rationale for developing OpenMx is discussed along with the philosophy behind the user interface. The OpenMx data structures are…
Curious exceptions? : open source software and "open" technology
Nuvolari, A.; Rullani, F.; St. Amant, Kirk; Still, Brian
2007-01-01
The aim of thts chapter is to explore the differences and commonalities between open source software and other cases of open technology. The concept of open technology is used here to indicate various models of innovation based on the participation of a wide range of different actors who freely
Implementing Open Data: The Open Data Commons Project
Directory of Open Access Journals (Sweden)
Jordan Hatcher
2008-02-01
Full Text Available Free and libre/open source software (F/LOSS movements have spawned similar solutions in many other contexts, each at differing stages of development. As F/LOSS enters the routine and familiarity of middle age, the open content movement--open source for non-software copyright and best embodied by the work of Creative Commons--has just graduated university and is getting a feel for the world. Even younger is the open data movement, whose legal tools have just started to come online.
Design Support System for Open Distance Learning Student Teamwork
Putranto, A.; Pradipto, Y. D.
2017-01-01
Open distance learning students in doing team assignment, they seldom face to some problems such as student fell unfair in numbers of workload contribution, instructors also do not know which students do more work than others. So there are some questions ie: how to connect between instructor, team members, and working documents. Methods will be used are first, analyzing current condition and last by designing systems to connect between instructor, team members, and document. The expected result is support systems for open distance learning student teamwork.
OpenSHS: Open Smart Home Simulator
Directory of Open Access Journals (Sweden)
Nasser Alshammari
2017-05-01
Full Text Available This paper develops a new hybrid, open-source, cross-platform 3D smart home simulator, OpenSHS, for dataset generation. OpenSHS offers an opportunity for researchers in the field of the Internet of Things (IoT and machine learning to test and evaluate their models. Following a hybrid approach, OpenSHS combines advantages from both interactive and model-based approaches. This approach reduces the time and efforts required to generate simulated smart home datasets. We have designed a replication algorithm for extending and expanding a dataset. A small sample dataset produced, by OpenSHS, can be extended without affecting the logical order of the events. The replication provides a solution for generating large representative smart home datasets. We have built an extensible library of smart devices that facilitates the simulation of current and future smart home environments. Our tool divides the dataset generation process into three distinct phases: first design: the researcher designs the initial virtual environment by building the home, importing smart devices and creating contexts; second, simulation: the participant simulates his/her context-specific events; and third, aggregation: the researcher applies the replication algorithm to generate the final dataset. We conducted a study to assess the ease of use of our tool on the System Usability Scale (SUS.
OpenSHS: Open Smart Home Simulator.
Alshammari, Nasser; Alshammari, Talal; Sedky, Mohamed; Champion, Justin; Bauer, Carolin
2017-05-02
This paper develops a new hybrid, open-source, cross-platform 3D smart home simulator, OpenSHS, for dataset generation. OpenSHS offers an opportunity for researchers in the field of the Internet of Things (IoT) and machine learning to test and evaluate their models. Following a hybrid approach, OpenSHS combines advantages from both interactive and model-based approaches. This approach reduces the time and efforts required to generate simulated smart home datasets. We have designed a replication algorithm for extending and expanding a dataset. A small sample dataset produced, by OpenSHS, can be extended without affecting the logical order of the events. The replication provides a solution for generating large representative smart home datasets. We have built an extensible library of smart devices that facilitates the simulation of current and future smart home environments. Our tool divides the dataset generation process into three distinct phases: first design: the researcher designs the initial virtual environment by building the home, importing smart devices and creating contexts; second, simulation: the participant simulates his/her context-specific events; and third, aggregation: the researcher applies the replication algorithm to generate the final dataset. We conducted a study to assess the ease of use of our tool on the System Usability Scale (SUS).
Lee, W. Y.
2012-12-04
Previous thermodynamic analyses of carbon formation in SOFCs assumed that graphite could be used to represent the properties of carbon formed in the anode. It is generally observed, however, that catalytically grown carbon nanofibers (CNF) are more likely to form in the SOFC anode with nickel catalysts. The energetic and entropic properties of CNF are different from those of graphite.We compare equilibrium results based on thermochemical properties for graphite, to new results based on a previously reported value of an empirically determined Gibbs free energy for carbon fibers grown on a nickel support (with fitted values of H°CNF = 54.46 kJ/mol and S°CNF = 68.90 J/mol/K for a nickel crystal size of 5.4 nm). There is little difference in predictions of carbon formation under open-circuit conditions between the two carbon types for methane mixtures, with graphite predicted to form at lower temperatures than CNF. There is a much bigger difference in predictions for methanol mixtures, especially at low steam-carbon ratios. The differences for propane are even more pronounced, and the improved predictions assuming CNF are in closer agreement with past observations.We show a strong dependence of CNF formation and "coking threshold" on nickel crystallite size, supporting previous reports that the nickel particle size is a dominating parameter for controlling filament growth. If both carbon types are included in the calculations, only the thermodynamically favored form (i.e., the type having the lowest formation energy) exists. Predicted Nernst potentials are more-or-less independent of the carbon type and in agreement with measured open-circuit voltages. © 2012 The Electrochemical Society.
Iiyoshi, Toru, Ed.; Kumar, M. S. Vijay, Ed.
2008-01-01
Given the abundance of open education initiatives that aim to make educational assets freely available online, the time seems ripe to explore the potential of open education to transform the economics and ecology of education. Despite the diversity of tools and resources already available--from well-packaged course materials to simple games, for…
A New Way of Measuring Openness: The Open Governance Index
Directory of Open Access Journals (Sweden)
Liz Laffan
2012-01-01
Full Text Available Open source software is now "business as usual" in the mobile industry. While much attention is given to the importance of open source licenses, we argue in this article that the governance model can be as necessary to a project’s success and that projects vary widely in the governance models – whether open or closed – that they employ. Open source governance models describe the control points that are used to influence open source projects with regard to access to the source code, how the source code is developed, how derivatives are created, and the community structure of the project. Governance determines who has control over the project beyond what is deemed legally necessary via the open source licenses for that project. The purpose of our research is to define and measure the governance of open source projects, in other words, the extent to which decision-making in an open source project is "open" or "closed". We analyzed eight open source projects using 13 specific governance criteria across four areas of governance: access, development, derivatives and community. Our findings suggest that the most open platforms will be most successful in the long term, however we acknowledge exceptions to this rule. We also identify best practices that are common across these open source projects with regard to source code access, development of source code, management of derivatives, and community structure. These best practices increase the likelihood of developer use of and involvement in open source projects.
Ballooning modes on open magnetic field lines
International Nuclear Information System (INIS)
Hameiri, E.
1999-01-01
The ballooning instability on open magnetic field lines is given a thorough mathematical analysis. It is shown that resistive bounding ends (endplates) induce the same stability properties as insulating ends. When unstable, the maximal growth rate increases monotonically with boundary resistivity. An interchange instability may be present, and one necessary condition for its stability is that ∫dl/B be constant on pressure surfaces. (This is an equilibrium existence condition for systems with closed magnetic field lines.) Another necessary condition for interchange stability has the same form as in the closed line case. Precise necessary and sufficient stability criteria are given for various types of bounding ends, including insulating, resistive, and perfectly conducting. copyright 1999 American Institute of Physics
Evolution of the branchiostegal membrane and restricted gill openings in Actinopterygian fishes.
Farina, Stacy C; Near, Thomas J; Bemis, William E
2015-06-01
A phylogenetic survey is a powerful approach for investigating the evolutionary history of a morphological characteristic that has evolved numerous times without obvious functional implications. Restricted gill openings, an extreme modification of the branchiostegal membrane, are an example of such a characteristic. We examine the evolution of branchiostegal membrane morphology and highlight convergent evolution of restricted gill openings. We surveyed specimens from 433 families of actinopterygians for branchiostegal membrane morphology and measured head and body dimensions. We inferred a relaxed molecular clock phylogeny with branch length estimates based on nine nuclear genes sampled from 285 species that include all major lineages of Actinopterygii. We calculated marginal state reconstructions of four branchiostegal membrane conditions and found that restricted gill openings have evolved independently in at least 11 major actinopterygian clades, and the total number of independent origins of the trait is likely much higher. A principal component analysis revealed that fishes with restricted gill openings occupy a larger morphospace, as defined by our linear measurements, than do fishes with nonrestricted openings. We used a decision tree analysis of ecological data to determine if restricted gill openings are linked to certain environments. We found that fishes with restricted gill openings repeatedly occur under a variety of ecological conditions, although they are rare in open-ocean pelagic environments. We also tested seven ratios for their utility in distinguishing between fishes with and without restricted gill openings, and we propose a simple metric for quantifying restricted gill openings (RGO), defined as a ratio of the distance from the ventral midline to the gill opening relative to half the circumference of the head. Functional explanations for this specialized morphology likely differ within each clade, but its repeated evolution indicates a need
Energy Technology Data Exchange (ETDEWEB)
Pierret, Ch
1999-12-31
This short note summarizes the new conditions of electricity purchase as stipulated in the contracts passed between Electricite de France (EdF) and the independent companies exploiting cogeneration units. These new conditions should allow the continuation of the development of cogeneration units in a power market progressively opened to competition. (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Pierret, Ch.
1998-12-31
This short note summarizes the new conditions of electricity purchase as stipulated in the contracts passed between Electricite de France (EdF) and the independent companies exploiting cogeneration units. These new conditions should allow the continuation of the development of cogeneration units in a power market progressively opened to competition. (J.S.)
Outdoor cultivation of lutein-rich cells of Muriellopsis sp. in open ponds.
Blanco, Antonio M; Moreno, José; Del Campo, José A; Rivas, Joaquín; Guerrero, Miguel G
2007-01-01
The growth performance of the chlorophycean microalga Muriellopsis sp. outdoors in open tanks agitated with a paddlewheel and its ability to accumulate carotenoids have been evaluated throughout the year. The cells grown in the open system had free lutein as the main carotenoid, with violaxanthin, beta-carotene, and neoxanthin also present. Lutein content of the dry biomass ranged from 0.4 to 0.6%, depending on the growth and environmental conditions. In addition, the biomass of Muriellopsis sp. had a high content in both protein and lipids with about half of the fatty acids being of the polyunsaturated type, with alpha-linolenic acid accounting for almost 30% of the total fatty acids. The effect of determinant parameters on the performance of the cultures in open tanks was evaluated. Operating conditions that allow the maintenance of productive cultures were established under semicontinuous regime for 9 months throughout the year. Biomass and lutein yields in the open system were not far from those in closed tubular photobioreactors, and reached productivity values of 20 g dry biomass, containing around 100 mg lutein m(-2) day(-1) in summer. The outdoor culture of Muriellopsis sp. in open ponds thus represents a real alternative to established systems for the production of lutein.
Improving fuel utilization in open-hearth production
Energy Technology Data Exchange (ETDEWEB)
Rozin, S Ye
1981-01-01
According to calculations, open-hearth shops employing oxygen can save from 20-25 kilograms of conventional fuel per ton of steel with O/sub 2/ consumption of 40-50 cubic meters per ton. Research indicates that O/sub 2/ is used most effectively during that melt period which can be shortened to the maximum extent. The use of paired lance oil nozzles with tilted jets which work in sync with reversing of the primary flame made it possible to increase furnace output by 2-3% and reduce fuel consumption by 2-3%. When building new, or rehabilitating existing, KU (expansion not given) and other equipment in the gas removal section, allowance must be made for the prospects of intensification of the process, variation in the resistance of the furnace during a run and other factors. Proper planning of preventive maintenance is essential for fuel conservation. It is well known that the specific fuel consumption increases by 10-20%, and steel production drops, during the final third than open-hearth furnance run. The possible margin for increasing output of open-hearth furnaces amounts to 10-20%, and 5-15% in terms of fuel economy. The primary elements involved in controlling the heat conditions are the study of the furnace operating indicators as a function of the mode parameters and periodic checking of the combustion performance and draft conditions; there must be increased interest in using and fulfilling the most progressive norms.
Open-Air Schools. Bulletin, 1916, No. 23
Kingsley, Sherman C.; Dresslar, F. B.
1917-01-01
Open-air schools represent one of the latest developments in public-school organization. They came as the result of a desire for better conservation of the health of those children who, by reason of a tuberculous affection, poor nourishment, or other debilitating conditions, were unable to profit physically and mentally by the life and work of…
NCBI nr-aa BLAST: CBRC-LAFR-01-1042 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-1042 ref|ZP_01506538.1| inner-membrane translocator [Burkholderia phytofirm...ans PsJN] gb|EAV07683.1| inner-membrane translocator [Burkholderia phytofirmans PsJN] ZP_01506538.1 7.0 24% ...
NCBI nr-aa BLAST: CBRC-AGAM-03-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-03-0016 ref|ZP_01508657.1| CDP-alcohol phosphatidyltransferase [Burkholderia phytofirm...ans PsJN] gb|EAV06352.1| CDP-alcohol phosphatidyltransferase [Burkholderia phytofirmans PsJN] ZP_01508657.1 0.024 29% ...
NCBI nr-aa BLAST: CBRC-AGAM-03-0017 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-03-0017 ref|ZP_01512956.1| conserved hypothetical protein [Burkholderia phytofirm...ans PsJN] gb|EAV02438.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] ZP_01512956.1 0.070 25% ...
NCBI nr-aa BLAST: CBRC-DYAK-02-0076 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-02-0076 ref|ZP_01508657.1| CDP-alcohol phosphatidyltransferase [Burkholderia phytofirm...ans PsJN] gb|EAV06352.1| CDP-alcohol phosphatidyltransferase [Burkholderia phytofirmans PsJN] ZP_01508657.1 0.052 28% ...
Computing OpenSURF on OpenCL and General Purpose GPU
Directory of Open Access Journals (Sweden)
Wanglong Yan
2013-10-01
Full Text Available Speeded-Up Robust Feature (SURF algorithm is widely used for image feature detecting and matching in computer vision area. Open Computing Language (OpenCL is a framework for writing programs that execute across heterogeneous platforms consisting of CPUs, GPUs, and other processors. This paper introduces how to implement an open-sourced SURF program, namely OpenSURF, on general purpose GPU by OpenCL, and discusses the optimizations in terms of the thread architectures and memory models in detail. Our final OpenCL implementation of OpenSURF is on average 37% and 64% faster than the OpenCV SURF v2.4.5 CUDA implementation on NVidia's GTX660 and GTX460SE GPUs, repectively. Our OpenCL program achieved real-time performance (>25 Frames Per Second for almost all the input images with different sizes from 320*240 to 1024*768 on NVidia's GTX660 GPU, NVidia's GTX460SE GPU and AMD's Radeon HD 6850 GPU. Our OpenCL approach on NVidia's GTX660 GPU is more than 22.8 times faster than its original CPU version on Intel's Dual-Core E5400 2.7G on average.
76 FR 21894 - Federal Open Market Committee; Domestic Policy Directive of March 15, 2011
2011-04-19
.... The Federal Open Market Committee seeks monetary and financial conditions that will foster price... Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of March 15, 2011...
76 FR 1616 - Federal Open Market Committee; Domestic Policy Directive of December 14, 2010
2011-01-11
... Report. The Federal Open Market Committee seeks monetary and financial conditions that will foster price... Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of December 14...
Effects of different reaction mediums on ring opening polymerization ...
African Journals Online (AJOL)
This work examined the effects of reaction conditions on ring opening ... of this study was to observe molecular weight distribution, conversion rates, and thermal ... M monomer and 0.56 M solvent), 10 mg lipase were used in the experiments.
Zhang, Delong; Liang, Bishan; Wu, Xia; Wang, Zengjian; Xu, Pengfei; Chang, Song; Liu, Bo; Liu, Ming; Huang, Ruiwang
2015-01-01
The present study examined directional connections in the brain among resting-state networks (RSNs) when the participant had their eyes open (E0) or had their eyes closed (EC). The resting state fMRI data were collected from 20 healthy participants (9 males, 20.17 +/- 2.74 years) under the EO and EC
openBEB: open biological experiment browser for correlative measurements.
Ramakrishnan, Chandrasekhar; Bieri, Andrej; Sauter, Nora; Roizard, Sophie; Ringler, Philippe; Müller, Shirley A; Goldie, Kenneth N; Enimanev, Kaloyan; Stahlberg, Henning; Rinn, Bernd; Braun, Thomas
2014-03-26
New experimental methods must be developed to study interaction networks in systems biology. To reduce biological noise, individual subjects, such as single cells, should be analyzed using high throughput approaches. The measurement of several correlative physical properties would further improve data consistency. Accordingly, a considerable quantity of data must be acquired, correlated, catalogued and stored in a database for subsequent analysis. We have developed openBEB (open Biological Experiment Browser), a software framework for data acquisition, coordination, annotation and synchronization with database solutions such as openBIS. OpenBEB consists of two main parts: A core program and a plug-in manager. Whereas the data-type independent core of openBEB maintains a local container of raw-data and metadata and provides annotation and data management tools, all data-specific tasks are performed by plug-ins. The open architecture of openBEB enables the fast integration of plug-ins, e.g., for data acquisition or visualization. A macro-interpreter allows the automation and coordination of the different modules. An update and deployment mechanism keeps the core program, the plug-ins and the metadata definition files in sync with a central repository. The versatility, the simple deployment and update mechanism, and the scalability in terms of module integration offered by openBEB make this software interesting for a large scientific community. OpenBEB targets three types of researcher, ideally working closely together: (i) Engineers and scientists developing new methods and instruments, e.g., for systems-biology, (ii) scientists performing biological experiments, (iii) theoreticians and mathematicians analyzing data. The design of openBEB enables the rapid development of plug-ins, which will inherently benefit from the "house keeping" abilities of the core program. We report the use of openBEB to combine live cell microscopy, microfluidic control and visual
DEFF Research Database (Denmark)
Müller, Emmanuel; Assent, Ira; Günnemann, Stephan
2009-01-01
Subspace clustering and projected clustering are recent research areas for clustering in high dimensional spaces. As the field is rather young, there is a lack of comparative studies on the advantages and disadvantages of the different algorithms. Part of the underlying problem is the lack...... of available open source implementations that could be used by researchers to understand, compare, and extend subspace and projected clustering algorithms. In this paper, we discuss the requirements for open source evaluation software. We propose OpenSubspace, an open source framework that meets...... these requirements. OpenSubspace integrates state-of-the-art performance measures and visualization techniques to foster research in subspace and projected clustering....
Open Babel: An open chemical toolbox
Directory of Open Access Journals (Sweden)
O'Boyle Noel M
2011-10-01
Full Text Available Abstract Background A frequent problem in computational modeling is the interconversion of chemical structures between different formats. While standard interchange formats exist (for example, Chemical Markup Language and de facto standards have arisen (for example, SMILES format, the need to interconvert formats is a continuing problem due to the multitude of different application areas for chemistry data, differences in the data stored by different formats (0D versus 3D, for example, and competition between software along with a lack of vendor-neutral formats. Results We discuss, for the first time, Open Babel, an open-source chemical toolbox that speaks the many languages of chemical data. Open Babel version 2.3 interconverts over 110 formats. The need to represent such a wide variety of chemical and molecular data requires a library that implements a wide range of cheminformatics algorithms, from partial charge assignment and aromaticity detection, to bond order perception and canonicalization. We detail the implementation of Open Babel, describe key advances in the 2.3 release, and outline a variety of uses both in terms of software products and scientific research, including applications far beyond simple format interconversion. Conclusions Open Babel presents a solution to the proliferation of multiple chemical file formats. In addition, it provides a variety of useful utilities from conformer searching and 2D depiction, to filtering, batch conversion, and substructure and similarity searching. For developers, it can be used as a programming library to handle chemical data in areas such as organic chemistry, drug design, materials science, and computational chemistry. It is freely available under an open-source license from http://openbabel.org.
Open Babel: An open chemical toolbox
2011-01-01
Background A frequent problem in computational modeling is the interconversion of chemical structures between different formats. While standard interchange formats exist (for example, Chemical Markup Language) and de facto standards have arisen (for example, SMILES format), the need to interconvert formats is a continuing problem due to the multitude of different application areas for chemistry data, differences in the data stored by different formats (0D versus 3D, for example), and competition between software along with a lack of vendor-neutral formats. Results We discuss, for the first time, Open Babel, an open-source chemical toolbox that speaks the many languages of chemical data. Open Babel version 2.3 interconverts over 110 formats. The need to represent such a wide variety of chemical and molecular data requires a library that implements a wide range of cheminformatics algorithms, from partial charge assignment and aromaticity detection, to bond order perception and canonicalization. We detail the implementation of Open Babel, describe key advances in the 2.3 release, and outline a variety of uses both in terms of software products and scientific research, including applications far beyond simple format interconversion. Conclusions Open Babel presents a solution to the proliferation of multiple chemical file formats. In addition, it provides a variety of useful utilities from conformer searching and 2D depiction, to filtering, batch conversion, and substructure and similarity searching. For developers, it can be used as a programming library to handle chemical data in areas such as organic chemistry, drug design, materials science, and computational chemistry. It is freely available under an open-source license from http://openbabel.org. PMID:21982300
On trans-parenchymal transport after blood brain barrier opening: pump-diffuse-pump hypothesis
Postnov, D. E.; Postnikov, E. B.; Karavaev, A. S.; Glushkovskaya-Semyachkina, O. V.
2018-04-01
Transparenchymal transport attracted the attention of many research groups after the discovery of glymphatic mechanism for the brain drainage in 2012. While the main facts of rapid transport of substances across the parenchyma are well established experimentally, specific mechanisms that drive this drainage are just hypothezised but not proved yed. Moreover, the number of modeling studies show that the pulse wave powered mechanism is unlikely able to perform pumping as suggested. Thus, the problem is still open. In addition, new data obtained under the conditions of intensionally opened blood brain barrier shows the presence of equally fast transport in opposite durection. In our study we investigate the possible physical mechanisms for rapid transport of substances after the opening of blood-brain barrier under the conditions of zero net flow.
Open Science and Open Data: Evolving Business Models
Melero, Remedios
2013-01-01
The rise of ICT has changed the way scientific inputs and outputs are disseminated and diffused. As a consequence, new business models for open access to Scientific publications and datasets are emerging. This session will explore the new features of the business models for open access and open data as well as the associated benefits and risks.
An opening criterion for dust gaps in protoplanetary discs
Dipierro, Giovanni; Laibe, Guillaume
2017-01-01
We aim to understand under which conditions a low mass planet can open a gap in viscous dusty protoplanetary discs. For this purpose, we extend the theory of dust radial drift to include the contribution from the tides of an embedded planet and from the gas viscous forces. From this formalism, we derive i) a grain size-dependent criterion for dust gap opening in discs, ii) an estimate of the location of the outer edge of the dust gap and iii) an estimate of the minimum Stokes number above whi...
Armbruster, Chris
2008-01-01
Open source, open content and open access are set to fundamentally alter the conditions of knowledge production and distribution. Open source, open content and open access are also the most tangible result of the shift towards e-science and digital networking. Yet, widespread misperceptions exist about the impact of this shift on knowledge…
Energy conditions and spacetime singularities
International Nuclear Information System (INIS)
Tipler, F.J.
1978-01-01
In this paper, a number of theorems are proven which collectively show that singularities will occur in spacetime under weaker energy conditions than the strong energy condition. In particular, the Penrose theorem, which uses only the weak energy condition but which applies only to open universes, is extended to all closed universes which have a Cauchy surface whose universal covering manifold is not a three-sphere. Furthermore, it is shown that the strong energy condition in the Hawking-Penrose theorem can be replaced by the weak energy condition and the assumption that the strong energy condition holds only on the average. In addition, it is demonstrated that if the Universe is closed, then the existence of singularities follows from the averaged strong energy condition alone. It is argued that any globally hyperbolic spacetime which satisfies the weak energy condition and which contains a black hole must be null geodesically incomplete
NCBI nr-aa BLAST: CBRC-XTRO-01-0245 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0245 ref|ZP_01508011.1| inner-membrane translocator [Burkholderia phytofirm...ans PsJN] gb|EAV07126.1| inner-membrane translocator [Burkholderia phytofirmans PsJN] ZP_01508011.1 3e-34 38% ...
NCBI nr-aa BLAST: CBRC-CREM-01-1349 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1349 ref|ZP_01506491.1| inner-membrane translocator [Burkholderia phytofirm...ans PsJN] gb|EAV07636.1| inner-membrane translocator [Burkholderia phytofirmans PsJN] ZP_01506491.1 1e-34 40% ...
NCBI nr-aa BLAST: CBRC-CBRE-01-1545 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CBRE-01-1545 ref|ZP_01512285.1| inner-membrane translocator [Burkholderia phytofirm...ans PsJN] gb|EAV03005.1| inner-membrane translocator [Burkholderia phytofirmans PsJN] ZP_01512285.1 6e-69 57% ...
NCBI nr-aa BLAST: CBRC-CREM-01-1344 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1344 ref|ZP_01513006.1| sodium:dicarboxylate symporter [Burkholderia phytofirm...ans PsJN] gb|EAV02321.1| sodium:dicarboxylate symporter [Burkholderia phytofirmans PsJN] ZP_01513006.1 4e-73 66% ...
NCBI nr-aa BLAST: CBRC-DMEL-02-0082 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0082 ref|ZP_01510105.1| conserved hypothetical protein [Burkholderia phytofirm...ans PsJN] gb|EAV05658.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] ZP_01510105.1 5e-08 25% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0174 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0174 ref|ZP_01508925.1| inner-membrane translocator [Burkholderia phytofirm...ans PsJN] gb|EAV06620.1| inner-membrane translocator [Burkholderia phytofirmans PsJN] ZP_01508925.1 1e-101 66% ...
Program of evaluations for nuclear data centers
International Nuclear Information System (INIS)
Cunha Menezes Filho, A. da.
1980-01-01
Standard problems for evaluating basic data libraries of multigroup constant generation, and codes for calculating integral parameters existing or will exist in the near future in the advanced study division (EAV), are defined. (M.C.K.) [pt
Cozzi, Patrick
2012-01-01
Get Real-World Insight from Experienced Professionals in the OpenGL Community With OpenGL, OpenGL ES, and WebGL, real-time rendering is becoming available everywhere, from AAA games to mobile phones to web pages. Assembling contributions from experienced developers, vendors, researchers, and educators, OpenGL Insights presents real-world techniques for intermediate and advanced OpenGL, OpenGL ES, and WebGL developers. Go Beyond the Basics The book thoroughly covers a range of topics, including OpenGL 4.2 and recent extensions. It explains how to optimize for mobile devices, explores the design
Opening Pandora's Box: The impact of open system modeling on interpretations of anoxia
Hotinski, Roberta M.; Kump, Lee R.; Najjar, Raymond G.
2000-06-01
The geologic record preserves evidence that vast regions of ancient oceans were once anoxic, with oxygen levels too low to sustain animal life. Because anoxic conditions have been postulated to foster deposition of petroleum source rocks and have been implicated as a kill mechanism in extinction events, the genesis of such anoxia has been an area of intense study. Most previous models of ocean oxygen cycling proposed, however, have either been qualitative or used closed-system approaches. We reexamine the question of anoxia in open-system box models in order to test the applicability of closed-system results over long timescales and find that open and closed-system modeling results may differ significantly on both short and long timescales. We also compare a scenario with basinwide diffuse upwelling (a three-box model) to a model with upwelling concentrated in the Southern Ocean (a four-box model). While a three-box modeling approach shows that only changes in high-latitude convective mixing rate and character of deepwater sources are likely to cause anoxia, four-box model experiments indicate that slowing of thermohaline circulation, a reduction in wind-driven upwelling, and changes in high-latitude export production may also cause dysoxia or anoxia in part of the deep ocean on long timescales. These results suggest that box models must capture the open-system and vertically stratified nature of the ocean to allow meaningful interpretations of long-lived episodes of anoxia.
Chitosan production by psychrotolerant Rhizopus oryzae in non-sterile open fermentation conditions.
Tasar, Ozden Canli; Erdal, Serkan; Taskin, Mesut
2016-08-01
A new chitosan producing fungus was locally isolated from soil samples collected around Erzurum, Turkey and identified as Rhizopus oryzae PAS 17 (GenBank accession number KU318422.1). Cultivation in low cost non-sterile conditions was achieved by exploiting its ability to grow at low temperature and pH, thus, undesired microbial contamination could be eliminated when appropriate culture conditions (incubation temperature as 15°C and initial pH of the medium as 4.5) were selected. Medium composition and culture conditions were optimized using Taguchi orthogonal array (OA) design of experiment (DOE). An OA layout of L16 (4(5)) was constructed with five most influensive factors at four levels on chitosan production like, carbon source (molasses), metal ion (Mg(2+)), inoculum amount, agitation speed and incubation time. The optimal combinations of factors (molasses, 70ml/l; MgSO4·7H2O, 0.5g/l; inoculum, 6.7×10(6) spores/disc; agitation speed, 150rpm and incubation time, 8days) obtained from the proposed DOE methodology was further validated by analysis of variance (ANOVA) test and the results revealed the increment of chitosan and biomass yields of 14.45 and 8.58 folds from its unoptimized condition, respectively. Copyright © 2016 Elsevier B.V. All rights reserved.
DEFF Research Database (Denmark)
Dalsgaard, Christian; Thestrup, Klaus
2015-01-01
The objective of the paper is to present a pedagogical approach to openness. The paper develops a framework for understanding the pedagogical opportunities of openness in education. Based on the pragmatism of John Dewey and sociocultural learning theory, the paper defines openness in education...... as a matter of engaging educational activities in sociocultural practices of a surrounding society. Openness is not only a matter of opening up the existing, but of developing new educational practices that interact with society. The paper outlines three pedagogical dimensions of openness: transparency...... practices. Openness as joint engagement in the world aims at establishing interdependent collaborative relationships between educational institutions and external practices. To achieve these dimensions of openness, educational activities need to change and move beyond the course as the main format...
NCBI nr-aa BLAST: CBRC-ACAR-01-0711 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0711 ref|ZP_01509857.1| glycosyl transferase, family 2 [Burkholderia phytofirm...ans PsJN] gb|EAV05410.1| glycosyl transferase, family 2 [Burkholderia phytofirmans PsJN] ZP_01509857.1 4.7 30% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0225 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0225 ref|ZP_01508363.1| Collagen triple helix repeat [Burkholderia phytofirm...ans PsJN] gb|EAV07478.1| Collagen triple helix repeat [Burkholderia phytofirmans PsJN] ZP_01508363.1 0.010 29% ...
Zooplankton responses to sandbar opening in a tropical eutrophic coastal lagoon
Santangelo, Jayme M.; de M. Rocha, Adriana; Bozelli, Reinaldo L.; Carneiro, Luciana S.; de A. Esteves, Francisco
2007-02-01
The effects of a disturbance by sandbar opening on the zooplankton community were evaluated through a long-term study in an eutrophic and oligohaline system, Imboassica Lagoon, Rio de Janeiro, Brazil. Zooplankton samples and limnological data were collected monthly from March 2000 to February 2003. Before the sandbar was opened in February 2001, the lagoon showed eutrophic conditions, with high mean nutrient concentrations and low salinity (total nitrogen - TN = 190.28 μM, chlorophyll a content - Chl. a = 104.60 μg/L and salinity = 0.87'). During this period, the zooplankton species present, such as the rotifers Brachionus calyciflorus and Brachionus havanaensis, were typical of freshwater to oligohaline and eutrophic environments. After the sandbar opening, the lagoon changed to a lower trophic status and increased salinity (TN = 55.11 μM, Chl. a = 27.56 μg/L and salinity = 19.64'). As a result, the zooplankton community came to consist largely of the rotifer Brachionus plicatilis, marine copepods and meroplanktonic larvae, mainly Gastropoda. Salinity was the main force structuring the zooplankton community after the sandbar opening. Two years after this episode, the prior zooplankton community had not reestablished itself, indicating a low resilience to this disturbance. The conditions developed prior to a sandbar opening can be crucial to the community responses in the face of this disturbance and for the capacity of the original zooplankton community to re-establish itself.
OpenOffice y el formato OpenDocument: funciones y compatibilidad
Codina, Lluís; Rovira, Cristòfol
2008-01-01
Presentation of the OpenOffice suite and the ODF format. The basic characteristics of OpenOffice and ODF format are presented. The need for the adoption of open-source software and open formats is discussed. Finally, an ODF case study of converting xhtml documents related to an e-learning course is presented.
Valkenburg, P.M.
2015-01-01
Open access week Van 19 tot en met 25 oktober 2015 vond wereldwijd de Open Access Week plaats. Tijdens deze week werden er over de hele wereld evenementen georganiseerd waar open access een rol speelt. Ook in Nederland zijn er diverse symposia, workshops en debatten georganiseerd zoals het debat in
DEFF Research Database (Denmark)
Schneider, Till; Hauschild, Anne-Christin; Baumbach, Jörg Ingo
2013-01-01
data integration and semi-automated data analysis, in particular with regard to the rapid data accumulation, emerging from the high-throughput nature of the MCC/IMS technology. Here, we present a comprehensive database application and analysis platform, which combines metabolic maps with heterogeneous...... biomedical data in a well-structured manner. The design of the database is based on a hybrid of the entity-attribute-value (EAV) model and the EAV-CR, which incorporates the concepts of classes and relationships. Additionally it offers an intuitive user interface that provides easy and quick access...... to have a clear understanding of the detailed composition of human breath. Therefore, in addition to the clinical studies, there is a need for a flexible and comprehensive centralized data repository, which is capable of gathering all kinds of related information. Moreover, there is a demand for automated...
OpenADR Open Source Toolkit: Developing Open Source Software for the Smart Grid
Energy Technology Data Exchange (ETDEWEB)
McParland, Charles
2011-02-01
Demand response (DR) is becoming an increasingly important part of power grid planning and operation. The advent of the Smart Grid, which mandates its use, further motivates selection and development of suitable software protocols to enable DR functionality. The OpenADR protocol has been developed and is being standardized to serve this goal. We believe that the development of a distributable, open source implementation of OpenADR will benefit this effort and motivate critical evaluation of its capabilities, by the wider community, for providing wide-scale DR services
Sudden transition and sudden change from open spin environments
International Nuclear Information System (INIS)
Hu, Zheng-Da; Xu, Jing-Bo; Yao, Dao-Xin
2014-01-01
We investigate the necessary conditions for the existence of sudden transition or sudden change phenomenon for appropriate initial states under dephasing. As illustrative examples, we study the behaviors of quantum correlation dynamics of two noninteracting qubits in independent and common open spin environments, respectively. For the independent environments case, we find that the quantum correlation dynamics is closely related to the Loschmidt echo and the dynamics exhibits a sudden transition from classical to quantum correlation decay. It is also shown that the sudden change phenomenon may occur for the common environment case and stationary quantum discord is found at the high temperature region of the environment. Finally, we investigate the quantum criticality of the open spin environment by exploring the probability distribution of the Loschmidt echo and the scaling transformation behavior of quantum discord, respectively. - Highlights: • Sudden transition or sudden change from open spin baths are studied. • Quantum discord is related to the Loschmidt echo in independent open spin baths. • Steady quantum discord is found in a common open spin bath. • The probability distribution of the Loschmidt echo is analyzed. • The scaling transformation behavior of quantum discord is displayed
International Nuclear Information System (INIS)
Thorndike, A.M.
1979-01-01
The main objective of the two open areas in the present ISABELLE design has been to provide flexibility with respect to the size and shape of experimental equipment that would eventually be installed there. No permanent building would be installed initially. One possibility would be to enclose each experiment in a temporary structure that would provide weatherproofing and shielding; another possibility would be to erect a permanent building at a later time, when experience has made the needs clearer than they are at present. The secondary objective of the design of open areas has been to keep initial costs as low as practicable. Another objective might be added, however, which we indicate by the term ''open access.'' This note will explore this idea and some design concepts based on it. In the ISABELLE 1977 summer workshop there was considerable discussion of the importance of techniques for inserting large pieces of experimental equipment quickly and removing them with equal ease and speed. Since enclosed halls have certain restrictions in this respect, open areas may be helpful in providing this feature. If the mechanical and electrical aspects could be handled quickly, one might even attempt to reduce the time spent on bureaucratic procedures in order to expedite the introduction of new experiments and new ideas in these areas
DEFF Research Database (Denmark)
Ekstrøm, Jeannette
Open Access is high on the agenda in Denmark and internationally. Denmark has announced a national strategy for Open Access that aims to achieve Open Access to 80% in 2017 and 100% in 2022 to peer review research articles. All public Danish funders as well as H2020 requires that all peer review...... articles that is an outcome of their funding will be Open Access. Uploading your full texts (your final author manuscript after review ) to DTU Orbit is a fundamental part of providing Open Access to your research. We are here to answer all your questions with regards to Open Access and related topics...... such as copyright, DTU Orbit, Open Access journals, APCs, Vouchers etc....
NCBI nr-aa BLAST: CBRC-MMUS-18-0004 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-18-0004 ref|ZP_01509120.1| PE-PGRS family protein [Burkholderia phytofirm...ans PsJN] gb|EAV06815.1| PE-PGRS family protein [Burkholderia phytofirmans PsJN] ZP_01509120.1 1e-21 33% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0189 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0189 ref|ZP_01508363.1| Collagen triple helix repeat [Burkholderia phytofirm...ans PsJN] gb|EAV07478.1| Collagen triple helix repeat [Burkholderia phytofirmans PsJN] ZP_01508363.1 3e-35 46% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0102 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0102 ref|ZP_01508363.1| Collagen triple helix repeat [Burkholderia phytofirm...ans PsJN] gb|EAV07478.1| Collagen triple helix repeat [Burkholderia phytofirmans PsJN] ZP_01508363.1 9e-39 51% ...
NCBI nr-aa BLAST: CBRC-GACU-01-0025 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-01-0025 ref|ZP_01508363.1| Collagen triple helix repeat [Burkholderia phytofirm...ans PsJN] gb|EAV07478.1| Collagen triple helix repeat [Burkholderia phytofirmans PsJN] ZP_01508363.1 8e-15 34% ...
... Home » Statistics and Data » Glaucoma, Open-angle Listen Glaucoma, Open-angle Open-angle Glaucoma Defined In open-angle glaucoma, the fluid passes ... 2010 2010 U.S. Age-Specific Prevalence Rates for Glaucoma by Age and Race/Ethnicity The prevalence of ...
Real analytic solutions for marginal deformations in open superstring field theory
International Nuclear Information System (INIS)
Okawa, Yuji
2007-01-01
We construct analytic solutions for marginal deformations satisfying the reality condition in open superstring field theory formulated by Berkovits when operator products made of the marginal operator and the associated superconformal primary field are regular. Our strategy is based on the recent observation by Erler that the problem of finding solutions for marginal deformations in open superstring field theory can be reduced to a problem in the bosonic theory of finding a finite gauge parameter for a certain pure-gauge configuration labeled by the parameter of the marginal deformation. We find a gauge transformation generated by a real gauge parameter which infinitesimally changes the deformation parameter and construct a finite gauge parameter by its path-ordered exponential. The resulting solution satisfies the reality condition by construction
Real analytic solutions for marginal deformations in open superstring field theory
International Nuclear Information System (INIS)
Okawa, Y.
2007-04-01
We construct analytic solutions for marginal deformations satisfying the reality condition in open superstring field theory formulated by Berkovits when operator products made of the marginal operator and the associated superconformal primary field are regular. Our strategy is based on the recent observation by Erler that the problem of finding solutions for marginal deformations in open superstring field theory can be reduced to a problem in the bosonic theory of finding a finite gauge parameter for a certain pure-gauge configuration labeled by the parameter of the marginal deformation. We find a gauge transformation generated by a real gauge parameter which infinitesimally changes the deformation parameter and construct a finite gauge parameter by its path-ordered exponential. The resulting solution satisfies the reality condition by construction. (orig.)
76 FR 10364 - Federal Open Market Committee; Domestic Policy Directive of January 25-26, 2011
2011-02-24
... Report. The Federal Open Market Committee seeks monetary and financial conditions that will foster price... Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of January 25-26...
76 FR 37114 - Federal Open Market Committee; Domestic Policy Directive of April 26-27, 2011
2011-06-24
... Report. The Federal Open Market Committee seeks monetary and financial conditions that will foster price... Market Account Manager and the Secretary will keep the Committee informed of ongoing developments... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of April 26-27...
Evaluation of the stress distribution on the pressure vessel head with multi-openings
Energy Technology Data Exchange (ETDEWEB)
Kim, K.S.; Kim, T.W.; Jeong, K.H.; Lee, G.M. [Korea Atomic Energy Research Institute, Taejon (Korea)
1998-06-01
This report discusses and analyzes the stress distribution on the pressure vessel head with multi-openings(3 PSV nozzles, 2 SDS nozzles and 1 Man Way) according to patterns of the opening distance. The pressurizer of Korea Standardized Nuclear Power Plant(Ulchin 3 and 4), which meets requirements of the cyclic operation and opening design defined by ASME code, was used as the basic model for that. Stress changes according to the distance between openings were investigated and the factors which should be considered for the opening design were analyzed. Also, the nozzle loads at Level A, B conditions and internal pressure were applied in order to evaluate changes of head stress distributions due to nozzle loads. (author). 6 refs., 29 figs., 4 tabs.
Heterogeneous compute in computer vision: OpenCL in OpenCV
Gasparakis, Harris
2014-02-01
We explore the relevance of Heterogeneous System Architecture (HSA) in Computer Vision, both as a long term vision, and as a near term emerging reality via the recently ratified OpenCL 2.0 Khronos standard. After a brief review of OpenCL 1.2 and 2.0, including HSA features such as Shared Virtual Memory (SVM) and platform atomics, we identify what genres of Computer Vision workloads stand to benefit by leveraging those features, and we suggest a new mental framework that replaces GPU compute with hybrid HSA APU compute. As a case in point, we discuss, in some detail, popular object recognition algorithms (part-based models), emphasizing the interplay and concurrent collaboration between the GPU and CPU. We conclude by describing how OpenCL has been incorporated in OpenCV, a popular open source computer vision library, emphasizing recent work on the Transparent API, to appear in OpenCV 3.0, which unifies the native CPU and OpenCL execution paths under a single API, allowing the same code to execute either on CPU or on a OpenCL enabled device, without even recompiling.
Hu, Qingsong; Rahman, Hafiz Abd ur; Jiang, Yazhou; Zhang, Shouyu; Shentu, Jikang
2018-06-01
Attracting released hatchery-reared fish to designated areas during the growth process is vital to realize the objectives of sea ranching. Based on the bottom artificial reefs and surface kelp culture facilities in the Xiangshan Bay sea ranch, we proposed systematic techniques related to acoustic conditioning of the black seabream ( Sparus macrocephalus). Experiments conducted in 12 m × 10 m × 1.6 m ponds on Xixuan Island showed that black seabream was positively sensitive to 500-600 Hz periodic signals. Conditioned responses were apparent after 8 d. Two to three days were required for recovery of the memory of a conditioned response after a 20-day interval. According to the practical application requirements in the open sea, unattended acoustic conditioning equipment was developed. The ranching equipment was used in 12 m × 12 m × 2.5 m cages, and the behavior of black seabream juveniles was successfully guided after 7 days. Of the 16000 released fish, 82.5% of them were conditioned with a flexible grading net. To avoid inducing a stress response, the juveniles were released into the sea ranch in situ from the net cage. The acoustic conditioning equipments were moved into the open sea and the aggregation phenomenon of the released fish was observed when the sound was played. After 6 months of investigation and based on Sr+ marking, only one acoustically conditioned fish was found outside the 3.5-km2 sea ranch area, thereby reached the goal of guiding activity. The practical effect in the Xiangshan Bay sea ranch showed the validity of the acoustic conditioning system, which may contribute to improve the operation of the sea ranches in the East China Sea.
Heat or mass transfer from an open cavity
Kuiken, H.K.
1978-01-01
This paper presents a mathematical model for heat or mass transfer from an open cavity. It is assumed that the Péclet number, based on conditions at the cavity, and the Prandtl number are both large. The model assumes heat- or mass-transfer boundary layers at the rim of the cavity vortex flow. Heat
Numerical study on heat transfer characteristics of liquid-fueled molten salt using OpenFOAM
International Nuclear Information System (INIS)
Jeong, Yeong Shin; Bang, In Cheol
2017-01-01
To pursue sustainability and safety enhancement of nuclear energy, molten salt reactor is regarded as a promising candidate among various types of gen-IV reactors. Besides, pyroprocessing, which treats molten salt containing fission products, should consider safety related to decay heat from fuel material. For design of molten salt-related nuclear system, it is required to consider both thermal-hydraulic characteristics and neutronic behaviors for demonstration. However, fundamental heat transfer study of molten salt in operation condition is not easy to be experimentally studied due to its large scale, high temperature condition as well as difficulties of treating fuel material. >From that reason, numerical study can have benefit to investigate behaviors of liquid-fueled molten salt in real condition. In this study, open source CFD package OpenFOAM was used to analyze liquid-fueled molten salt loop having internal heat source as a first step of research. Among various molten salts considered as a candidate of liquid fueled molten salt reactors, in this study, FLiBe was chosen as liquid salt. For simulating heat generation from fuel material within fluid flow, volumetric heat source was set for fluid domain and OpenFOAM solver was modified as fvOptions as customized. To investigate thermal-hydraulic behavior of molten salt, CFD model was developed and validated by comparing experimental results in terms of heat transfer and pressure drop. As preliminary stage, 2D cavity simulations were performed to validate the modeling capacity of modified solver of OpenFOAM by comparison with those of ANSYS-CFX. In addition, cases of external heat flux and internal heat source were compared to configure the effect of heat source setting in various operation condition. As a result, modified solver of OpenFOAM considering internal heat source have sufficient modeling capacity to simulate liquid-fueled molten salt systems including heat generation cases. (author)
NCBI nr-aa BLAST: CBRC-ACAR-01-0939 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0939 ref|ZP_01513727.1| hypothetical protein BphytDRAFT_7135 [Burkholderia phytofirm...ans PsJN] gb|EAV01607.1| hypothetical protein BphytDRAFT_7135 [Burkholderia phytofirmans PsJN] ZP_01513727.1 5.4 32% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-1201 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-1201 ref|ZP_01508587.1| hypothetical protein BphytDRAFT_4874 [Burkholderia phytofirm...ans PsJN] gb|EAV06282.1| hypothetical protein BphytDRAFT_4874 [Burkholderia phytofirmans PsJN] ZP_01508587.1 0.010 34% ...
NCBI nr-aa BLAST: CBRC-PABE-13-0007 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-13-0007 ref|ZP_01510961.1| major facilitator superfamily MFS_1 [Burkholderia phytofirm...ans PsJN] gb|EAV04498.1| major facilitator superfamily MFS_1 [Burkholderia phytofirmans PsJN] ZP_01510961.1 8.2 32% ...
NCBI nr-aa BLAST: CBRC-DMEL-04-0059 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-04-0059 ref|ZP_01511301.1| Prophage tail length tape measure [Burkholderia phytofirm...ans PsJN] gb|EAV04010.1| Prophage tail length tape measure [Burkholderia phytofirmans PsJN] ZP_01511301.1 1e-07 26% ...
NCBI nr-aa BLAST: CBRC-PTRO-18-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-18-0038 ref|ZP_01507184.1| glycogen/starch/alpha-glucan phosphorylases [Burkholderia phytofirm...ans PsJN] gb|EAV08329.1| glycogen/starch/alpha-glucan phosphorylases [Burkholderia phytofirmans PsJN] ZP_01507184.1 4.8 26% ...
Electron-confined LO-phonon scattering in GaAs-Al0.45Ga0.55As ...
Indian Academy of Sciences (India)
resonance [17] – at high field where a longitudinal-optical (LO) phonon mediates a transition ..... This competition is controlled through the factor. Γ = γLLw ... [3] L Eaves, F W Sheard and G A T Toombs, Band structure engineering in semicon-.
Reference levels for assays in opened installations of industrial radiography
International Nuclear Information System (INIS)
Leocadio, Joao C.; Tauhata, Luiz; Crispim, Verginia R.
2001-01-01
This work had as objectives to analyze the facilities open of industrial x-ray to obtain the distribution of doses in the operators and present proposed for the reference levels. The results of the monitoring revealed an improvement of the radiation protection conditions in the facilities and that the risk of potential exposure was reduced. The advantage of the proposed reference levels is that the supervisors would enlarge the frequency of audits in the facilities opened to accomplish the investigations and interventions.The facilities open with 'bunkers' presented distributions with 95% of the doses below 0,2 mSv and the distributions of the facilities with cordoned area they had 75% of the doses below 0,4 mSv. (author)
L’iniziativa OpenDataNetwork, OpenData senza confini
Directory of Open Access Journals (Sweden)
Simone Giannechini
2013-12-01
Full Text Available In the last few years, the Open Data movement has made a significant impact on the IT world by bringing the att ention to an unexploited value represented by the tremendous amount of data that was kept hidden behind the gates of the existing infrastructures, both in public administrations and in private companies. This value can be declined in many ways depending on the perspective of the observer since unprecedented possibilities to correlate different sources of data to mine hidden trends and patt erns, can all at a sudden provide innovative ways to evaluate and monitor events and real life situation.After the initial period of the widespread adoption of the Open Data principles, we are now experimenting a situation where the amount of data available as Open Data is becoming overwhelming as such the need for some kind of coordinationeffort between different Open Data infrastructures is needed in order to make the data easier to browse and to exploit. This is the goal of the Open Data Network initiative. The Open Data Network initiative aim at bringing together a certain number ofItalian Public Administration with the goal of creating a standard infrastructure based on Open Source components suitable for the dissemination of data as Open Data. Moreover it aims at creating a network between each partner's node in order to ease the life of the end user as he will be allowed to access a central hub where all the information will be harvested, rather than having to deal with each single partner's infrastructure.
Bonita Open Solution 5.x essentials
Bhat, Rohit
2013-01-01
A practical, intuitive guide for modeling complex business processes as full-scale applications using the ease and power of Bonita Open Solution.If you are a business application developer looking forward to model business processes intuitively in a workflow, with various conditions and transitions then this book is for you. Basic knowledge of Java or Groovy is necessary to help you develop these applications. Knowledge of HTML and JavaScript/JQuery will be helpful but not mandatory.
Open Source Opens Opportunities for Army's Simulation System
National Research Council Canada - National Science Library
Parsons, Douglas J; Wittman, Jr, Robert L
2005-01-01
.... Postured as an open-architecture, open-source application, the OneSAF program will put this software into the hands of a vast number of developers throughout the Department of Defense with the intent...
Open Data as Open Educational Resources: Case studies of emerging practice
Atenas, Javiera; Havemann, Leo
2018-01-01
This collection presents the stories of our contributors’ experiences and insights, in order to demonstrate the enormous potential for openly-licensed and accessible datasets (Open Data) to be used as Open Educational Resources (OER). Open Data is an umbrella term describing openly-licensed, interoperable, and reusable datasets which have been created and made available to the public by national or local governments, academic researchers, or other organisations. These datasets can be accessed...
Directory of Open Access Journals (Sweden)
Ondřej Košulič
Full Text Available Traditional woodland management created a mosaic of differently aged patches providing favorable conditions for a variety of arthropods. After abandonment of historical ownership patterns and traditional management and the deliberate transformation to high forest after World War II, large forest areas became darker and more homogeneous. This had significant negative consequences for biodiversity. An important question is whether even small-scale habitat structures maintained by different levels of canopy openness in abandoned coppiced forest may constitute conditions suitable for forest as well as open habitat specialists. We investigated the effect of canopy openness in former traditionally coppiced woodlands on the species richness, functional diversity, activity density, conservation value, and degree of rareness of epigeic spiders. In each of the eight studied locations, 60-m-long transect was established consisting of five pitfall traps placed at regular 15 m intervals along the gradient. Spiders were collected from May to July 2012. We recorded 90 spider species, including high proportions of xeric specialists (40% and red-listed threatened species (26%. The peaks of conservation indicators, as well as spider community abundance, were shifted toward more open canopies. On the other hand, functional diversity peaked at more closed canopies followed by a rapid decrease with increasing canopy openness. Species richness was highest in the middle of the canopy openness gradient, suggesting an ecotone effect. Ordinations revealed that species of conservation concern tended to be associated with sparse and partly opened canopy. The results show that the various components of biodiversity peaked at different levels of canopy openness. Therefore, the restoration and suitable forest management of such conditions will retain important diversification of habitats in formerly coppiced oak forest stands. We indicate that permanent presence of small
Miller, Adam
2013-01-01
A standard tutorial-based approach to using OpenShift and deploying custom or pre-built web applications to the OpenShift Online cloud.This book is for software developers and DevOps alike who are interested in learning how to use the OpenShift Platform-as-a-Service for developing and deploying applications, how the environment works on the back end, and how to deploy their very own open source Platform-as-a-Service based on the upstream OpenShift Origin project.
DEFF Research Database (Denmark)
Nørgård, Rikke Toft; Paaskesen, Rikke Berggreen
2016-01-01
THE ARTICLE DESCRIBES OPEN-ENDED EDUCATION FOR 21ST CENTURY LEARNING AS THE COMING TOGETHER OF OPEN-ENDED TECHNOLOGY, OPEN-ENDED PROJECTS, AND OPEN-ENDED INSTITUTIONS IN WAYS THAT FOSTER AND PROMOTE FUTURE EDUCATION FOR CITIZENSHIP IN SOCIETY. THROUGH THE CASE OF THE CODING PIRATES FUTURE ISLAND......, THE ARTICLE DEMONSTRATES HOW OPEN-ENDED EDUCATION CAN BE PRACTICED TO FOSTER AND PROMOTE TECHNOLOGICAL IMAGINATION, ENTERPRISING, AND PARTICIPATION. THIS PRACTICE IS THEN DEVELOPED INTO A THEORETICAL MODEL FOR THE CONCEPT OF OPEN-ENDED EDUCATION AS A WAY OF AND FRAMEWORK FOR PRACTICING FUTURE EDUCATION FOR 21......ST CENTURY LEARNING WITH NEW TECHNOLOGIES. THE ARTICLE PRESENTS AN ANSWER TO THE CALL FOR 21ST CENTURY LEARNING AS THOROUGHLY COLLABORATIVE, COMMUNICATIVE, CREATIVE, AND CRITICALLY REFLECTIVE THROUGH THE CASE AND THE CONCEPT OF OPEN-ENDED EDUCATION. IT OUTLINES THE IMPLICATIONS OF THIS CALL...
The conditions for exercising eligibility for natural gas purchasing
International Nuclear Information System (INIS)
Anon.
2005-01-01
Since the electricity and natural gas markets were opened to all non-household customers, the CRE (the French commission of energy regulation) has received requests for information about the conditions for exercising eligibility, coming mainly from consumers with questions about the diverging practices of historical suppliers. The commission therefore launched a public investigation into this subject in 2004. Out of the 38 responses received, some criticized the way in which access to the network operates and the conditions for market opening while others raised questions falling outside the direct scope of the public investigation. The CRE's answers to these observations are explained in this article
DNA Open states and DNA hydratation
International Nuclear Information System (INIS)
Lema-Larre, B. de; Martin-Landrove, M
1995-01-01
It is a very well-known fact that an protonic exchange exists among natural DNA filaments and synthetic polynucleotides with the solvent (1--2). The existence of DNA open states, that is to say states for which the interior of the DNA molecule is exposed to the external environment, it has been demonstrated by means of proton-deuterium exchange (3). This work has carried out experiments measuring the dispersion of the traverse relaxation rate (4), as a pulsation rate function in a Carr-Purcell-Meiboom-Gill (CPMG) pulses sequence rate, to determine changes in the moist layer of the DNA molecule. The experiments were carried out under different experimental conditions in order to vary the probability that open states occurs, such as temperature or the exposure to electromagnetic fields. Some theoretical models were supposed to adjust the experimental results including those related to DNA non linear dynamic [es
DEFF Research Database (Denmark)
Morelli, Nicola; Mulder, Ingrid; Concilio, Grazia
2017-01-01
and environmental opportunities around them and government choices. Developing spacesmeans for enabling citizens to harness the opportunities coming from the use of this new resource, offers thus a substantial promise of social innovation. This means that open data is vi (still) virtually a new resource that could...... become a new commons with the engagement of interested and active communities. The condition for open data becoming a new common is that citizens become aware of the potential of this resource, that they use it for creating new services and that new practices and infrastructures are defined, that would......An increasing computing capability is raising the opportunities to use a large amount of publicly available data for creating new applications and a new generation of public services. But while it is easy to find some early examples of services concerning control systems (e.g. traffic, meteo...
Quantum games in open systems using biophysical Hamiltonians
International Nuclear Information System (INIS)
Faber, Jean; Portugal, Renato; Rosa, Luiz Pinguelli
2006-01-01
We analyze the necessary physical conditions to model an open quantum system as a quantum game. By applying the formalism of quantum operations on a particular system, we use Kraus operators as quantum strategies. The physical interpretation is a conflict among different configurations of the environment. The resolution of the conflict displays regimes of minimum loss of information
Quantum games in open systems using biophysical Hamiltonians
Energy Technology Data Exchange (ETDEWEB)
Faber, Jean [National Laboratory of Scientific Computing (LNCC), Av. Getulio Vargas 333, Quitandinha 25651-075, Petropolis, RJ (Brazil)]. E-mail: faber@lncc.br; Portugal, Renato [National Laboratory of Scientific Computing (LNCC), Av. Getulio Vargas 333, Quitandinha 25651-075, Petropolis, RJ (Brazil)]. E-mail: portugal@lncc.br; Rosa, Luiz Pinguelli [Federal University of Rio de Janeiro, COPPE-UFRJ, RJ (Brazil)]. E-mail: lpr@adc.coppe.ufrj.br
2006-09-25
We analyze the necessary physical conditions to model an open quantum system as a quantum game. By applying the formalism of quantum operations on a particular system, we use Kraus operators as quantum strategies. The physical interpretation is a conflict among different configurations of the environment. The resolution of the conflict displays regimes of minimum loss of information.
Search Family Open House Join us for an afternoon of science fun. The Fermilab Family Open House is a party for children of all ages to learn about the world of physics. The Open House is supported by Open House? Check out our YouTube video to learn more! Explore physics concepts with hands-on
Parallel inhomogeneity and the Alfven resonance. 1: Open field lines
Hansen, P. J.; Harrold, B. G.
1994-01-01
In light of a recent demonstration of the general nonexistence of a singularity at the Alfven resonance in cold, ideal, linearized magnetohydrodynamics, we examine the effect of a small density gradient parallel to uniform, open ambient magnetic field lines. To lowest order, energy deposition is quantitatively unaffected but occurs continuously over a thickened layer. This effect is illustrated in a numerical analysis of a plasma sheet boundary layer model with perfectly absorbing boundary conditions. Consequences of the results are discussed, both for the open field line approximation and for the ensuing closed field line analysis.
Diagnostic Yield of Microscopic Colitis in Open Access Endoscopy Center.
Ellingson, Derek; Miick, Ronald; Chang, Faye; Hillard, Robert; Choudhary, Abhishek; Ashraf, Imran; Bechtold, Matthew; Diaz-Arias, Alberto
2011-08-01
The diagnostic yield in open access endoscopy has been evaluated which generally support the effectiveness and efficiency of open access endoscopy. With a few exceptions, diagnostic yield studies have not been performed in open access endoscopy for more specific conditions. Therefore, we conducted a study to determine the efficiency of open access endoscopy in the detection of microscopic colitis as compared to traditional referral via a gastroenterologist. A retrospective search of the pathology database at the University of Missouri for specimens from a local open access endoscopy center was conducted via SNOMED code using the terms: "microscopic", "lymphocytic", "collagenous", "spirochetosis", "focal active colitis", "melanosis coli" and "histopathologic" in the diagnosis line for the time period between January 1, 2004 and May 25, 2006. Specimens and colonoscopy reports were reviewed by a single pathologist. Of 266 consecutive patients with chronic diarrhea and normal colonoscopies, the number of patients with microscopic disease are as follows: Lymphocytic colitis (n = 12, 4.5%), collagenous colitis (n = 17, 6.4%), focal active colitis (n = 15, 5.6%), and spirochetosis (n = 2, 0.4%). The diagnostic yield of microscopic colitis in this study of an open access endoscopy center does not differ significantly from that seen in major medical centers. In terms of diagnostic yield, open access endoscopy appears to be as effective in diagnosing microscopic colitis.
Energy Technology Data Exchange (ETDEWEB)
Saravia, Maricela; Morillon Galvez, David [Instituto de Ingenieria, UNAM, Mexico, D. F. (Mexico)
1999-07-01
A bioclimatic study of El Salvador is presented, with the purpose of using window eaves as elements of passive solar control and to determine the optimal angles of orientation, in order to diminish the thermal gains by direct solar radiation and to manage to get close to the comfort conditions. The former with the intention of integrating measures that help to obtain energy efficiency and comfortable buildings, for the conditions of warm humid climate, characteristic of a Central American country like El Salvador. Besides offering a document of consultation among the professionals dedicated to the design and as base of bioclimatic considerations that must have the construction regulations. As a conclusion the optimal angles of eaves for each orientation are presented and a quantitative estimation of the savings that would imply not to consume electrical energy in cooling systems using these elements as a protection to the direct solar radiation. [Spanish] Se presenta un estudio del bioclima de El Salvador, con el fin de utilizar aleros de ventana como elementos de control solar pasivo y determinar los angulos optimos por orientacion, para disminuir las ganancias termicas por radiacion solar directa y lograr acercar a las condiciones de confort. Lo anterior con el objeto de integrar medidas que coadyuven a lograr edificios energeticamente eficientes y confortables, para las condiciones de clima calido humedo, caracteristico de un pais centroamericano como El Salvador. Ademas de brindar un documento de consulta entre los profesionales dedicados al dise y como base de consideraciones bioclimaticas que debe tener el reglamento de construcciones. Como conclusion se presentan los angulos optimos de alero por cada orientacion y una estimacion cuantitativa del ahorro que implicaria el no consumir energia electrica en sistemas de enfriamiento utilizando estos elementos como una proteccion a la radiacion solar directa.
Maeda, Takuto; Takemura, Shunsuke; Furumura, Takashi
2017-07-01
We have developed an open-source software package, Open-source Seismic Wave Propagation Code (OpenSWPC), for parallel numerical simulations of seismic wave propagation in 3D and 2D (P-SV and SH) viscoelastic media based on the finite difference method in local-to-regional scales. This code is equipped with a frequency-independent attenuation model based on the generalized Zener body and an efficient perfectly matched layer for absorbing boundary condition. A hybrid-style programming using OpenMP and the Message Passing Interface (MPI) is adopted for efficient parallel computation. OpenSWPC has wide applicability for seismological studies and great portability to allowing excellent performance from PC clusters to supercomputers. Without modifying the code, users can conduct seismic wave propagation simulations using their own velocity structure models and the necessary source representations by specifying them in an input parameter file. The code has various modes for different types of velocity structure model input and different source representations such as single force, moment tensor and plane-wave incidence, which can easily be selected via the input parameters. Widely used binary data formats, the Network Common Data Form (NetCDF) and the Seismic Analysis Code (SAC) are adopted for the input of the heterogeneous structure model and the outputs of the simulation results, so users can easily handle the input/output datasets. All codes are written in Fortran 2003 and are available with detailed documents in a public repository.[Figure not available: see fulltext.
The Mackey convergence condition for spaces with webs
Directory of Open Access Journals (Sweden)
Thomas E. Gilsdorf
1988-01-01
Full Text Available If each sequence converging to 0 in a locally convex space is also Mackey convergent to 0, that space is said to satisfy the Mackey convergence condition. The problem of characterizing those locally convex spaces with this property is still open. In this paper, spaces with compatible webs are used to construct both a necessary and a sufficient condition for a locally convex space to satisfy the Mackey convergence condition.
U02 pellets surface properties and environmental conditions effects on the wet adsorption
International Nuclear Information System (INIS)
Junqueira, Fabio da S.; Carnaval, Joao Paulo R.
2013-01-01
Angra power plants fuels are made bye en riche uranium dioxide (UO 2 ) pellets which are assembled inside metal tubes. These tubes are welded and arranged in order to perform the final product, the fuel assembly. The UO 2 pellets have a specified humidity tolerance designed to comply with security and performance requirements when working under operating conditions in the reactor. This work intends to verify the pellet opened porosity and the environmental conditions (relative humidity and temperature) influence on the wet adsorption by UO 2 pellet. The work was done in 2 parts: Firstly, pallets groups from 3 opened porosity levels were tested under a fixed relative humidity, temperature and time. In the second part of the work, the most critical pallet group upon wet adsorption was tested under different relative humidity and temperature conditions, regarding design of experiments. The opened porosity and environmental conditions tests allowed the evolution of the wet adsorption by the UO 2 pallet. (author)
Directory of Open Access Journals (Sweden)
Pablo Rizzi
2013-05-01
Full Text Available Introducción Lograr una artrodesis sólida a nivel de L5-S1 constituye siempre una dificultad mayor que en otros niveles de la columna lumbar o torácica. La fijación con tornillos a las alas ilíacas representa una alternativa dentro de los diversos métodos de fijación. Objetivo Evaluar los resultados de la fijación pelviana con tornillos en pacientes adultos sin problemas de la marcha, considerando especialmente la fijación en 4 pun- tos por debajo de L5. Materiales y métodos: Veinticinco pacientes, con un seguimiento mínimo de 12 meses. Diagnósticos predomi- nantes: escoliosis, seudoartrosis. Resultados Veintinueve pacientes con distintas patologí- as fueron tratados por medio de fijación con tornillos pelvianos y los resultados se evaluaron mediante control clínico (escala analógica visual [EAV] y escala de Oswestry y control radiográfico. Los resultados obtenidos fueron: EAV preoperatoria 7,8% y EAV posoperatoria 3,1%. El puntaje para dolor ilíaco posoperatorio en la EAV fue del 3,3% y el puntaje Oswestry preoperatorio, del 74,4%, mientras que el del período posoperatorio fue, en promedio, del 31,5%. En cuatro pacientes fue necesario retirar el implante, en todos los casos por radiolucidez de los tornillos ilíacos. Se produjo la rotura de ambos tornillos ilíacos en 2 casos y se logró la fusión en los 24 casos restantes. Conclusión La fijación con tornillos pelvianos en fusiones largas, si bien no está exenta de complicaciones, es un método eficaz para lograr un alto índice de fusión lumbosacra en casos especialmente complejos por el largo de la fusión o por el fracaso de cirugías previas; es una técnica sencilla y con un moderado índice de dolor pelviano no solo en el número de pacientes, sino también en la intensidad del dolor, lo que quedó evidenciado por el bajo número de pacientes que fueron reintervenidos para el retiro de los tornillos.
Technology of interdisciplinary open-ended designing in engineering education
Isaev, A. P.; Plotnikov, L. V.; Fomin, N. I.
2017-11-01
Author’s technology of interdisciplinary open-ended engineering is presented in this article. This technology is an integrated teaching method that significantly increases the practical component in the educational program. Author’s technology creates the conditions to overcome the shortcomings in the engineering education. The basic ideas of the technology of open-ended engineering, experience of their implementation in higher education and the author’s vision of the teaching technology are examined in the article. The main stages of development process of the author’s technology of open-ended engineering to prepare students (bachelor) of technical profile are presented in the article. Complex of the methodological tools and procedures is shown in the article. This complex is the basis of the developed training technology that is used in educational process in higher school of engineering (UrFU). The organizational model of the technology of open-ended engineering is presented. Organizational model integrates the functions in the creation and implementation of all educational program. Analysis of the characteristics of educational activity of students working on author’s technology of interdisciplinary open-ended engineering is presented. Intermediate results of the application of author’s technology in the educational process of the engineering undergraduate are shown.
Innovation with open data : Essential elements of open data ecosystems
Zuiderwijk, A.M.G.; Janssen, M.F.W.H.A.; Davis, C.B.
2014-01-01
Open data ecosystems are expected to bring many advantages, such as stimulating citizen participation and innovation. However, scant attention has been given to what constitutes an open data ecosystem. The objective of this paper is to provide an overview of essential elements of open data
Experiences with OpenMP in tmLQCD
Energy Technology Data Exchange (ETDEWEB)
Deuzeman, A. [Bern Univ. (Switzerland). Albert Einstein Center for Fundamental Physics; Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Kostrzewa, B. [Humboldt Univ. Berlin (Germany). Inst. fuer Physik; Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Urbach, C. [Bonn Univ. (Germany). HISKP (Theory); Collaboration: European Twisted Mass Collaboration
2013-11-15
An overview is given of the lessons learned from the introduction of multi-threading using OpenMP in tmLQCD. In particular, programming style, performance measurements, cache misses, scaling, thread distribution for hybrid codes, race conditions, the overlapping of communication and computation and the measurement and reduction of certain overheads are discussed. Performance measurements and sampling profiles are given for different implementations of the hopping matrix computational kernel.
Experiences with OpenMP in tmLQCD
International Nuclear Information System (INIS)
Deuzeman, A.
2013-11-01
An overview is given of the lessons learned from the introduction of multi-threading using OpenMP in tmLQCD. In particular, programming style, performance measurements, cache misses, scaling, thread distribution for hybrid codes, race conditions, the overlapping of communication and computation and the measurement and reduction of certain overheads are discussed. Performance measurements and sampling profiles are given for different implementations of the hopping matrix computational kernel.
International Nuclear Information System (INIS)
Watrous, J.J.; Frese, M.H.
1993-01-01
The Plasma Opening Switch used on PBFA-II uses a source plasma which is injected into the inter-electrode gap along the field lines of a modest-strength applied poloidal magnetic field. The distribution of this plasma within the gap plays an important role in the behavior of the switch. Knowledge of this distribution is critical for performing relevant switch calculations and for interpreting experimental data. In the work reported here, the influence on that distribution of the plasma electrical resistivity, the applied magnetic field strength, and the boundary and injection conditions have been investigated with the 2 1/2-dimensional magnetohydrodynamics simulation code, MACH2. The injected plasma has density in the 10 14 cm -3 range and temperature in the several eV range. In this parameter regime, the classical collision time scale is on the order of 10 ns, which, when compared to the 100 ns time scale of the inflowing plasma, means that the plasma is classically collisionless. However, mechanisms other than classical collisions are likely to contribute to electrical resistivity. The authors have investigated the effect of an anomalous resistivity which scales with the plasma frequency, varying the scaling from the electron plasma frequency to the ion plasma frequency. They will compare these results with results based on the assumption of an ideal plasma, and discuss other anomalous resistivity models
A Study on the Main Steam Safety Valve Opening Mechanism by Flashing on NPPs
International Nuclear Information System (INIS)
Kim, Bae Joo
2009-01-01
A safety injection event happened by opening of the Main Steam Safety Valve at Kori unit 1 on April 16, 2005. The safety valves were opened at the lower system pressure than the valve opening set point due to rapid system pressure drop by opening of the Power Operated Relief Valve installed at the upstream of the Main Steam System. But the opening mechanism of safety valve at the lower set point pressure was not explained exactly. So, it needs to be understood about the safety valve opening mechanism to prevent a recurrence of this kind of event at a similar system of Nuclear Power Plant. This study is aimed to suggest the hydrodynamic mechanism for the safety valve opening at the lower set point pressure and the possibility of the recurrence at similar system conditions through document reviewing for the related previous studies and Kori unit 1 event
Miyanishi, Masayoshi
2000-01-01
Open algebraic surfaces are a synonym for algebraic surfaces that are not necessarily complete. An open algebraic surface is understood as a Zariski open set of a projective algebraic surface. There is a long history of research on projective algebraic surfaces, and there exists a beautiful Enriques-Kodaira classification of such surfaces. The research accumulated by Ramanujan, Abhyankar, Moh, and Nagata and others has established a classification theory of open algebraic surfaces comparable to the Enriques-Kodaira theory. This research provides powerful methods to study the geometry and topology of open algebraic surfaces. The theory of open algebraic surfaces is applicable not only to algebraic geometry, but also to other fields, such as commutative algebra, invariant theory, and singularities. This book contains a comprehensive account of the theory of open algebraic surfaces, as well as several applications, in particular to the study of affine surfaces. Prerequisite to understanding the text is a basic b...
PARTICULATE MATTER MEASUREMENTS USING OPEN-PATH FOURIER TRANSFORM INFRARED SPECTROSCOPY
Open-path Fourier transform infrared (OP-FT1R) spectroscopy is an accepted technology for measuring gaseous air contaminants. OP-FT1R absorbance spectra acquired during changing aerosols conditions reveal related changes in very broad baseline features. Usually, this shearing of ...
Casali, John G; Robinette, Martin B
2015-02-01
To determine if training with electronically-modulated hearing protection (EMHP) and the open ear results in auditory learning on a horizontal localization task. Baseline localization testing was conducted in three listening conditions (open-ear, in-the-ear (ITE) EMHP, and over-the-ear (OTE) EMHP). Participants then wore either an ITE or OTE EMHP for 12, almost daily, one-hour training sessions. After training was complete, participants again underwent localization testing in all three listening conditions. A computer with a custom software and hardware interface presented localization sounds and collected participant responses. Twelve participants were recruited from the student population at Virginia Tech. Audiometric requirements were 35 dBHL at 500, 1000, and 2000 Hz bilaterally, and 55 dBHL at 4000 Hz in at least one ear. Pre-training localization performance with an ITE or OTE EMHP was worse than open-ear performance. After training with any given listening condition, including open-ear, performance in that listening condition improved, in part from a practice effect. However, post-training localization performance showed near equal performance between the open-ear and training EMHP. Auditory learning occurred for the training EMHP, but not for the non-training EMHP; that is, there was no significant training crossover effect between the ITE and the OTE devices. It is evident from this study that auditory learning (improved horizontal localization performance) occurred with the EMHP for which training was performed. However, performance improvements found with the training EMHP were not realized in the non-training EMHP. Furthermore, localization performance in the open-ear condition also benefitted from training on the task.
Classification of heart valve condition using acoustic measurements
Energy Technology Data Exchange (ETDEWEB)
Clark, G. [Lawrence Livermore National Lab., CA (United States)
1994-11-15
Prosthetic heart valves and the many great strides in valve design have been responsible for extending the life spans of many people with serious heart conditions. Even though the prosthetic valves are extremely reliable, they are eventually susceptible to long-term fatigue and structural failure effects expected from mechanical devices operating over long periods of time. The purpose of our work is to classify the condition of in vivo Bjork-Shiley Convexo-Concave (BSCC) heart valves by processing acoustic measurements of heart valve sounds. The structural failures of interest for Bscc valves is called single leg separation (SLS). SLS can occur if the outlet strut cracks and separates from the main structure of the valve. We measure acoustic opening and closing sounds (waveforms) using high sensitivity contact microphones on the patient`s thorax. For our analysis, we focus our processing and classification efforts on the opening sounds because they yield direct information about outlet strut condition with minimal distortion caused by energy radiated from the valve disc.
OpenSHMEM-UCX : Evaluation of UCX for implementing OpenSHMEM Programming Model
Energy Technology Data Exchange (ETDEWEB)
Baker, Matthew B [ORNL; Gorentla Venkata, Manjunath [ORNL; Aderholdt, William Ferrol [ORNL; Shamis, Pavel [ARM Research
2016-01-01
The OpenSHMEM reference implementation was developed towards the goal of developing an open source and high-performing Open- SHMEM implementation. To achieve portability and performance across various networks, the OpenSHMEM reference implementation uses GAS- Net and UCCS for network operations. Recently, new network layers have emerged with the promise of providing high-performance, scalabil- ity, and portability for HPC applications. In this paper, we implement the OpenSHMEM reference implementation to use the UCX framework for network operations. Then, we evaluate its performance and scalabil- ity on Cray XK systems to understand UCX s suitability for developing the OpenSHMEM programming model. Further, we develop a bench- mark called SHOMS for evaluating the OpenSHMEM implementation. Our experimental results show that OpenSHMEM-UCX outperforms the vendor supplied OpenSHMEM implementation in most cases on the Cray XK system by up to 40% with respect to message rate and up to 70% for the execution of application kernels.
Time constraints in the treatment of nuclear transients - MONSTREAV code
International Nuclear Information System (INIS)
Amorim, E.S. do; Sudano, J.P.; Moura Neto, C. de; Ferreira, W.J.
1980-08-01
An improved approach to the spatial dynamics problem is described. This approach alows the factorization of the flux in amplitude and shape functions. Boundaries conditions are treated as time dependent functions and the coupling between functions is treated as the improved quasistatic approximation (1,2). A burnup feedback has been included allowing to describe extreme excursion in fast reactors very accurately even for treatment of nonlinear problems. A benchmark analysis shows that an improved method is fully sufficient for fast reactor dynamics calculations. Computation modules embodying the improved model of neutronic behaviour will be integrared with the other tests of the fast reactor dynamics analysis system now under development at EAV-IAE. (Author) [pt
Composite analysis E-area vaults and saltstone disposal facilities
Energy Technology Data Exchange (ETDEWEB)
Cook, J.R.
1997-09-01
This report documents the Composite Analysis (CA) performed on the two active Savannah River Site (SRS) low-level radioactive waste (LLW) disposal facilities. The facilities are the Z-Area Saltstone Disposal Facility and the E-Area Vaults (EAV) Disposal Facility. The analysis calculated potential releases to the environment from all sources of residual radioactive material expected to remain in the General Separations Area (GSA). The GSA is the central part of SRS and contains all of the waste disposal facilities, chemical separations facilities and associated high-level waste storage facilities as well as numerous other sources of radioactive material. The analysis considered 114 potential sources of radioactive material containing 115 radionuclides. The results of the CA clearly indicate that continued disposal of low-level waste in the saltstone and EAV facilities, consistent with their respective radiological performance assessments, will have no adverse impact on future members of the public.
Composite analysis E-area vaults and saltstone disposal facilities
International Nuclear Information System (INIS)
Cook, J.R.
1997-09-01
This report documents the Composite Analysis (CA) performed on the two active Savannah River Site (SRS) low-level radioactive waste (LLW) disposal facilities. The facilities are the Z-Area Saltstone Disposal Facility and the E-Area Vaults (EAV) Disposal Facility. The analysis calculated potential releases to the environment from all sources of residual radioactive material expected to remain in the General Separations Area (GSA). The GSA is the central part of SRS and contains all of the waste disposal facilities, chemical separations facilities and associated high-level waste storage facilities as well as numerous other sources of radioactive material. The analysis considered 114 potential sources of radioactive material containing 115 radionuclides. The results of the CA clearly indicate that continued disposal of low-level waste in the saltstone and EAV facilities, consistent with their respective radiological performance assessments, will have no adverse impact on future members of the public
Public open space for disaster mitigation in Tangerang housing estates
Winandari, M. I. R.
2018-01-01
Public open space in housing estates plays an important role particularly in disaster mitigation. In some housing, there are indications of shape and use of space changes post-handover to local government. The aim of this study is to explore the relationship between public open space condition and management related to disaster mitigation in Tangerang housing estates. Multiple case study method is used to analyse of 2 housing cases. Aspects of access and boundaries were used to evaluate the cases. The results showed that gated community housing type should have more than 1 access to facilitate evacuation by considering the farthest unit to the housing gate. This is necessary to provide open spaces that are easily accessible from all units as the first evacuation site during and post disaster.
Closed hierarchy of correlations in Markovian open quantum systems
International Nuclear Information System (INIS)
Žunkovič, Bojan
2014-01-01
We study the Lindblad master equation in the space of operators and provide simple criteria for closeness of the hierarchy of equations for correlations. We separately consider the time evolution of closed and open systems and show that open systems satisfying the closeness conditions are not necessarily of Gaussian type. In addition, we show that dissipation can induce the closeness of the hierarchy of correlations in interacting quantum systems. As an example we study an interacting optomechanical model, the Fermi–Hubbard model, and the Rabi model, all coupled to a fine-tuned Markovian environment and obtain exact analytic expressions for the time evolution of two-point correlations. (paper)
Development of a closed and open loop solar tracker technology
Directory of Open Access Journals (Sweden)
Aurélio Gouvêa Melo
2017-05-01
Full Text Available Solar energy is among the renewable energy sources that received greater addition in installed capacity. However, it accounts for a small fraction of the energy matrix of most countries. Electric energy generation by solar systems can be improved through tracking. This work aimed to develop and compare a closed and an open loop solar tracking system. The closed loop system was developed using Light Dependent Resistors. An algorithm was developed for the open loop tracker as a function of the geometric relation between the sun and the photovoltaic module. A simulation was run to compare this algorithm with a system using tracking at fixed time intervals, for clear sky conditions, with different tracking parameters and for five different latitudes. No significant difference was observed between the proposed open loop tracking algorithm and the fixed time interval algorithm for the tracking parameters evaluated. The open and closed loop solar tracking systems were compared experimentally in Rio das Ostras, Brazil (22.49 °S 41.92° W. An average gain of 28.5% was observed for the open loop tracking system over a latitude tilted system and 33.0% for the closed loop tracking system.
Framing Openness. The Digital Circulation of Israel's National Photographic Memory
Directory of Open Access Journals (Sweden)
Nathalie Casemajor
2014-03-01
Full Text Available Since 1948, the Government Press Office of Israel has been collecting and producing an extensive archive of photographs representing the birth and development of the Israeli nation state. Digitized and published online, this archive functions as a visual memorial of Israel, an example of what Jan Assman calls “bonding memory”, a form of memory that connects individuals to a political body, and which acts to frame a collective national identity. In 2011, the copyright terms of this archive were changed to encourage the circulation and reuse of images. This decision echoes a broader trend towards the “opening” of large data sets on the Web (“open data”, “open archives”, “open government”. At the same time, the ongoing Arab-Israeli conflict and the existence of contesting narratives of the creation of Israel threaten the integrity of the official national memory. In this context, what are the conditions and limits of “opening” the national photographic archive? Examining contemporary ideology of the “open” in new media discourses and the free culture movement, this paper investigates the conditions of circulation and appropriation of memory and the role of copyright as a potential tool to control freedom of expression.
Panel 5 -- Open Architecture, Open Business Models and Collaboration for Acquisition
National Research Council Canada - National Science Library
Johnson, Bill; Guertin, Nick
2007-01-01
What do we mean by Naval Open Architecture? Naval Open Architecture is the confluence of business and technical practices yielding modular, interoperable systems that adhere to open standards with published interfaces...
50 years of brown coal open cast ''Konin''
International Nuclear Information System (INIS)
Wlodarczyk, B.
1995-01-01
The history as well as present condition of brown coal mine ''Konin'' located in Central Poland are presented. In 1994 about 13380 million tons of coal were extracted from this open cast and 95% of it was burnt in power plants. The prognosis of future production up to 2020 is given and the program of mine restructurization is described. 3 ills
Leppänen, Pia K; Ravaja, Niklas; Ewalds-Kvist, S Béatrice M
2008-01-01
The authors examined pre- and postpartum open-field (OF) behavior and maternal responsiveness in mice that they bidirectionally selected for OF thigmotaxis. The authors tested 40 female mice under 3 conditions: prepartum OF, postpartum OF, and a pup retrieval test. In both OF conditions, the high OF thigmotaxis (HOFT) mice were more thigmotactic but explored and reared less than the low OF thigmotaxis (LOFT) mice, indicating that the HOFT mice were more emotional. In the postpartum condition, the HOFT mothers also defecated more and ambulated less than the LOFT mothers. The increase in grooming after parturition was more conspicuous among the LOFT mothers than among the HOFT mothers. The LOFT mothers were also more attracted to their pups in the OF, but the retrieval test did not show any substantial line differences. The results suggested that the line difference in emotionality was more pronounced during lactation than during pregnancy, although parturition exerted no effect on thigmotaxis.
Big Five Personality Factors and Facets as Predictors of Openness to Diversity.
Han, Suejung; Pistole, M Carole
2017-11-17
Openness to diversity is a crucial component of cultural competence needed in the increasingly diversified modern society and a necessary condition for benefitting from diversity contacts and interventions (e.g., diversity training, cultural courses). Responding to the recent call for more research on personality and its relation to diversity outcomes, we examined the associations between Big Five personality (i.e., Openness to Experience, Agreeableness, Extraversion, Neuroticism, and Conscientiousness) higher order factors and lower order facets and universal-diverse orientation (i.e., open attitude of appreciating human universality and diversity; Miville et al., 1999 ). In the Study 1 (N = 338) web survey on Big Five factors, Openness to Experience and Agreeableness were associated with universal-diverse orientation significantly. In the Study 2 (N = 176) paper survey on both Big Five factors and facets, Openness to Experience, low Neuroticism, and Conscientiousness, and various lower-order facets of all the Big Five personality were associated with universal-diverse orientation significantly. Practical implications were suggested on how personality facets could be incorporated into current diversity interventions to enhance their effectiveness of promoting openness to diversity.
Role of short periodic orbits in quantum maps with continuous openings
Prado, Carlos A.; Carlo, Gabriel G.; Benito, R. M.; Borondo, F.
2018-04-01
We apply a recently developed semiclassical theory of short periodic orbits to the continuously open quantum tribaker map. In this paradigmatic system the trajectories are partially bounced back according to continuous reflectivity functions. This is relevant in many situations that include optical microresonators and more complicated boundary conditions. In a perturbative regime, the shortest periodic orbits belonging to the classical repeller of the open map—a cantor set given by a region of exactly zero reflectivity—prove to be extremely robust in supporting a set of long-lived resonances of the continuously open quantum maps. Moreover, for steplike functions a significant reduction in the number needed is obtained, similarly to the completely open situation. This happens despite a strong change in the spectral properties when compared to the discontinuous reflectivity case. In order to give a more realistic interpretation of these results we compare with a Fresnel-type reflectivity function.
Suber, Peter
2012-01-01
The Internet lets us share perfect copies of our work with a worldwide audience at virtually no cost. We take advantage of this revolutionary opportunity when we make our work "open access": digital, online, free of charge, and free of most copyright and licensing restrictions. Open access is made possible by the Internet and copyright-holder consent, and many authors, musicians, filmmakers, and other creators who depend on royalties are understandably unwilling to give their consent. But for 350 years, scholars have written peer-reviewed journal articles for impact, not for money, and are free to consent to open access without losing revenue. In this concise introduction, Peter Suber tells us what open access is and isn't, how it benefits authors and readers of research, how we pay for it, how it avoids copyright problems, how it has moved from the periphery to the mainstream, and what its future may hold. Distilling a decade of Suber's influential writing and thinking about open access, this is the indispe...
Anti-equine arteritis virus activity of ethanolic extract and compounds from Origanum vulgare
Directory of Open Access Journals (Sweden)
Daiane Einhardt Blank
2017-05-01
Full Text Available The equine arteritis virus (EAV is responsible by an important respiratory and reproductive disease in equine populations and there is no specific antiviral treatment available. The objective of this study was to investigate the activity of an ethanolic crude extract of Origanum vulgare (EEO and of isolated compound caffeic acid, p-coumaric acid, rosmarinic acid, quercetin, luteolin, carnosol, carnosic acid, kaempferol and apigenin against EAV. The assays were performed using non-cytotoxic concentrations. The antiviral activity was monitored initially by cytopathic effect inhibition (CPE assay in RK13 cells in the presence or absence of EEO. Pre-incubated cells with EEO were also examined to show prophylactic effect. Direct viral inactivation by EEO and isolated compounds was evaluated by incubation at 37°C or 20°C. After the incubation period, the infectivity was immediately determined by virus titrations on cell cultures and expressed as 50% tissue culture infective dose (TCID50/100 µL. There was significant virucidal activity of EEO and of the compounds caffeic acid, p-coumaric acid, quercetin, carnosic acid and kaempferol. When EEO was added after infection, EEO inhibited the virus growth in infected cells, as evidenced by significant reduction of the viral titre. The results provide evidence that the EEO exhibit an inhibitory effect anti-EAV. Among the main compounds evaluated, caffeic acid, p-coumaric acid, carnosic acid, kaempferol and mainly quercetin, contributed to the activity of EEO. EEO may represent a good prototype for the development of a new antiviral agent, presenting promising for combating arteriviruses infections.
Radiological performance assessment for the E-Area Vaults Disposal Facility
Energy Technology Data Exchange (ETDEWEB)
Cook, J.R.; Hunt, P.D. [Westinghouse Savannah River Co., Aiken, SC (United States)
1994-04-15
The E-Area Vaults (EAVs) located on a 200 acre site immediately north of the current LLW burial site at Savannah River Site will provide a new disposal and storage site for solid, low-level, non-hazardous radioactive waste. The EAV Disposal Facility will contain several large concrete vaults divided into cells. Three types of structures will house four designated waste types. The Intermediate Level Non-Tritium Vaults will receive waste radiating greater than 200 mR/h at 5 cm from the outer disposal container. The Intermediate Level Tritium Vaults will receive waste with at least 10 Ci of tritium per package. These two vaults share a similar design, are adjacent, share waste handling equipment, and will be closed as one facility. The second type of structure is the Low Activity Waste Vaults which will receive waste radiating less than 200 mR/h at 5 cm from the outer disposal container and containing less than 10 Ci of tritium per package. The third facility, the Long Lived Waste Storage Building, provides covered, long term storage for waste containing long lived isotopes. Two additional types of disposal are proposed: (1) trench disposal of suspect soil, (2) naval reactor component disposal. To evaluate the long-term performance of the EAVs, site-specific conceptual models were developed to consider: (1) exposure pathways and scenarios of potential importance; (2) potential releases from the facility to the environment; (3) effects of degradation of engineered features; (4) transport in the environment; (5) potential doses received from radionuclides of interest in each vault type.
Radiological performance assessment for the E-Area Vaults Disposal Facility
International Nuclear Information System (INIS)
Cook, J.R.; Hunt, P.D.
1994-01-01
The E-Area Vaults (EAVs) located on a 200 acre site immediately north of the current LLW burial site at Savannah River Site will provide a new disposal and storage site for solid, low-level, non-hazardous radioactive waste. The EAV Disposal Facility will contain several large concrete vaults divided into cells. Three types of structures will house four designated waste types. The Intermediate Level Non-Tritium Vaults will receive waste radiating greater than 200 mR/h at 5 cm from the outer disposal container. The Intermediate Level Tritium Vaults will receive waste with at least 10 Ci of tritium per package. These two vaults share a similar design, are adjacent, share waste handling equipment, and will be closed as one facility. The second type of structure is the Low Activity Waste Vaults which will receive waste radiating less than 200 mR/h at 5 cm from the outer disposal container and containing less than 10 Ci of tritium per package. The third facility, the Long Lived Waste Storage Building, provides covered, long term storage for waste containing long lived isotopes. Two additional types of disposal are proposed: (1) trench disposal of suspect soil, (2) naval reactor component disposal. To evaluate the long-term performance of the EAVs, site-specific conceptual models were developed to consider: (1) exposure pathways and scenarios of potential importance; (2) potential releases from the facility to the environment; (3) effects of degradation of engineered features; (4) transport in the environment; (5) potential doses received from radionuclides of interest in each vault type
Spitzen, Jeroen; Koelewijn, Teun; Mukabana, W Richard; Takken, Willem
2017-08-01
Insecticide-treated nets are currently a major tool to reduce malaria transmission. Their level of repellency affects contact of the mosquito with the net, but may also influence the mosquito's entry into the house. The response of host-seeking malaria mosquitoes approaching the eave of an experimental house was recorded within a large screen house. We compared entry- and exit rates in relation to the presence in the house of different insecticide-treated bed nets (ITNs) with an untreated net. Mosquitoes were lured towards the house by dispensing a synthetic host-odour blend from within the net in the house. Complementary WHO bioassays revealed that the treated nets caused high knock-down- and mortality responses to the Anopheles gambiae sensu stricto strain tested. The proportion of mosquitoes that came into view of the cameras and subsequently entered the house did not differ between treated nets and the untreated net. Treated nets did not affect proportions of mosquitoes that exited the house and departed from view around the eave. However, the percentage of house-leaving and re-entering mosquitoes when an insecticide- treated net was present, was lower than in the presence of an untreated net. Our results indicated that there was no spatial repellent effect from pyrethroid-treated nets that influences house-entry at eave level. It is argued that the toxic effect of treated bed nets resulted in a reduced number of mosquitoes re-entering the house, which could thereby affect malaria transmission in neighbouring, unprotected houses. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.
... Lewis esophagectomy, Blunt esophagectomy; Esophageal cancer - esophagectomy - open; Cancer of the esophagus - esophagectomy - open ... lining of the esophagus that can lead to cancer ( Barrett esophagus ) Severe trauma Destroyed esophagus Severely damaged stomach
Study on the Opening Characteristics of MSSV
Energy Technology Data Exchange (ETDEWEB)
Lee, Jong-Beom; Song, Dong-Soo [KHNP-CRI, Daejeon (Korea, Republic of)
2014-10-15
Nuclear power plants have safety valves on the main steam lines to protect overpressure of the secondary system of the plants. The safety valves are designed to open and relieve excess pressure from the main steam lines and to reclose in order to prevent further release of steam after normal conditions have been restored. In safety analysis, the opening and closing characteristics of MSSV is usually modeled in two types. One is popup model and the other is step-change model. In this paper the two models are compared to see the effects on the pressures of the primary and the secondary systems. Pop-up model of the MSSV is compared with stepchange model. Thus far, step-change model has been generally used to simulate the MSSV response of the OPR1000 plants. But with the view point of current safety standards this model may be not adequate to simulate the MSSV responses. Pop-up model shows better results than step-change model, and is more realistic since one of features of safety valve is fast opening. By using the pop-up model the secondary system can have more margins in pressure.
Study on the Opening Characteristics of MSSV
International Nuclear Information System (INIS)
Lee, Jong-Beom; Song, Dong-Soo
2014-01-01
Nuclear power plants have safety valves on the main steam lines to protect overpressure of the secondary system of the plants. The safety valves are designed to open and relieve excess pressure from the main steam lines and to reclose in order to prevent further release of steam after normal conditions have been restored. In safety analysis, the opening and closing characteristics of MSSV is usually modeled in two types. One is popup model and the other is step-change model. In this paper the two models are compared to see the effects on the pressures of the primary and the secondary systems. Pop-up model of the MSSV is compared with stepchange model. Thus far, step-change model has been generally used to simulate the MSSV response of the OPR1000 plants. But with the view point of current safety standards this model may be not adequate to simulate the MSSV responses. Pop-up model shows better results than step-change model, and is more realistic since one of features of safety valve is fast opening. By using the pop-up model the secondary system can have more margins in pressure
Biopsy - open lung ... An open lung biopsy is done in the hospital using general anesthesia . This means you will be asleep and ... The open lung biopsy is done to evaluate lung problems seen on x-ray or CT scan .
International Nuclear Information System (INIS)
Thorndike, A.M.
1978-01-01
One objective of the two open areas in the present ISABELLE design is to provide flexibility with respect to the size and shape of experimental equipment that would eventually be installed there. No permanent building would be installed initially. A second objective of the design of open areas is to keep initial costs as low as practicable. Another objective is open access. This note explores this idea and some design concepts based on it. It would permit inserting large pieces of experimental equipment quickly and removing them with equal ease and speed. Entire experiments would be moved in a single piece (or a few) by building them on movable platforms with capacities of up to about 1000 tons per platform. Most experiments could be built on a single platform or on a few. The shielding must also be moved. It must also be organized into a small number of large units. A scheme using large tanks filled with water is described. It is important to make the equipment on a given platform as complete and self-contained as possible, with a minimum of interconnections for power, coolant, controls, data transmission, etc. 5 figures
CERN. Geneva; Rodriguez Peon, Alberto
2017-01-01
Workshop to introduce developers to the OpenShift platform available at CERN. Several use cases will be shown, including deploying an existing application into OpenShift. We expect attendees to realize about OpenShift features and general architecture of the service.
Kulk, S.; Van Loenen, B.
2012-01-01
Bij de selectie van welke datasets als open data kunnen worden aangeboden wordt privacy vaak genoemd als aandachtspunt. Dat is terecht want aandacht voor privacy is noodzakelijk bij het aanbieden van open data. Privacy is een van de mogelijke argumenten om voor bepaalde gegevens geen open data
Overview: Routes to Open Access
Tullney, Marco; van Wezenbeek, Wilma
2017-01-01
Slides of an overview presentation given at a CESAER workshop on Open Access, February 2nd, 2017, in Brussels Cover major routes to more open access as discussed in the Task Force Open Science of CESAER: (national) open access strategies open access mandates open access incentives open access awareness open access publishing open access infrastructure
Alou-Font, E
2015-12-02
© Inter-Research 2016. We examined phytoplankton biomass and community composition (mostly based on pigments) as well as cell viability with the cell digestion assay in surface waters of the Canadian Beaufort Sea during the spring-summer transition. Our aim was to understand phytoplankton responses to the large environmental changes (irradiance, temperature and nutrients) occurring during this period. Two categories of stations were visited in May and June 2008: ice-covered (IC), exposed to low irradiances, and open-water (OW), exposed to higher irradiances. We observed a large variation in the percentage of living cells (%LC) relative to the total community. No relationship was found between %LC and nitrate concentration (the nutrient potentially limiting in this environment). The in situ irradiance influenced the status of the cells at OW stations. Mean surface mixed layer irradiances >600 μmol photons m-2 s-1 were associated with low cell viability and a decline in photosynthetic performance (Fv/Fm). For IC stations, %LC declined at temperatures above 0°C, whereas for OW stations, it increased, suggesting that ice melting resulted in the release into surface waters of unhealthy cells from the bottom ice in one case, and that seasonal warming favored the communities present in open waters. A chlorophyll degradation pigment tentatively identified as pyropheophorbide a-\\'like\\' showed a significant negative relationship between its concentration (relative to chlorophyll a) and the %LC and Fv/Fm. Our results suggest that the melting conditions influence the distribution of this pigment and that it may be useful as a marker for low cell viability of ice algae being released into surface waters.
Alou-Font, E; Roy, S; Agusti, Susana; Gosselin, M
2015-01-01
© Inter-Research 2016. We examined phytoplankton biomass and community composition (mostly based on pigments) as well as cell viability with the cell digestion assay in surface waters of the Canadian Beaufort Sea during the spring-summer transition. Our aim was to understand phytoplankton responses to the large environmental changes (irradiance, temperature and nutrients) occurring during this period. Two categories of stations were visited in May and June 2008: ice-covered (IC), exposed to low irradiances, and open-water (OW), exposed to higher irradiances. We observed a large variation in the percentage of living cells (%LC) relative to the total community. No relationship was found between %LC and nitrate concentration (the nutrient potentially limiting in this environment). The in situ irradiance influenced the status of the cells at OW stations. Mean surface mixed layer irradiances >600 μmol photons m-2 s-1 were associated with low cell viability and a decline in photosynthetic performance (Fv/Fm). For IC stations, %LC declined at temperatures above 0°C, whereas for OW stations, it increased, suggesting that ice melting resulted in the release into surface waters of unhealthy cells from the bottom ice in one case, and that seasonal warming favored the communities present in open waters. A chlorophyll degradation pigment tentatively identified as pyropheophorbide a-'like' showed a significant negative relationship between its concentration (relative to chlorophyll a) and the %LC and Fv/Fm. Our results suggest that the melting conditions influence the distribution of this pigment and that it may be useful as a marker for low cell viability of ice algae being released into surface waters.
{open_quotes}O{close_quotes} ring sealed process tube, Phase II, test project
Energy Technology Data Exchange (ETDEWEB)
Johnson, R.E.
1951-04-09
The {open_quotes}O{close_quotes} ring seal has been proposed to replace the van stone flange and the bellows thermal expansion assembly currently used on the existing Hanford piles to achieve water and gas seals, respectively. Possible advantages of the {open_quotes}O{close_quotes} ring seal are: (1) simplification of component parts and elimination of van stone corrosion; (2) simplification of maintenance; (3) lower costs of initial erection; (4) increased strength. This test supplements Test Project No. 27 (a preliminary thermal cycling test) in applying the {open_quotes}O{close_quotes} ring seal assembly to actual pile operating conditions.
Improving Security at Work with Software that Uses OpenMP
Directory of Open Access Journals (Sweden)
P. S. Polishuk
2010-03-01
Full Text Available A model of the offender and the list of major types of threats, the conditions for the realization of which are created by using the software that uses OpenMP is considered. A method for verification of software using OpenMP for the presence of vulnerabilities associated with multi-threaded execution is offered. We give basic algorithms and the system architecture that implements the proposed method. The results of testing the method on various programs, including those containing malicious code, as well as assessment of the possibilities of applying the method in different computing environments are given.
International Nuclear Information System (INIS)
Ester, Z.; Vrkljan, D.
1998-01-01
Underground nuclear waste repositories are constructed in natural rock formations, with heterogenous compound and structure, and should be accommodated in design and construction according to rock conditions. The quality insurance of underground repository, during and after construction, is most demanding in view of contour and category of excavation. the technology of drilling and blasting, regarding the mechanical excavation, is accommodated in sense of response to cross section magnitude of underground openings, the rock conditions and category, the support performance and other design demands. The high level rock damage around underground openings, that is in opposition with reaching quality insurance. Conventional construction technology can be successful by implementation of controlled blasting technique avoiding extensive rock weakness. (author)
NCBI nr-aa BLAST: CBRC-MMUS-09-0186 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-09-0186 ref|ZP_01510169.1| ABC-2 type transporter, NodJ family [Burkholderia phytofirm...ans PsJN] gb|EAV05032.1| ABC-2 type transporter, NodJ family [Burkholderia phytofirmans PsJN] ZP_01510169.1 1.4 31% ...
PHYSICAL AND NUMERICAL MODELING OF ASD EXHAUST DISPERSION AROUND HOUSES
The report discusses the use of a wind tunnel to physically model the dispersion of exhaust plumes from active soil depressurization (ASD) radon mitigation systems in houses. he testing studied the effects of exhaust location (grade level vs. above the eave), as house height, roo...
Hale, Matthew W; Bouwknecht, J Adriaan; Spiga, Francesca; Shekhar, Anantha; Lowry, Christopher A
2006-12-11
Anxiety states and anxiety-related behaviors appear to be regulated by a distributed and highly interconnected system of forebrain structures including the basolateral amygdaloid complex (basolateral amygdala). Despite a wealth of research examining the role of the basolateral amygdala in anxiety-related behaviors and anxiety states, the specific subdivisions of the basolateral amygdala that are involved in responses to anxiogenic stimuli have not been examined. In this study, we investigated the effects of exposure to a novel open-field environment, with either low- or high-levels of illumination, on expression of the protein product of the immediate-early gene c-Fos in subdivisions of the rat basolateral amygdala. The subdivisions studied included the lateral, ventrolateral and ventromedial parts of the lateral amygdaloid nucleus, the anterior, posterior and ventral parts of the basolateral amygdaloid nucleus and the anterior and posterior part of the basomedial amygdaloid nucleus. Small increases in the number of c-Fos-immunoreactive cells were observed in several, but not all, of the subdivisions of the basolateral amygdala studied following exposure of rats to either the high- or low-light conditions, compared to home cage or handled control groups. Open-field exposure in both the high- and low-light conditions resulted in a marked increase in c-Fos expression in the anterior part of the basolateral amygdaloid nucleus compared to either home cage or handled control groups. These findings point toward anatomical and functional heterogeneity within the basolateral amygdaloid complex and an important role of the anterior part of the basolateral amygdaloid nucleus in the neural mechanisms underlying physiological or behavioral responses to this anxiety-related stimulus.
The effect of human activity noise on the acoustic quality in open plan office
DEFF Research Database (Denmark)
Dehlbæk, Tania Stenholt; Jeong, Cheol-Ho; Brunskog, Jonas
2016-01-01
A disadvantage of open plan offices is the noise annoyance. Noise problems in open plan offices have been dealt with in several studies, and standards have been set up. Still, what has not been taken into account is the effect of human activity noise on acoustic conditions. In this study......, measurements of the general office noise levels and the room acoustic conditions according to ISO 3382-3 have been carried out in five open plan offices. Probability density functions of the sound pressure level have been obtained, and the human activity noise has been identified. Results showed a decrease...... in STI-values including the human activity noise compared to STI-values including only technical background noise as the standard recommends. Furthermore, at 500 Hz a regression analysis showed that the density of people in an room, absorption area, reverberation time as well as the ISO 3382-3 parameter...
Software development an open source approach
Tucker, Allen; de Silva, Chamindra
2011-01-01
Overview and Motivation Software Free and Open Source Software (FOSS)Two Case Studies Working with a Project Team Key FOSS Activities Client-Oriented vs. Community-Oriented Projects Working on a Client-Oriented Project Joining a Community-Oriented Project Using Project Tools Collaboration Tools Code Management Tools Run-Time System ConstraintsSoftware Architecture Architectural Patterns Layers, Cohesion, and Coupling Security Concurrency, Race Conditions, and DeadlocksWorking with Code Bad Smells and Metrics Refactoring Testing Debugging Extending the Software for a New ProjectDeveloping the D
increase transparency and openness. We encourage you to explore other information on our website to learn Defense Search DOD Open Government: Home Open Government @ DoD Transparency Congressional Inquiries IT Dashboard.gov Regulations.gov Challenge.gov Performance.gov ForeignAssistance.gov Transparency
An efficient water conditioning system for land-based abalone aquaculture
Energy Technology Data Exchange (ETDEWEB)
Davis, C.P. [University of Edinburgh (United Kingdom). School of GeoSciences; Carrington, C.G. [University of Otago, Dunedin (New Zealand). Dept. of Physics
2005-07-01
Data collected from a single grow-out tank in an abalone farm in southern New Zealand has highlighted hygiene maintenance problems in the use of semi-closed water conditioning systems for the aquaculture of New Zealand black foot abalone Haliotis iris. The data shows that semi-closed systems can have high concentrations of un-ionized ammonia, which is harmful to the animals. In this paper an alternative open flow-through system is suggested where energy demand is limited by heat recovery at the grow-out tank outlet. Using temperature data collected over 1 year, and a previously obtained expression for standing losses, a simple energy model is presented for an open system with heat recovery. To compliment the energy model, a function has been established for abalone production with respect to the concentration of un-ionized ammonia and water temperature. The energy model and production function are combined to determine the impact of plant design and tank conditions on the economics of the operation for the southern New Zealand climate. It is demonstrated that temperature control is financially preferable to an open system with no temperature control, and estimates of optimum operating conditions are given. (author)
Stability of deep open casts; Statecznosc glebokich wyrobisk odkrywkowych
Energy Technology Data Exchange (ETDEWEB)
Dmitruk, S [Politechnika Wroclawska, Wroclaw (Poland)
1994-12-01
The landslides which took place in Belchatow /Central Poland/ as well as in Berzdorf and Turow brown coal open casts located at German-Polish boarder and having similar geologic conditions are described and compared. The mechanism of landslide is analysed and the necessity of further studies on this problem is stressed. 3 figs., ill.
OpenBook WordPress Plugin: Open Source Access to Bibliographic Data
Directory of Open Access Journals (Sweden)
John Miedema
2008-09-01
Full Text Available OpenBook is a WordPress PHP plugin that implements the Open Library APIs to insert book covers, titles, authors and publishers into web pages. The motive behind the development was to provide an easy alternative to the common practice of linking to Amazon. Open Library was selected as a data source because it is both open source and open data.The plugin is useful for book reviewers, library webmasters, anyone who wants to put book covers and data on their WordPress blog or website. The plugin also allows users to add links to publisher websites, a feature that was considered significant to independent publishers.
Pierre Gorissen
2015-01-01
Deze quickscan open textbooks is uitgevoerd in opdracht van SURFnet ter voorbereiding van het seminar over open textbooks op 26 november 2015. Het is nadrukkelijk een quickscan, de beschikbare tijd om literatuur te verzamelen en te beoordelen rond open textbooks was begrensd. Deze quickscan heeft
Reinforced concrete beams with web openings: A state of the art review
International Nuclear Information System (INIS)
Ahmed, A.; Fayyadh, M.M.; Naganathan, S.; Nasharuddin, K.
2012-01-01
Highlights: ► Present paper highlights the gaps in the work related RC beams with web opening. ► There is limited work on comparing of design approaches of RC beams with opening. ► Strengthening with externally bonded steel or FRP sheets needs to be investigated. ► There is no repair work been done on the RC beams with opening. -- Abstract: The construction of modern buildings requires many pipes and ducts in order to accommodate essential services such as air conditioning, electricity, telephone, and computer network. Web openings in concrete beams enable the installation of these services. A number of studies have been conducted with regards to reinforced concrete beams which contain web openings. The present paper aims to compile this state of the art work on the behaviour, analysis and design of Reinforced Concrete (RC) beams with transverse web openings. A variety of aspects will be highlighted and discussed including the classification of openings, guidelines for opening location, and the structural behaviour of RC beams with web openings. Various design approaches will also be detailed, for example the American Concrete Institute (ACI) approach, the Architectural Institute of Japan (AIJ) approach and the strut and tie method. Moreover, the strengthening of RC beams with openings using Fibre Reinforced Polymer (FRP) material and steel plates is presented. Finally, directions for future research based on the gaps which exist in the present work are presented.
Open Genetic Code: on open source in the life sciences.
Deibel, Eric
2014-01-01
The introduction of open source in the life sciences is increasingly being suggested as an alternative to patenting. This is an alternative, however, that takes its shape at the intersection of the life sciences and informatics. Numerous examples can be identified wherein open source in the life sciences refers to access, sharing and collaboration as informatic practices. This includes open source as an experimental model and as a more sophisticated approach of genetic engineering. The first section discusses the greater flexibly in regard of patenting and the relationship to the introduction of open source in the life sciences. The main argument is that the ownership of knowledge in the life sciences should be reconsidered in the context of the centrality of DNA in informatic formats. This is illustrated by discussing a range of examples of open source models. The second part focuses on open source in synthetic biology as exemplary for the re-materialization of information into food, energy, medicine and so forth. The paper ends by raising the question whether another kind of alternative might be possible: one that looks at open source as a model for an alternative to the commodification of life that is understood as an attempt to comprehensively remove the restrictions from the usage of DNA in any of its formats.
Buhl, Mie; Andreasen, Lars Birch; Pushpanadham, Karanam
2018-03-01
The proliferation and expansion of massive open online courses (MOOCs) prompts a need to revisit classical pedagogical questions. In what ways will MOOCs facilitate and promote new e-learning pedagogies? Is current learning design adequate for the "massiveness" and "openness" of MOOCs? This article discusses the ways in which MOOCs create new conditions for designing learning processes. The authors present various theoretical approaches to learning design and discuss a combination of theoretical perspectives. They discern a fragmentation of the teacher role; where the teacher was once the main person responsible for planning, practice and reflection, those activities may now be performed by different actors with different areas of responsibility. The theoretical discussion is complemented by a review of recent studies of new practices and design formats aiming to overcome the upscaling issues of MOOCs. The authors present a multifaceted picture of MOOC methodologies, including a typology of hybrid approaches to MOOC design. Through the example of MOOC implementation in India, they address the integration of MOOCs into formal higher education systems. They conclude their article with the contention that, through upscaling, important facets of students' intellectual development and critical thinking might be left to the students themselves. This may cause problems. Adequate scaffolding from a teacher, such as adapting activities to the specific situation, might be needed to develop the skills required to be a self-directed learner. Furthermore, upscaling seems to promote a separation of the formerly unified teacher functions of planning, teaching and assessing, which necessitates increased collaboration among the many new actors in the field of pedagogy.
Information Extraction and Dependency on Open Government Data (ogd) for Environmental Monitoring
Abdulmuttalib, Hussein
2016-06-01
Environmental monitoring practices support decision makers of different government / private institutions, besides environmentalists and planners among others. This support helps them act towards the sustainability of our environment, and also take efficient measures for protecting human beings in general, but it is difficult to explore useful information from 'OGD' and assure its quality for the purpose. On the other hand, Monitoring itself comprises detecting changes as happens, or within the mitigation period range, which means that any source of data, that is to be used for monitoring, should replicate the information related to the period of environmental monitoring, or otherwise it's considered almost useless or history. In this paper the assessment of information extraction and structuring from Open Government Data 'OGD', that can be useful to environmental monitoring is performed, looking into availability, usefulness to environmental monitoring of a certain type, checking its repetition period and dependences. The particular assessment is being performed on a small sample selected from OGD, bearing in mind the type of the environmental change monitored, such as the increase and concentrations of built up areas, and reduction of green areas, or monitoring the change of temperature in a specific area. The World Bank mentioned in its blog that Data is open if it satisfies both conditions of, being technically open, and legally open. The use of Open Data thus, is regulated by published terms of use, or an agreement which implies some conditions without violating the above mentioned two conditions. Within the scope of the paper I wish to share the experience of using some OGD for supporting an environmental monitoring work, that is performed to mitigate the production of carbon dioxide, by regulating energy consumption, and by properly designing the test area's landscapes, thus using Geodesign tactics, meanwhile wish to add to the results achieved by many
Pattee, Gary L; Wymer, James P; Lomen-Hoerth, Catherine; Appel, Stanley H; Formella, Andrea E; Pope, Laura E
2014-11-01
Pseudobulbar affect (PBA) is associated with neurological disorders or injury affecting the brain, and characterized by frequent, uncontrollable episodes of crying and/or laughing that are exaggerated or unrelated to the patient's emotional state. Clinical trials establishing dextromethorphan and quinidine (DM/Q) as PBA treatment were conducted in patients with amyotrophic lateral sclerosis (ALS) or multiple sclerosis (MS). This trial evaluated DM/Q safety in patients with PBA secondary to any neurological condition affecting the brain. To evaluate the safety and tolerability of DM/Q during long-term administration to patients with PBA associated with multiple neurological conditions. Fifty-two-week open-label study of DM/Q 30/30 mg twice daily. Safety measures included adverse events (AEs), laboratory tests, electrocardiograms (ECGs), vital signs, and physical examinations. #NCT00056524. A total of 553 PBA patients with >30 different neurological conditions enrolled; 296 (53.5%) completed. The most frequently reported treatment-related AEs (TRAEs) were nausea (11.8%), dizziness (10.5%), headache (9.9%), somnolence (7.2%), fatigue (7.1%), diarrhea (6.5%), and dry mouth (5.1%). TRAEs were mostly mild/moderate, generally transient, and consistent with previous controlled trials. Serious AEs (SAEs) were reported in 126 patients (22.8%), including 47 deaths, mostly due to ALS progression and respiratory failure. No SAEs were deemed related to DM/Q treatment by investigators. ECG results suggested no clinically meaningful effect of DM/Q on myocardial repolarization. Differences in AEs across neurological disease groups appeared consistent with the known morbidity of the primary neurological conditions. Study interpretation is limited by the small size of some disease groups, the lack of a specific efficacy measure and the use of a DM/Q dose higher than the eventually approved dose. DM/Q was generally well tolerated over this 52 week trial in patients with PBA
Semi-wild chimpanzees open hard-shelled fruits differently across communities.
Rawlings, Bruce; Davila-Ross, Marina; Boysen, Sarah T
2014-07-01
Researchers investigating the evolutionary roots of human culture have turned to comparing behaviours across nonhuman primate communities, with tool-based foraging in particular receiving much attention. This study examined whether natural extractive foraging behaviours other than tool selection differed across nonhuman primate colonies that had the same foods available. Specifically, the behaviours applied to open the hard-shelled fruits of Strychnos spp. were examined in three socially separate, semi-wild colonies of chimpanzees (Pan troglodytes) that lived under shared ecological conditions at Chimfunshi Wildlife Orphanage, and were comparable in their genetic makeup. The chimpanzees (N=56) consistently applied six techniques to open these fruits. GLMM results revealed differences in the number of combined technique types to open fruits across the colonies. They also showed colony differences in the application of three specific techniques. Two techniques (full biting and fruit cracking) were entirely absent in some colonies. This study provides empirical evidence that natural hard-shelled fruit-opening behaviours are distinct across chimpanzee colonies, differences that most likely have not resulted from ecological and genetic reasons.
Open Source Software and Open Content: Interview met Jan Hylén
Lambert Berenbroek
2005-01-01
Jan Hylén also attending the Surf Education Days 2005, held a presentation about Open Source Software and Open Content (such as the MIT Open Courseware project and the Open Access initiative). Jan Hylén is working at the Centre for Educational Research and Innovation (CERI) of the Organization of
dsmcFoam+: An OpenFOAM based direct simulation Monte Carlo solver
White, C.; Borg, M. K.; Scanlon, T. J.; Longshaw, S. M.; John, B.; Emerson, D. R.; Reese, J. M.
2018-03-01
dsmcFoam+ is a direct simulation Monte Carlo (DSMC) solver for rarefied gas dynamics, implemented within the OpenFOAM software framework, and parallelised with MPI. It is open-source and released under the GNU General Public License in a publicly available software repository that includes detailed documentation and tutorial DSMC gas flow cases. This release of the code includes many features not found in standard dsmcFoam, such as molecular vibrational and electronic energy modes, chemical reactions, and subsonic pressure boundary conditions. Since dsmcFoam+ is designed entirely within OpenFOAM's C++ object-oriented framework, it benefits from a number of key features: the code emphasises extensibility and flexibility so it is aimed first and foremost as a research tool for DSMC, allowing new models and test cases to be developed and tested rapidly. All DSMC cases are as straightforward as setting up any standard OpenFOAM case, as dsmcFoam+ relies upon the standard OpenFOAM dictionary based directory structure. This ensures that useful pre- and post-processing capabilities provided by OpenFOAM remain available even though the fully Lagrangian nature of a DSMC simulation is not typical of most OpenFOAM applications. We show that dsmcFoam+ compares well to other well-known DSMC codes and to analytical solutions in terms of benchmark results.
Matching conditions and duality in N=1 SUSY gauge theories in the conformal window
International Nuclear Information System (INIS)
Kogan, I.I.; Shifman, M.; Vainshtein, A.
1996-01-01
We discuss duality in N=1 SUSY gauge theories in Seiberg close-quote s conformal window, 3N c /2 f c . The close-quote t Hooft consistency conditions, the basic tool for establishing the infrared duality, are considered taking into account higher order α corrections. The conserved (anomaly-free) R current is built to all orders in α. Although this current contains all orders in α the close-quote t Hooft consistency conditions for this current are shown to be one loop. This observation thus justifies Seiberg close-quote s matching procedure. We also briefly discuss the inequivalence of the open-quote open-quote electric close-quote close-quote and open-quote open-quote magnetic close-quote close-quote theories at short distances. copyright 1996 The American Physical Society
High-uniformity centimeter-wide Si etching method for MEMS devices with large opening elements
Okamoto, Yuki; Tohyama, Yukiya; Inagaki, Shunsuke; Takiguchi, Mikio; Ono, Tomoki; Lebrasseur, Eric; Mita, Yoshio
2018-04-01
We propose a compensated mesh pattern filling method to achieve highly uniform wafer depth etching (over hundreds of microns) with a large-area opening (over centimeter). The mesh opening diameter is gradually changed between the center and the edge of a large etching area. Using such a design, the etching depth distribution depending on sidewall distance (known as the local loading effect) inversely compensates for the over-centimeter-scale etching depth distribution, known as the global or within-die(chip)-scale loading effect. Only a single DRIE with test structure patterns provides a micro-electromechanical systems (MEMS) designer with the etched depth dependence on the mesh opening size as well as on the distance from the chip edge, and the designer only has to set the opening size so as to obtain a uniform etching depth over the entire chip. This method is useful when process optimization cannot be performed, such as in the cases of using standard conditions for a foundry service and of short turn-around-time prototyping. To demonstrate, a large MEMS mirror that needed over 1 cm2 of backside etching was successfully fabricated using as-is-provided DRIE conditions.
The Openness of the University of the Philippines Open University: Issues and Prospects
Directory of Open Access Journals (Sweden)
Maria Fe Villamejor-Mendoza
2013-05-01
Full Text Available This paper is a self-reflection on the state of openness of the University of the Philippines Open University (UPOU. An exploratory and descriptive study, it aims not only to define the elements of openness of UPOU, but also to unravel the causes and solutions to the issues and concerns that limit its options to becoming a truly open university. It is based on four parameters of openness, which are widely universal in the literature, e.g., open admissions, open curricula, distance education at scale, and the co-creation, sharing and use of open educational resources (OER. It draws from the perception survey among peers, which the author conducted in UPOU in July and August 2012. It also relies on relevant secondary materials on the subject.
DEFF Research Database (Denmark)
Bogers, Marcel; Chesbrough, Henry; Moedas, Carlos
2018-01-01
Open innovation is now a widely used concept in academia, business, and policy making. This article describes the state of open innovation at the intersection of research, practice, and policy. It discusses some key trends (e.g., digital transformation), challenges (e.g., uncertainty...
Surface free energy for systems with integrable boundary conditions
International Nuclear Information System (INIS)
Goehmann, Frank; Bortz, Michael; Frahm, Holger
2005-01-01
The surface free energy is the difference between the free energies for a system with open boundary conditions and the same system with periodic boundary conditions. We use the quantum transfer matrix formalism to express the surface free energy in the thermodynamic limit of systems with integrable boundary conditions as a matrix element of certain projection operators. Specializing to the XXZ spin-1/2 chain we introduce a novel 'finite temperature boundary operator' which characterizes the thermodynamical properties of surfaces related to integrable boundary conditions
Häyrynen, Teppo; Osterkryger, Andreas Dyhl; de Lasson, Jakob Rosenkrantz; Gregersen, Niels
2017-09-01
Recently, an open geometry Fourier modal method based on a new combination of an open boundary condition and a non-uniform k-space discretization was introduced for rotationally symmetric structures, providing a more efficient approach for modeling nanowires and micropillar cavities [J. Opt. Soc. Am. A33, 1298 (2016)JOAOD61084-752910.1364/JOSAA.33.001298]. Here, we generalize the approach to three-dimensional (3D) Cartesian coordinates, allowing for the modeling of rectangular geometries in open space. The open boundary condition is a consequence of having an infinite computational domain described using basis functions that expand the whole space. The strength of the method lies in discretizing the Fourier integrals using a non-uniform circular "dartboard" sampling of the Fourier k space. We show that our sampling technique leads to a more accurate description of the continuum of the radiation modes that leak out from the structure. We also compare our approach to conventional discretization with direct and inverse factorization rules commonly used in established Fourier modal methods. We apply our method to a variety of optical waveguide structures and demonstrate that the method leads to a significantly improved convergence, enabling more accurate and efficient modeling of open 3D nanophotonic structures.
DEFF Research Database (Denmark)
Tosco, Paolo; Balle, Thomas
2011-01-01
Open3DQSAR is a freely available open-source program aimed at chemometric analysis of molecular interaction fields. MIFs can be imported from different sources (GRID, CoMFA/CoMSIA, quantum-mechanical electrostatic potential or electron density grids) or generated by Open3DQSAR itself. Much focus...... has been put on automation through the implementation of a scriptable interface, as well as on high computational performance achieved by algorithm parallelization. Flexibility and interoperability with existing molecular modeling software make Open3DQSAR a powerful tool in pharmacophore assessment...
JISC Open Access Briefing Paper
Swan, Alma
2005-01-01
What Open Access is. What Open Access is not. How is Open Access provided? Open Access archives or repositories. Open Access journals. Why should authors provide Open Access to their work? Further information and resources
Directory of Open Access Journals (Sweden)
Xiliang Zhang
2013-09-01
Full Text Available A life-cycle analysis (LCA of greenhouse gas (GHG emissions and energy use was performed to study bio-jet fuel (BJF production from micro-algae grown in open ponds under Chinese conditions using the Tsinghua University LCA Model (TLCAM. Attention was paid to energy recovery through biogas production and cogeneration of heat and power (CHP from the residual biomass after oil extraction, including fugitive methane (CH4 emissions during the production of biogas and nitrous oxide (N2O emissions during the use of digestate (solid residue from anaerobic digestion as agricultural fertilizer. Analyses were performed based on examination of process parameters, mass balance conditions, material requirement, energy consumptions and the realities of energy supply and transport in China (i.e., electricity generation and heat supply primarily based on coal, multiple transport modes. Our LCA result of the BJF pathway showed that, compared with the traditional petrochemical pathway, this new pathway will increase the overall fossil energy use and carbon emission by 39% and 70%, respectively, while decrease petroleum consumption by about 84%, based on the same units of energy service. Moreover, the energy conservation and emission reduction benefit of this new pathway may be accomplished by two sets of approaches: wider adoption of low-carbon process fuels and optimization of algae cultivation and harvest, and oil extraction processes.
Mass, A.
2016-12-01
Cryoconites are small melt pools on the ablation surface of glaciers created by the accumulation of aeolian sediment with a lower albedo than the surrounding ice. While many cryoconites remain open to the surrounding atmosphere, environmental conditions in the McMurdo Dry Valleys of Antarctica often lead to the formation of dense ice lids due to advection from cold winds. These lidded cryoconites are isolated from atmospheric exchange while maintaining subsurface melt in a solid-state greenhouse. The varying conditions for the formation and freeze-thaw cycle of cryoconites lead to a range of biogeochemical processes occurring within the pools. This study analyzed the biochemistry of both open and lidded cryoconite water from six glaciers in the Dry Valleys throughout the initial pulse melt, equilibrium, and refreezing periods in 2013- 2015. Many of the spatial gradients in carbon cycling, solute concentrations, and pH identified for lidded cryoconites exhibited opposite trends for pools in equilibrium with the atmosphere, while temporal gradients were less diverse for open pools.
Non-traumatic causes and the management of the open abdomen.
Mentula, P
2011-04-01
The open abdomen is increasingly used for the treatment and prevention of abdominal compartment syndrome. The leading non-traumatic conditions that may cause abdominal compartment syndrome requiring surgical decompression include secondary peritonitis, ruptured abdominal aortic aneurysm and severe acute pancreatitis. Patients may also end up with the open abdomen when the laparotomy wound cannot be closed without tension because of excessive visceral swelling. Also, surgical complications such as laparotomy wound dehiscence, may require temporary abdominal closure techniques. In critically ill surgical patients and in situations when second-look laparotomy is mandatory the open abdomen can be utilized in a preventive manner like in damage control trauma surgery. Underlying disease and the indication for the open abdomen significantly contributes to outcome of patient with open abdomen. Non-traumatic aetiology of the open abdomen is associated with lower likelihood of primary fascial closure and higher rate of open abdomen related complications compared with traumatic aetiology. A number of temporal abdominal closure techniques have been described. Ideally, temporal abdominal closure technique should prevent the development of recurrent abdominal compartment syndrome and facilitate later primary fascia closure with low complication rate. Although fascial closure rate varies between techniques, there are few evidence-based data to support one technique over another. However, recent evolution of temporary abdominal closure techniques have decreased the number of patients with frozen abdomen and reduced the need for planned hernia management. Highest fascial closure rates have been achieved with vacuum-assisted closure systems and systems that provide continuous fascial traction.
Characteristics and Challenges of Open-Water Swimming Performance: A Review.
Baldassarre, Roberto; Bonifazi, Marco; Zamparo, Paola; Piacentini, Maria Francesca
2017-11-01
Although the popularity of open-water swimming (OWS) events has significantly increased in the last decades, specific studies regarding performance of elite or age-group athletes in these events are scarce. To analyze the existing literature on OWS. Relevant literature was located via computer-generated citations. During August 2016, online computer searches on PubMed and Scopus databases were conducted to locate published research. The number of participants in ultraendurance swimming events has substantially increased in the last 10 y. In elite athletes there is a higher overall competitive level of women than of men. The body composition of female athletes (different percentage and distribution of fat tissue) shows several advantages (more buoyancy and less drag) in aquatic conditions that determine the small difference between males and females. The main physiological characteristics of open-water swimmers (OW swimmers) are the ability to swim at high percentage of [Formula: see text] (80-90%) for many hours. Furthermore, to sustain high velocity for many hours, endurance swimmers need a high propelling efficiency and a low energy cost. Open-water races may be characterized by extreme environmental conditions (water temperature, tides, currents, and waves) that have an overall impact on performance, influencing tactics and pacing. Future studies are needed to study OWS in both training and competition.
Smiler S, Kingston
2015-01-01
This book is intended for network protocol developers, SDN controller application developers, and academics who would like to understand and develop their own OpenFlow switch or OpenFlow controller in any programming language. With basic understanding of OpenFlow and its components, you will be able to follow the recipes in this book.
Munshi, Aaftab; Mattson, Timothy G; Fung, James; Ginsburg, Dan
2011-01-01
Using the new OpenCL (Open Computing Language) standard, you can write applications that access all available programming resources: CPUs, GPUs, and other processors such as DSPs and the Cell/B.E. processor. Already implemented by Apple, AMD, Intel, IBM, NVIDIA, and other leaders, OpenCL has outstanding potential for PCs, servers, handheld/embedded devices, high performance computing, and even cloud systems. This is the first comprehensive, authoritative, and practical guide to OpenCL 1.1 specifically for working developers and software architects. Written by five leading OpenCL authorities, OpenCL Programming Guide covers the entire specification. It reviews key use cases, shows how OpenCL can express a wide range of parallel algorithms, and offers complete reference material on both the API and OpenCL C programming language. Through complete case studies and downloadable code examples, the authors show how to write complex parallel programs that decompose workloads across many different devices. They...
Van Zante, Dale E.; Rizzi, Stephen A.
2016-01-01
The ERA project executed a comprehensive test program for Open Rotor aerodynamic and acoustic performance. System studies used the data to estimate the fuel burn savings and acoustic margin for an aircraft system with open rotor propulsion. The acoustic measurements were used to produce an auralization that compares the legacy blades to the current generation of open rotor designs.
International Nuclear Information System (INIS)
Mele, Salvatore
2007-01-01
The tenets of Open Access are to grant anyone, anywhere and anytime free access to the results of scientific research. HEP spearheaded the Open Access dissemination of scientific results with the mass mailing of preprints in the pre-WWW era and with the launch of the arXiv preprint system at the dawn of the '90s. The HEP community is now ready for a further push to Open Access while retaining all the advantages of the peer-review system and, at the same time, bring the spiralling cost of journal subscriptions under control. I will present a possible plan for the conversion to Open Access of HEP peer-reviewed journals, through a consortium of HEP funding agencies, laboratories and libraries: SCOAP3 (Sponsoring Consortium for Open Access Publishing in Particle Physics). SCOAP3 will engage with scientific publishers towards building a sustainable model for Open Access publishing, which is as transparent as possible for HEP authors. The current system in which journals income comes from subscription fees is replaced with a scheme where SCOAP3 compensates publishers for the costs incurred to organise the peer-review service and give Open Access to the final version of articles. SCOAP3 will be funded by all countries active in HEP under a 'fair share' scenario, according to their production of HEP articles. In this talk I will present a short overview of the history of Open Access in HEP, the details of the SCOAP3 model and the outlook for its implementation.
Transport efficiency in open quantum systems with static and dynamical disorder
Zhang, Yang; Celardo, G. Luca; Borgonovi, Fausto; Kaplan, Lev
2017-12-01
We study, under very general conditions and in a variety of geometries, quantum enhancement of transport in open systems. Both static disorder and dephasing associated with dynamical disorder (or finite temperature) are fully included in the analysis. We show that quantum coherence effects may significantly enhance transport in open quantum systems even in the semiclassical regime (where the decoherence rate is greater than the inter-site hopping amplitude), as long as the static disorder is sufficiently strong. When the strengths of static and dynamical disorder are fixed, there is an optimal opening strength at which the coherent transport enhancement is optimized. Analytic results are obtained in two simple paradigmatic tight-binding models of large systems: the linear chain and the fully connected network. The physical behavior is also reflected, for example, in the FMO photosynthetic complex, which may be viewed as being intermediate between these paradigmatic models. We furthermore show that a nonzero dephasing rate assists transport in an open linear chain when the disorder strength exceeds a critical value, and obtain this critical disorder strength as a function of the degree of opening.
Breanna L. Riedel; Kevin R. Russell; W. Mark Ford
2012-01-01
Nonforested habitats such as open fields and pastures have been considered unsuitable for desiccation-prone woodland salamanders such as the Eastern Red-backed Salamander (Plethodon cinereus). Recent research has suggested that Plethodon cinereus may not only disperse across but also reside within open habitats including fields,...
Open Government Partnership as a Platform for Advancing Open Education Policy
Gondol, Jan; Allen, Nicole
2015-01-01
An exciting new avenue for establishing and expanding national commitments to open education has emerged through the Open Government Partnership (OGP), a multilateral initiative that aims to secure commitments from governments to make their governance more open, accountable and responsive to citizens. In the past, there has not been a strong link…
Structural Safety Analysis of Openable Working Table in ACP Hot Cell for Spent Fuel Treatment
International Nuclear Information System (INIS)
Kwon, Ki Chan; Ku, Jeong Hoe; Lee, Eun Pyo; Choung, Won Myung; You, Gil Sung; Lee, Won Kyung; Cho, IL Je; Kuk, Dong Hak
2006-01-01
A demonstration facility for advanced spent fuel conditioning process (ACP) is under construction in KAERI. In this hot cell facility, all process equipment and materials are taken in and out only through the rear door. The working table in front of the process rear door is specially designed to be openable for the efficient use of the space. This paper presents the structural safety analysis of the openable working table, for the normal operational load condition and accidental drop condition of heavy object. Both cases are investigated through static and dynamic finite element analyses. The analysis results show that structural safety of the working table is sufficiently assured and the working table is not collapsed even when an object of 500 kg is dropped from the height of 50 cm.
Tang, Haoye; Liu, Gang; Zhu, Jianguo; Kobayashi, Kazuhiko
2015-04-01
We investigated the effects of elevated ozone concentration (E-O3) on CH4 and N2O emission from paddies with two rice cultivars: an inbred Indica cultivar Yangdao 6 (YD6) and a hybrid one II-you 084 (IIY084), under fully open-air field conditions in China. A mean 26.7% enhancement of ozone concentration above the ambient level (A-O3) significantly reduced CH4 emission at tillering and flowering stages leading to a reduction of seasonal integral CH4 emission by 29.6% on average across the two cultivars. The reduced CH4 emission is associated with O3-induced reduction in the whole-plant biomass (-13.2%), root biomass (-34.7%), and maximum tiller number (-10.3%), all of which curbed the carbon supply for belowground CH4 production and its release from submerged soil to atmosphere. Although no significant difference was detected between the cultivars in the CH4 emission response to E-O3, a larger decrease in CH4 emission with IIY084 (-33.2%) than that with YD6 (-7.0%) was observed at tillering stage, which may be due to the larger reduction in tiller number in IIY084 by E-O3. Additionally, E-O3 reduced seasonal mean NOx flux by 5.7% and 11.8% with IIY084 and YD6, respectively, but the effects were not significant statistically. We found that the relative response of CH4 emission to E-O3 was not significantly different from those reported in open-top chamber experiments. This study has thus confirmed that increasing ozone concentration would mitigate the global warming potential of CH4 and suggested consideration of the feedback mechanism between ozone and its precursor emission into the projection of future ozone effects on terrestrial ecosystem. © 2014 John Wiley & Sons Ltd.
DEFF Research Database (Denmark)
Møller Moltke Martiny, Kristian; Pedersen, David Budtz; Hansted, Allan Alfred Birkegaard
2016-01-01
In this article, we present three challenges to the emerging Open Science (OS) movement: the challenge of communication, collaboration and cultivation of scientific research. We argue that to address these challenges OS needs to include other forms of data than what can be captured in a text...... and extend into a fully-fledged Open Media movement engaging with new media and non-traditional formats of science communication. We discuss two cases where experiments with open media have driven new collaborations between scientists and documentarists. We use the cases to illustrate different advantages...... of using open media to face the challenges of OS....
Restoration of the analytically reconstructed OpenPET images by the method of convex projections
Energy Technology Data Exchange (ETDEWEB)
Tashima, Hideaki; Murayama, Hideo; Yamaya, Taiga [National Institute of Radiological Sciences, Chiba (Japan); Katsunuma, Takayuki; Suga, Mikio [Chiba Univ. (Japan). Graduate School of Engineering; Kinouchi, Shoko [National Institute of Radiological Sciences, Chiba (Japan); Chiba Univ. (Japan). Graduate School of Engineering; Obi, Takashi [Tokyo Institute of Technology (Japan). Interdisciplinary Graduate School of Science and Engineering; Kudo, Hiroyuki [Tsukuba Univ. (Japan). Graduate School of Systems and Information Engineering
2011-07-01
We have proposed the OpenPET geometry which has gaps between detector rings and physically opened field-of-view. The image reconstruction of the OpenPET is classified into an incomplete problem because it does not satisfy the Orlov's condition. Even so, the simulation and experimental studies have shown that applying iterative methods such as the maximum likelihood expectation maximization (ML-EM) algorithm successfully reconstruct images in the gap area. However, the imaging process of the iterative methods in the OpenPET imaging is not clear. Therefore, the aim of this study is to analytically analyze the OpenPET imaging and estimate implicit constraints involved in the iterative methods. To apply explicit constraints in the OpenPET imaging, we used the method of convex projections for restoration of the images reconstructed by the analytical way in which low-frequency components are lost. Numerical simulations showed that the similar restoration effects are involved both in the ML-EM and the method of convex projections. Therefore, the iterative methods have advantageous effect of restoring lost frequency components of the OpenPET imaging. (orig.)
Extraction of diode parameters of silicon solar cells under high illumination conditions
International Nuclear Information System (INIS)
Khan, Firoz; Baek, Seong-Ho; Park, Yiseul; Kim, Jae Hyun
2013-01-01
Graphical abstract: We have developed an analytical method to determine the diode parameters of concentrator solar cells under high illumination conditions. The determined values of diode parameters have been used to compute the theoretical values of performance parameters. The computed values of the open circuit voltage, curve factor, and efficiency obtained using diode parameters determined with this method showed good agreement (<2% discrepancy) with their experimental values in the temperature range 298–323 K. Highlights: • An analytical method to extract the diode parameters of concentrated Si solar cells. • This method uses single I–V curve under high illumination conditions. • The theoretical values of performance parameters have been computed. • Theoretical values of parameters matched within 2% discrepancy limit. • This method gives best results among the methods used in this work. - Abstract: An analytical method has been developed to extract all four diode parameters, namely the shunt resistance, series resistance, diode ideality factor, and reverse saturation current density, using a single J–V curve, based on one exponential model of silicon solar cells under high illumination conditions. The slope of the J–V curve (dV/dJ) at a short circuit condition is used to determine the value of the shunt resistance. The slope of the J–V curve at an open circuit condition together with the short circuit current density, open circuit voltage, current density, and voltage at maximum power point have been used to determine the values of the series resistance, diode ideality factor, and reverse saturation current density. The determined values of the diode parameters have been used to compute the theoretical values of the open circuit voltage, curve factor, and efficiency of the solar cell. The theoretical J–V curves matched well with the corresponding experimental curves. This method is applied to determine the diode parameters of concentrator
Dimensions of open research: critical reflections on openness in the ROER4D project
Directory of Open Access Journals (Sweden)
Thomas William King
2016-05-01
Full Text Available Open Research has the potential to advance the scientific process by improving the transparency, rigour, scope and reach of research, but choosing to experiment with Open Research carries with it a set of ideological, legal, technical and operational considerations. Researchers, especially those in resource-constrained situations, may not be aware of the complex interrelations between these different domains of open practice, the additional resources required, or how Open Research can support traditional research practices. Using the Research on Open Educational Resources for Development (ROER4D project as an example, this paper attempts to demonstrate the interrelation between ideological, legal, technical and operational openness; the resources that conducting Open Research requires; and the benefits of an iterative, strategic approach to one’s own Open Research practice. In this paper we discuss the value of a critical approach towards Open Research to ensure better coherence between ‘open’ ideology (embodied in strategic intention and ‘open’ practice (the everyday operationalisation of open principles.
Fischer, Hendrik S; Ullrich, Tim L; Bührer, Christoph; Czernik, Christoph; Schmalisch, Gerd
2017-02-01
Clinical studies show that non-invasive respiratory support by continuous positive airway pressure (CPAP) affects gas conditioning in the upper airways, especially in the presence of mouth leaks. Using a new bench model of neonatal CPAP, we investigated the influence of mouth opening on oropharyngeal temperature and humidity. The model features the insertion of a heated humidifier between an active model lung and an oropharyngeal head model to simulate the recurrent expiration of heated, humidified air. During unsupported breathing, physiological temperature and humidity were attained inside the model oropharynx, and mouth opening had no significant effect on oropharyngeal temperature and humidity. During binasal CPAP, the impact of mouth opening was investigated using three different scenarios: no conditioning in the CPAP circuit, heating only, and heated humidification. Mouth opening had a strong negative impact on oropharyngeal humidification in all tested scenarios, but heated humidification in the CPAP circuit maintained clinically acceptable humidity levels regardless of closed or open mouths. The model can be used to test new equipment for use with CPAP, and to investigate the effects of other methods of non-invasive respiratory support on gas conditioning in the presence of leaks. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Takanashi, M. (Kanagawa Prefectural Government, Kanagawa (Japan))
1992-08-06
With the dramatic progress of urbanization, the rapid decrease of the green area and the open space, which is basis for ensuring the safety and the comfort of city life and formation of a good city environment, lead to the worsen of city environment. For the basic purpose of achieving the harmony between development and environment by considering the preservation of the green area and the open space, the green master plan is a representative example, and was made as the constitution of from a ground plan to the various plans such as region, city and nation based on the space unit of developing the human action. One of the important planning approach for the green area plan from conception to implementation is the planning standards of park and open space planning. This paper introduced the change of the system about the planning standards of park and open space planning, and explained necessarily the present state of greens master plan about preservation of the national environment and adjustment the park and open space. 1tab.
International Nuclear Information System (INIS)
Trautz, R. C.; Wang, Joseph S. Y.
2001-01-01
Liquid-release tests, performed in boreholes above an underground opening constructed in unsaturated fractured rock, are used in this study to evaluate seepage into a waste emplacement drift. Evidence for the existence of a capillary barrier at the ceiling of the drift is presented, based on field observations (including spreading of the wetting front across the ceiling and water movement up fractures exposed in the ceiling before seepage begins). The capillary barrier mechanism has the potential to divert water around the opening, resulting in no seepage when the percolation flux is at or below the seepage threshold flux. Liquid-release tests are used to demonstrate that a seepage threshold exists and to measure the magnitude of the seepage threshold flux for three test zones that seeped. The seepage data are interpreted using analytical techniques to estimate the test-specific strength of the rock capillary forces (α -1 ) that prevent water from seeping into the drift. Evaporation increases the seepage threshold flux making it more difficult for water to seep into the drift and producing artificially inflated α -1 values. With adjustments for evaporation, the minimum test-specific threshold is 1,600 mm/yr with a corresponding α -1 of 0.027 m
Operating principle of Soft Open Points for electrical distribution network operation
International Nuclear Information System (INIS)
Cao, Wanyu; Wu, Jianzhong; Jenkins, Nick; Wang, Chengshan; Green, Timothy
2016-01-01
Highlights: • Two control modes were developed for a B2B VSCs based SOP. • The SOP operating principle was investigated under various network conditions. • The performance of the SOP using two control modes was analyzed. - Abstract: Soft Open Points (SOPs) are power electronic devices installed in place of normally-open points in electrical power distribution networks. They are able to provide active power flow control, reactive power compensation and voltage regulation under normal network operating conditions, as well as fast fault isolation and supply restoration under abnormal conditions. Two control modes were developed for the operation of an SOP, using back-to-back voltage-source converters (VSCs). A power flow control mode with current control provides independent control of real and reactive power. A supply restoration mode with a voltage controller enables power supply to isolated loads due to network faults. The operating principle of the back-to-back VSCs based SOP was investigated under both normal and abnormal network operating conditions. Studies on a two-feeder medium-voltage distribution network showed the performance of the SOP under different network-operating conditions: normal, during a fault and post-fault supply restoration. During the change of network operating conditions, a mode switch method based on the phase locked loop controller was used to achieve the transitions between the two control modes. Hard transitions by a direct mode switching were noticed unfavourable, but seamless transitions were obtained by deploying a soft cold load pickup and voltage synchronization process.
Open pre-schools at integrated health services - A program theory
Directory of Open Access Journals (Sweden)
Agneta Abrahamsson
2013-04-01
Full Text Available Introduction: Family centres in Sweden are integrated services that reach all prospective parents and parents with children up to their sixth year, because of the co-location of the health service with the social service and the open pre-school. The personnel on the multi-professional site work together to meet the needs of the target group. The article explores a program theory focused on the open pre-schools at family centres.Method: A multi-case design is used and the sample consists of open pre-schools at six family centres. The hypothesis is based on previous research and evaluation data. It guides the data collection which is collected and analysed stepwise. Both parents and personnel are interviewed individually and in groups at each centre.Findings: The hypothesis was expanded to a program theory. The compliance of the professionals was the most significant element that explained why the open access service facilitated positive parenting. The professionals act in a compliant manner to meet the needs of the children and parents as well as in creating good conditions for social networking and learning amongst the parents. Conclusion: The compliance of the professionals in this program theory of open pre-schools at family centres can be a standard in integrated and open access services, whereas the organisation form can vary. The best way of increasing the number of integrative services is to support and encourage professionals that prefer to work in a compliant manner.
Open pre-schools at integrated health services - A program theory
Directory of Open Access Journals (Sweden)
Agneta Abrahamsson
2013-04-01
Full Text Available Introduction: Family centres in Sweden are integrated services that reach all prospective parents and parents with children up to their sixth year, because of the co-location of the health service with the social service and the open pre-school. The personnel on the multi-professional site work together to meet the needs of the target group. The article explores a program theory focused on the open pre-schools at family centres. Method: A multi-case design is used and the sample consists of open pre-schools at six family centres. The hypothesis is based on previous research and evaluation data. It guides the data collection which is collected and analysed stepwise. Both parents and personnel are interviewed individually and in groups at each centre. Findings: The hypothesis was expanded to a program theory. The compliance of the professionals was the most significant element that explained why the open access service facilitated positive parenting. The professionals act in a compliant manner to meet the needs of the children and parents as well as in creating good conditions for social networking and learning amongst the parents. Conclusion: The compliance of the professionals in this program theory of open pre-schools at family centres can be a standard in integrated and open access services, whereas the organisation form can vary. The best way of increasing the number of integrative services is to support and encourage professionals that prefer to work in a compliant manner.
Li, Liangliang; Wang, Jiangfeng; Wang, Yu
2016-08-01
Analysis of the process of decomposition is essential in establishing the postmortem interval. However, despite the fact that insects are important players in body decomposition, their exact function within the decay process is still unclear. There is also limited knowledge as to how the decomposition process occurs in the absence of insects. In the present study, we compared the decomposition of a pig carcass in open air with that of one placed in a methyl methacrylate box to prevent insect contact. The pig carcass in the methyl methacrylate box was in the fresh stage for 1 day, the bloated stage from 2 d to 11 d, and underwent deflated decay from 12 d. In contrast, the pig carcass in open air went through the fresh, bloated, active decay and post-decay stages; and 22.3 h (0.93 d), 62.47 h (2.60 d), 123.63 h (5.15 d) and 246.5 h (10.27 d) following the start of the experiment respectively, prior to entering the skeletonization stage. A large amount of soft tissue were remained on the pig carcass in the methyl methacrylate box on 26 d, while only scattered bones remained on the pig carcass in open air. The results indicate that insects greatly accelerate the decomposition process. Copyright © 2016 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.
Open digital badges in Open edX
Hickey, Daniel T.; Barba, Lorena A.; Lemoie, Kerri; Amigot, Michael; Ewens, Damian
2014-01-01
Slides for the presentation at the Open edX Conference, Cambridge, MA 2014. This talk presented the first public update of our collaboration to implement open digital badges in Dr. Barba's new MOOC, "Practical Numerical Methods with Python." It's a collaboration between Indiana University's Center for Research on Learning and Technology (led by Prof. Daniel T. Hickey); Prof. Lorena Barba and her team at George Washington University, with her partners at IBL Studios Education, and...
Open Genetic Code: on open source in the life sciences
Deibel, Eric
2014-01-01
The introduction of open source in the life sciences is increasingly being suggested as an alternative to patenting. This is an alternative, however, that takes its shape at the intersection of the life sciences and informatics. Numerous examples can be identified wherein open source in the life sciences refers to access, sharing and collaboration as informatic practices. This includes open source as an experimental model and as a more sophisticated approach of genetic engineering. The first ...
Directory of Open Access Journals (Sweden)
Álvaro López García
2016-01-01
Full Text Available In this document we present an implementation of the Open Grid Forum’s Open Cloud Computing Interface (OCCI for OpenStack, namely ooi (Openstack occi interface, 2015 [1]. OCCI is an open standard for management tasks over cloud resources, focused on interoperability, portability and integration. ooi aims to implement this open interface for the OpenStack cloud middleware, promoting interoperability with other OCCI-enabled cloud management frameworks and infrastructures. ooi focuses on being non-invasive with a vanilla OpenStack installation, not tied to a particular OpenStack release version.
López García, Álvaro; Fernández del Castillo, Enol; Orviz Fernández, Pablo
In this document we present an implementation of the Open Grid Forum's Open Cloud Computing Interface (OCCI) for OpenStack, namely ooi (Openstack occi interface, 2015) [1]. OCCI is an open standard for management tasks over cloud resources, focused on interoperability, portability and integration. ooi aims to implement this open interface for the OpenStack cloud middleware, promoting interoperability with other OCCI-enabled cloud management frameworks and infrastructures. ooi focuses on being non-invasive with a vanilla OpenStack installation, not tied to a particular OpenStack release version.
Comparison of leak opening and leak rate calculations to HDR experimental results
International Nuclear Information System (INIS)
Grebner, H.; Hoefler, A.; Hunger, H.
1993-01-01
During the last years a number of calculations of leak opening and leak rate for through cracks in piping components have been performed. Analyses are pre- or mostly post-calculations to experiments performed at the HDR facility under PWR operating conditions. Piping components under consideration were small diameter straight pipes with circumferential cracks, pipe bends with longitudinal or circumferential cracks and pipe branches with weldment cracks. The components were loaded by internal pressure and opening as well as closing bending moment. The finite element method and two-phase flow leak rate programs were used for the calculations. Results of the analyses are presented as J-integral values, crack opening displacements and areas and leak rates as well as comparisons to the experimental results
Roost temperature and fidelity of Wahlberg's epauletted fruit bat ...
African Journals Online (AJOL)
Generally,Wahlberg's epauletted fruit bat (Epomophorus wahlbergi) roost in trees or under the eaves of buildings. This study investigated the roosting dynamics of E. wahlbergi in the urban environment of Pietermaritzburg, South Africa. To determine roost fidelity bats were radiotracked to daytime roosts. Bats were found to ...
DEFF Research Database (Denmark)
Algreen-Petersen, Albert
2017-01-01
WEATHERING IS A TERM, WHICH DESCRIBES THE DESTRUCTION AND PATINA OF A BUILDING: THE GRADUAL CHANGES OVER TIME. IT ALSO DESCRIBES THE BUILDING DETAILS – CORNICE, PLINTH, EAVES, SILL ETC. – ELEMENTS THAT PROTECT THE BUILDING FROM RAIN AND THEREBY CONTROLS THE PROCESSES OF DESTRUCTION AND PATINA. TH...
The effects of moderate heat stress and open-plan office noise distraction on office work
DEFF Research Database (Denmark)
Witterseh, Thomas; Wyon, David; Clausen, Geo
2002-01-01
Thirty subjects clothed for comfort at 22 deg.C performed simulated office work for 3 hours at 22/26/30 deg.C (7.4 g/kg dry air, i.e. 45/35/28 %RH) in quiet and recorded open-plan office noise (55 dBA) conditions. Warmth decreased perceived air quality (P......Thirty subjects clothed for comfort at 22 deg.C performed simulated office work for 3 hours at 22/26/30 deg.C (7.4 g/kg dry air, i.e. 45/35/28 %RH) in quiet and recorded open-plan office noise (55 dBA) conditions. Warmth decreased perceived air quality (P...
DEFF Research Database (Denmark)
Tosco, Paolo; Balle, Thomas
2011-01-01
Description Open3DQSAR is an open-source tool aimed at pharmacophore exploration by high-throughput chemometric analysis of molecular interaction fields (MIFs). Open3DQSAR can generate steric potential, electron density and MM/QM electrostatic potential fields; furthermore, it can import GRIDKONT...... binary files produced by GRID and CoMFA/CoMSIA fields (exported from SYBYL with the aid of a small SPL script). Subsequently, Open3DQSAR performs fast, automated PLS chemometric analysis of MIFs allowing to quickly generate and challenge the predictivity of many 3D-QSAR models using different training...... integration with OpenBabel, PyMOL, gnuplot •Multi-threaded computation of MIFs (both MM and QM); support for MMFF94 and GAFF force-fields with automated assignment of atom types to the imported molecular structures •Comprehensive output, including SDF molecular databases, 3D maps and many different plots...
Movania, Muhammad Mobeen
2013-01-01
The book is written in a Cookbook format with practical recipes aimed at helping you exploit OpenGL to its full potential.This book is targeted towards intermediate OpenGL programmers. However, those who are new to OpenGL and know an alternate API like DirectX might also find these recipes useful to create OpenGL animations.
openBIS ELN-LIMS: an open-source database for academic laboratories.
Barillari, Caterina; Ottoz, Diana S M; Fuentes-Serna, Juan Mariano; Ramakrishnan, Chandrasekhar; Rinn, Bernd; Rudolf, Fabian
2016-02-15
The open-source platform openBIS (open Biology Information System) offers an Electronic Laboratory Notebook and a Laboratory Information Management System (ELN-LIMS) solution suitable for the academic life science laboratories. openBIS ELN-LIMS allows researchers to efficiently document their work, to describe materials and methods and to collect raw and analyzed data. The system comes with a user-friendly web interface where data can be added, edited, browsed and searched. The openBIS software, a user guide and a demo instance are available at https://openbis-eln-lims.ethz.ch. The demo instance contains some data from our laboratory as an example to demonstrate the possibilities of the ELN-LIMS (Ottoz et al., 2014). For rapid local testing, a VirtualBox image of the ELN-LIMS is also available. © The Author 2015. Published by Oxford University Press.
Boundary Conditions, Data Assimilation, and Predictability in Coastal Ocean Models
National Research Council Canada - National Science Library
Samelson, Roger M; Allen, John S; Egbert, Gary D; Kindle, John C; Snyder, Chris
2007-01-01
...: The specific objectives of this research are to determine the impact on coastal ocean circulation models of open ocean boundary conditions from Global Ocean Data Assimilation Experiment (GODAE...
The role of grazing in nutrient-rich areas of the open sea
International Nuclear Information System (INIS)
Frost, B.W.
1991-01-01
No single factor accounts fully for the persistently low phytoplankton stocks in the nutrient-rich areas of the open sea. However, grazing plays the necessary role of consuming phytoplankton produced in excess of losses due to physical processes and sinking. Without grazing, even if specific growth rate of the phytoplankton is less than optimal for the prevailing light and temperature conditions, as might be so under limitation by a trace nutrient such as Fe, the phytoplankton stock would still accumulate with attendant depletion of nutrients. Observations during spring and summer in the open subarctic Pacific argue against limitation of phytoplankton growth to the point where phytoplankton stock could not increase in the absence of grazing. An ecosystem process model of the phytoplankton-grazer interaction suggests that two processes - grazing control of phytoplankton stock and preferential utilization of NH 4 by the phytoplankton - are sufficient to explain the continuously low phytoplankton stock and high concentrations of macronutrients. However, the grazing control may be exerted on a phytoplankton assemblage structured by Fe limitation. In particular, the intrinsic growth rates of potentially fast-growing diatoms seem to be depressed in the open subarctic Pacific. These conditions probably apply to two other nutrient-rich areas of the open sea, the Pacific equatorial upwelling region and the subantarctic circumpolar ocean, although in the latter region light limitation of phytoplankton growth may be more severe and silica limitation may influence the specific composition of the phytoplankton assemblage
The effect of open air conditions on the properties of wooden material
African Journals Online (AJOL)
In this study, the impregnation materials of Tanalith-C (CCA) and Protim 230 WR were used as preservative and water repellant. Wooden materials were taken from beech and black pine. The samples were made subject to weathering conditions for one year. At the end of this period, changes occurred in the samples' ...
Magyar, Mate; Gonda, Xenia; Pap, Dorottya; Edes, Andrea; Galambos, Attila; Baksa, Daniel; Kocsel, Natalia; Szabo, Edina; Bagdy, Gyorgy; Elliott, Rebecca; Kokonyei, Gyongyi; Juhasz, Gabriella
2017-01-01
Migraine and depression frequently occur as comorbid conditions, and it has been hypothesized that migraine with and without depression may have a different genetic background. A distinct personality trait constellation has been described in migraineurs. Less attention, however, was paid to personality differences in migraineurs with and without depression which may also shed light on differences in the neurobiological, background. The aim of our study was to investigate big five personality traits, headaches, and lifetime depression (DEP) in a large European general population sample. Relationship between DEP, Big Five Inventory personality traits, and headaches identified by the ID-Migraine Questionnaire were investigated in 3,026 individuals from Budapest and Manchester with multivariate and logistic regression analyses. Both DEP and migraine(ID) showed differences in personality traits. Neuroticism was an independent risk factor for both conditions while a significant interaction effect appeared between the two in the case of openness. Namely, subjects with migraine(ID) and without DEP scored higher on openness compared to those who had depression. While we confirmed previous results that high neuroticism is a risk factor for both depression and migraine, openness to experience was significantly lower in the co-occurrence of migraine and depression. Our results suggest that increased openness, possibly manifested in optimal or advantageous cognitive processing of pain experience in migraine may decrease the risk of co-occurrence of depression and migraine and thus may provide valuable insight for newer prevention and intervention approaches in the treatment of these conditions.
Learning openCV computer vision with the openCV library
Bradski, Gary
2008-01-01
Learning OpenCV puts you right in the middle of the rapidly expanding field of computer vision. Written by the creators of OpenCV, the widely used free open-source library, this book introduces you to computer vision and demonstrates how you can quickly build applications that enable computers to see" and make decisions based on the data. With this book, any developer or hobbyist can get up and running with the framework quickly, whether it's to build simple or sophisticated vision applications
OpenSesame: An Open-source, Graphical Experiment Builder for the Social Sciences
Mathot, S.; Schreij, D.B.B.; Theeuwes, J.
2012-01-01
In the present article, we introduce OpenSesame, a graphical experiment builder for the social sciences. OpenSesame is free, open-source, and cross-platform. It features a comprehensive and intuitive graphical user interface and supports Python scripting for complex tasks. Additional functionality,