Spatial Construction Skills of Chimpanzees ("Pan Troglodytes") and Young Human Children ("Homo Sapiens Sapiens")

Science.gov (United States)

Poti, Patrizia; Hayashi, Misato; Matsuzawa, Tetsuro

2009-01-01

Spatial construction tasks are basic tests of visual-spatial processing. Two studies have assessed spatial construction skills in chimpanzees (Pan troglodytes) and young children (Homo sapiens sapiens) with a block modelling task. Study 1a subjects were three young chimpanzees and five adult chimpanzees. Study 1b subjects were 30 human children…

Homo sapiens natriuretic peptide precursor type C (NPPC) mRNA,partial cds and 3' UTR.

OpenAIRE

Landi, Stefano; Melaiu, Ombretta; Cabiati, Manuela; Landi, Debora; Caselli, Chiara; Prescimone, Tommaso; Giannessi, Daniela; Gemignani, Federica; Del Ry, Silvia

2010-01-01

LOCUS HQ419060 318 bp mRNA linear PRI 24-NOV-2010 DEFINITION Homo sapiens natriuretic peptide precursor type C (NPPC) mRNA, partial cds and 3' UTR. ACCESSION HQ419060 VERSION HQ419060.1 GI:312261407 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 318) AUTHORS Landi,S., Melaiu,O., Cabiati,M., Landi,D., C...

Bone strength and athletic ability in hominids: Ardipithecus ramidus to Homo sapiens

Science.gov (United States)

Lee, S. A.

2013-03-01

The ability of the femur to resist bending stresses is determined by its midlength cross-sectional geometry, its length and the elastic properties of the mineral part of the bone. The animal's athletic ability, determined by a ``bone strength index,'' is limited by this femoral bending strength in relation to the loads on the femur. This analysis is applied to the fossil record for Homo sapiens, Homo neanderthalensis, Homo erectus, Homo habilis, Australopithecus afarensis and Ardipithecus ramidus. Evidence that the femoral bone strength index of modern Homo sapiens has weakened over the last 50,000 years is found.

The evolution and development of cranial form in Homo sapiens

OpenAIRE

Lieberman, Daniel E.; McBratney, Brandeis M.; Krovitz, Gail

2002-01-01

Despite much data, there is no unanimity over how to define Homo sapiens in the fossil record. Here, we examine cranial variation among Pleistocene and recent human fossils by using a model of cranial growth to identify unique derived features (autapomorphies) that reliably distinguish fossils attributed to “anatomically modern” H. sapiens (AMHS) from those attributed to various taxa of “archaic” Homo spp. (AH) and to test hypotheses about the changes in cranial development that underlie the ...

The Lake Ndutu cranium and early Homo sapiens in Africa.

Science.gov (United States)

Rightmire, G P

1983-06-01

The partial cranium from Lake Ndutu, near Olduvai Gorge in northern Tanzania, has generally been viewed as Homo erectus, although points of similarity to H. sapiens have also been recognized. Bones of the vault are in fact quite thick, and the cranium is small. Length and breadth dimensions are comparable to those of earlier H. erectus from Koobi Fora and Ileret, and the Ndutu individual is more similar in size to O.H. 12 than to O.H. 9. Unfortunately, the facial skeleton and frontal bone are very incomplete, and little useful information can be obtained from these parts of the existing reconstruction. The parietals are also damaged, but the left temporal is more satisfactorily preserved, and the occiput is nearly complete. Occipital morphology, mastoid shape, and characteristics of the glenoid cavity and tympanic plate probably provide the best available guide to affinities of the Ndutu hominid. In many of these features the cranium resembles Broken Hill, Elandsfontein, and other African fossils referred to archaic H. sapiens. There are some similarities to modern humans also, but no ties to the Neanderthals of Europe. Allocation of Ndutu to an African subspecies of H. sapiens seems most appropriate, even if the pattern of relationships between such archaic populations and recent humans is still unclear.

Dental size reduction in Indonesian Homo erectus: Implications for the PU-198 premolar and the appearance of Homo sapiens on Java.

Science.gov (United States)

Polanski, Joshua M; Marsh, Hannah E; Maddux, Scott D

2016-01-01

The recent recovery of a hominin maxillary third premolar, PU-198, within the faunal collections from Punung Cave (East Java) has led to assertions that Homo sapiens appeared on Java between 143,000 and 115,000 years ago. The taxonomic assignment of PU-198 to H. sapiens was based predominantly on the small size of the specimen, following an analysis which found little to no overlap in premolar size between Homo erectus and terminal Pleistocene/Holocene H. sapiens. Here, we re-evaluate the use of size in the taxonomic assignment of PU-198 in light of 1) new buccolingual and mesiodistal measurements taken on the fossil, 2) comparisons to a larger sample of H. erectus and H. sapiens maxillary third premolars, and 3) evidence of a diachronic trend in post-canine dental size reduction among Javan H. erectus. Our results demonstrate PU-198 to be slightly larger than previously suggested, reveal substantial overlap in premolar size between H. erectus and H. sapiens, and indicate a statistically significant reduction in premolar size between early and late Javan H. erectus. Our findings cast doubt on the assignment of PU-198 to H. sapiens, and accordingly, question the appearance of H. sapiens on Java between 143,000 and 115,000 years ago. Copyright © 2015 Elsevier Ltd. All rights reserved.

The biting performance of Homo sapiens and Homo heidelbergensis.

Science.gov (United States)

Godinho, Ricardo Miguel; Fitton, Laura C; Toro-Ibacache, Viviana; Stringer, Chris B; Lacruz, Rodrigo S; Bromage, Timothy G; O'Higgins, Paul

2018-05-01

Modern humans have smaller faces relative to Middle and Late Pleistocene members of the genus Homo. While facial reduction and differences in shape have been shown to increase biting efficiency in Homo sapiens relative to these hominins, facial size reduction has also been said to decrease our ability to resist masticatory loads. This study compares crania of Homo heidelbergensis and H. sapiens with respect to mechanical advantages of masticatory muscles, force production efficiency, strains experienced by the cranium and modes of deformation during simulated biting. Analyses utilize X-ray computed tomography (CT) scan-based 3D models of a recent modern human and two H. heidelbergensis. While having muscles of similar cross-sectional area to H. heidelbergensis, our results confirm that the modern human masticatory system is more efficient at converting muscle forces into bite forces. Thus, it can produce higher bite forces than Broken Hill for equal muscle input forces. This difference is the result of alterations in relative in and out-lever arm lengths associated with well-known differences in midfacial prognathism. Apparently at odds with this increased efficiency is the finding that the modern human cranium deforms more, resulting in greater strain magnitudes than Broken Hill when biting at the equivalent tooth. Hence, the facial reduction that characterizes modern humans may not have evolved as a result of selection for force production efficiency. These findings provide further evidence for a degree of uncoupling between form and function in the masticatory system of modern humans. This may reflect the impact of food preparation technologies. These data also support previous suggestions that differences in bite force production efficiency can be considered a spandrel, primarily driven by the midfacial reduction in H. sapiens that occurred for other reasons. Midfacial reduction plausibly resulted in a number of other significant changes in morphology, such

Pleistocene Homo sapiens from Middle Awash, Ethiopia.

Science.gov (United States)

White, Tim D; Asfaw, Berhane; DeGusta, David; Gilbert, Henry; Richards, Gary D; Suwa, Gen; Howell, F Clark

2003-06-12

The origin of anatomically modern Homo sapiens and the fate of Neanderthals have been fundamental questions in human evolutionary studies for over a century. A key barrier to the resolution of these questions has been the lack of substantial and accurately dated African hominid fossils from between 100,000 and 300,000 years ago. Here we describe fossilized hominid crania from Herto, Middle Awash, Ethiopia, that fill this gap and provide crucial evidence on the location, timing and contextual circumstances of the emergence of Homo sapiens. Radioisotopically dated to between 160,000 and 154,000 years ago, these new fossils predate classic Neanderthals and lack their derived features. The Herto hominids are morphologically and chronologically intermediate between archaic African fossils and later anatomically modern Late Pleistocene humans. They therefore represent the probable immediate ancestors of anatomically modern humans. Their anatomy and antiquity constitute strong evidence of modern-human emergence in Africa.

Genetic, physiologic and ecogeographic factors contributing to variation in Homo sapiens: Homo floresiensis reconsidered.

Science.gov (United States)

Richards, Gary D

2006-11-01

A new species, Homo floresiensis, was recently named for Pleistocene hominid remains on Flores, Indonesia. Significant controversy has arisen regarding this species. To address controversial issues and refocus investigations, I examine the affinities of these remains with Homo sapiens. Clarification of problematic issues is sought through an integration of genetic and physiological data on brain ontogeny and evolution. Clarification of the taxonomic value of various 'primitive' traits is possible given these data. Based on this evidence and using a H. sapiens morphological template, models are developed to account for the combination of features displayed in the Flores fossils. Given this overview, I find substantial support for the hypothesis that the remains represent a variant of H. sapiens possessing a combined growth hormone-insulin-like growth factor I axis modification and mutation of the MCPH gene family. Further work will be required to determine the extent to which this variant characterized the population.

Homo sapiens in Arabia by 85,000 years ago.

Science.gov (United States)

Groucutt, Huw S; Grün, Rainer; Zalmout, Iyad A S; Drake, Nick A; Armitage, Simon J; Candy, Ian; Clark-Wilson, Richard; Louys, Julien; Breeze, Paul S; Duval, Mathieu; Buck, Laura T; Kivell, Tracy L; Pomeroy, Emma; Stephens, Nicholas B; Stock, Jay T; Stewart, Mathew; Price, Gilbert J; Kinsley, Leslie; Sung, Wing Wai; Alsharekh, Abdullah; Al-Omari, Abdulaziz; Zahir, Muhammad; Memesh, Abdullah M; Abdulshakoor, Ammar J; Al-Masari, Abdu M; Bahameem, Ahmed A; Al Murayyi, Khaled M S; Zahrani, Badr; Scerri, Eleanor L M; Petraglia, Michael D

2018-05-01

Understanding the timing and character of the expansion of Homo sapiens out of Africa is critical for inferring the colonization and admixture processes that underpin global population history. It has been argued that dispersal out of Africa had an early phase, particularly ~130-90 thousand years ago (ka), that reached only the East Mediterranean Levant, and a later phase, ~60-50 ka, that extended across the diverse environments of Eurasia to Sahul. However, recent findings from East Asia and Sahul challenge this model. Here we show that H. sapiens was in the Arabian Peninsula before 85 ka. We describe the Al Wusta-1 (AW-1) intermediate phalanx from the site of Al Wusta in the Nefud desert, Saudi Arabia. AW-1 is the oldest directly dated fossil of our species outside Africa and the Levant. The palaeoenvironmental context of Al Wusta demonstrates that H. sapiens using Middle Palaeolithic stone tools dispersed into Arabia during a phase of increased precipitation driven by orbital forcing, in association with a primarily African fauna. A Bayesian model incorporating independent chronometric age estimates indicates a chronology for Al Wusta of ~95-86 ka, which we correlate with a humid episode in the later part of Marine Isotope Stage 5 known from various regional records. Al Wusta shows that early dispersals were more spatially and temporally extensive than previously thought. Early H. sapiens dispersals out of Africa were not limited to winter rainfall-fed Levantine Mediterranean woodlands immediately adjacent to Africa, but extended deep into the semi-arid grasslands of Arabia, facilitated by periods of enhanced monsoonal rainfall.

From Purgatorius ceratops to Homo sapiens - Primate Evolutionary ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 7. From Purgatorius ceratops to Homo sapiens - Primate Evolutionary History. Sindhu Radhakrishna. General Article Volume 11 Issue 7 July 2006 pp 51-60. Fulltext. Click here to view fulltext PDF. Permanent link:

Stravovacích návyky z hlediska fylogeneze Homo sapiens sapiens.

OpenAIRE

HOLÁ, Marcela

2010-01-01

This Bachelor's thesis on the synthesis of literature, is attempting to create an overview of our human ancestor's dietary habits. The time frame is from the oldest representative of the hominoid family, genus Ardipithecus ramidus, to neolithic Homo sapiens.This will show the connection between the changing food spectrum and the phylogeny of our species.

Homo sapiens, Homo neanderthalensis and the Denisova specimen: New insights on their evolutionary histories using whole-genome comparisons.

Science.gov (United States)

Paixão-Côrtes, Vanessa Rodrigues; Viscardi, Lucas Henrique; Salzano, Francisco Mauro; Hünemeier, Tábita; Bortolini, Maria Cátira

2012-12-01

After a brief review of the most recent findings in the study of human evolution, an extensive comparison of the complete genomes of our nearest relative, the chimpanzee (Pan troglodytes), of extant Homo sapiens, archaic Homo neanderthalensis and the Denisova specimen were made. The focus was on non-synonymous mutations, which consequently had an impact on protein levels and these changes were classified according to degree of effect. A total of 10,447 non-synonymous substitutions were found in which the derived allele is fixed or nearly fixed in humans as compared to chimpanzee. Their most frequent location was on chromosome 21. Their presence was then searched in the two archaic genomes. Mutations in 381 genes would imply radical amino acid changes, with a fraction of these related to olfaction and other important physiological processes. Eight new alleles were identified in the Neanderthal and/or Denisova genetic pools. Four others, possibly affecting cognition, occured both in the sapiens and two other archaic genomes. The selective sweep that gave rise to Homo sapiens could, therefore, have initiated before the modern/archaic human divergence.

Orsang Man: a robust Homo sapiens in Central India with Asian Homo erectus features

OpenAIRE

Dambricourt-Malassé, Anne; Raj, Rachna; Shah, Samit

2013-01-01

17th World Congress of the International Union of Anthropological and Ethnological Sciences "Evolving Humanity, Emerging Worlds", Manchester, August 5th-10th, 2013 Accepted preprint; A Homo sapiens calvarium recovered in a fluvial deposit of the Orsang River give evidence of genetic continuity between late Asian Homo erectus suggesting an Asian "like-cromagnoid" stadium in the evolutionary process. IRSL dating of the host sediments provided an age ranging from 50 to 30 ka. The interesting fea...

Homo sapiens, Homo neanderthalensis and the Denisova specimen: new insights on their evolutionary histories using whole-genome comparisons

Directory of Open Access Journals (Sweden)

Vanessa Rodrigues Paixão-Côrtes

2012-01-01

Full Text Available After a brief review of the most recent findings in the study of human evolution, an extensive comparison of the complete genomes of our nearest relative, the chimpanzee (Pan troglodytes, of extant Homo sapiens, archaic Homo neanderthalensis and the Denisova specimen were made. The focus was on non-synonymous mutations, which consequently had an impact on protein levels and these changes were classified according to degree of effect. A total of 10,447 non-synonymous substitutions were found in which the derived allele is fixed or nearly fixed in humans as compared to chimpanzee. Their most frequent location was on chromosome 21. Their presence was then searched in the two archaic genomes. Mutations in 381 genes would imply radical amino acid changes, with a fraction of these related to olfaction and other important physiological processes. Eight new alleles were identified in the Neanderthal and/or Denisova genetic pools. Four others, possibly affecting cognition, occured both in the sapiens and two other archaic genomes. The selective sweep that gave rise to Homo sapiens could, therefore, have initiated before the modern/archaic human divergence.

New fossils from Jebel Irhoud, Morocco and the pan-African origin of Homo sapiens.

Science.gov (United States)

Hublin, Jean-Jacques; Ben-Ncer, Abdelouahed; Bailey, Shara E; Freidline, Sarah E; Neubauer, Simon; Skinner, Matthew M; Bergmann, Inga; Le Cabec, Adeline; Benazzi, Stefano; Harvati, Katerina; Gunz, Philipp

2017-06-07

Fossil evidence points to an African origin of Homo sapiens from a group called either H. heidelbergensis or H. rhodesiensis. However, the exact place and time of emergence of H. sapiens remain obscure because the fossil record is scarce and the chronological age of many key specimens remains uncertain. In particular, it is unclear whether the present day 'modern' morphology rapidly emerged approximately 200 thousand years ago (ka) among earlier representatives of H. sapiens or evolved gradually over the last 400 thousand years. Here we report newly discovered human fossils from Jebel Irhoud, Morocco, and interpret the affinities of the hominins from this site with other archaic and recent human groups. We identified a mosaic of features including facial, mandibular and dental morphology that aligns the Jebel Irhoud material with early or recent anatomically modern humans and more primitive neurocranial and endocranial morphology. In combination with an age of 315 ± 34 thousand years (as determined by thermoluminescence dating), this evidence makes Jebel Irhoud the oldest and richest African Middle Stone Age hominin site that documents early stages of the H. sapiens clade in which key features of modern morphology were established. Furthermore, it shows that the evolutionary processes behind the emergence of H. sapiens involved the whole African continent.

Mandibular molar root morphology in Neanderthals and Late Pleistocene and recent Homo sapiens.

Science.gov (United States)

Kupczik, Kornelius; Hublin, Jean-Jacques

2010-11-01

Neanderthals have a distinctive suite of dental features, including large anterior crown and root dimensions and molars with enlarged pulp cavities. Yet, there is little known about variation in molar root morphology in Neanderthals and other recent and fossil members of Homo. Here, we provide the first comprehensive metric analysis of permanent mandibular molar root morphology in Middle and Late Pleistocene Homo neanderthalensis, and Late Pleistocene (Aterian) and recent Homo sapiens. We specifically address the question of whether root form can be used to distinguish between these groups and assess whether any variation in root form can be related to differences in tooth function. We apply a microtomographic imaging approach to visualise and quantify the external and internal dental morphologies of both isolated molars and molars embedded in the mandible (n=127). Univariate and multivariate analyses reveal both similarities (root length and pulp volume) and differences (occurrence of pyramidal roots and dental tissue volume proportion) in molar root morphology among penecontemporaneous Neanderthals and Aterian H. sapiens. In contrast, the molars of recent H. sapiens are markedly smaller than both Pleistocene H. sapiens and Neanderthals, but share with the former the dentine volume reduction and a smaller root-to-crown volume compared with Neanderthals. Furthermore, we found the first molar to have the largest average root surface area in recent H. sapiens and Neanderthals, although in the latter the difference between M(1) and M(2) is small. In contrast, Aterian H. sapiens root surface areas peak at M(2). Since root surface area is linked to masticatory function, this suggests a distinct occlusal loading regime in Neanderthals compared with both recent and Pleistocene H. sapiens. Copyright © 2010 Elsevier Ltd. All rights reserved.

Reflexões sobre a articulação entre o homo faber e o homo sapiens na enfermagem

Directory of Open Access Journals (Sweden)

Cecilia Nogueira Valenca

2013-09-01

Full Text Available Estudo reflexivo com o objetivo de analisar a articulação entre o enfermeiro-docente (Homo sapiens e o enfermeiro-assistencial (Homo faber no ambiente hospitalar, à luz do pensamento gramsciano. Na Enfermagem, coexistem duas dimensões: a teórica, exemplificada na figura do enfermeiro docente com seus projetos de pesquisa e publicações científicas; e a dimensão prática, com a atuação técnico-assistencial. Evidencia-se o distanciamento do enfermeiro docente em relação aos cenários de prática da graduação, assim como do enfermeiro assistencial, da pesquisa e da prática baseada em evidências científicas. Face ao dilema entre Homo faber e Homo sapiens na Enfermagem, emerge a importância de refletir sobre a dimensão ética subjacente às ações de ambos, centradas no ser humano. Este diálogo não pode ser ignorado, pois dele depende o desbravamento de novos horizontes e o crescimento da Enfermagem enquanto ciência e prática social.

Earliest evidence for the structure of Homo sapiens populations in Africa

Science.gov (United States)

Scerri, Eleanor M. L.; Drake, Nick A.; Jennings, Richard; Groucutt, Huw S.

2014-10-01

Understanding the structure and variation of Homo sapiens populations in Africa is critical for interpreting multiproxy evidence of their subsequent dispersals into Eurasia. However, there is no consensus on early H. sapiens demographic structure, or its effects on intra-African dispersals. Here, we show how a patchwork of ecological corridors and bottlenecks triggered a successive budding of populations across the Sahara. Using a temporally and spatially explicit palaeoenvironmental model, we found that the Sahara was not uniformly ameliorated between ∼130 and 75 thousand years ago (ka), as has been stated. Model integration with multivariate analyses of corresponding stone tools then revealed several spatially defined technological clusters which correlated with distinct palaeobiomes. Similarities between technological clusters were such that they decreased with distance except where connected by palaeohydrological networks. These results indicate that populations at the Eurasian gateway were strongly structured, which has implications for refining the demographic parameters of dispersals out of Africa.

New fossils from Jebel Irhoud, Morocco and the pan-African origin of Homo sapiens

OpenAIRE

Hublin, Jean-Jacques; Ben-Ncer, Abdelouahed; Bailey, Shara E.; Freidline, Sarah E.; Neubauer, Simon; Skinner, Matthew M.; Bergmann, Inga; Le Cabec, Adeline; Benazzi, Stefano; Harvati, Katerina; Gunz, Philipp

2017-01-01

Fossil evidence points to an African origin of Homo sapiens from a group called either H. heidelbergensis or H. rhodesiensis. However, the exact place and time of emergence of H. sapiens remain obscure because the fossil record is scarce and the chronological age of many key specimens remains uncertain. In particular, it is unclear whether the present day ‘modern’ morphology rapidly emerged approximately 200 thousand years ago (ka) among earlier representatives of H. sapiens1 or evolved gradu...

Crystal structure of Homo sapiens protein LOC79017

Energy Technology Data Exchange (ETDEWEB)

Bae, Euiyoung; Bingman, Craig A.; Aceti, David J.; Phillips, Jr., George N. (UW)

2010-02-08

LOC79017 (MW 21.0 kDa, residues 1-188) was annotated as a hypothetical protein encoded by Homo sapiens chromosome 7 open reading frame 24. It was selected as a target by the Center for Eukaryotic Structural Genomics (CESG) because it did not share more than 30% sequence identity with any protein for which the three-dimensional structure is known. The biological function of the protein has not been established yet. Parts of LOC79017 were identified as members of uncharacterized Pfam families (residues 1-95 as PB006073 and residues 104-180 as PB031696). BLAST searches revealed homologues of LOC79017 in many eukaryotes, but none of them have been functionally characterized. Here, we report the crystal structure of H. sapiens protein LOC79017 (UniGene code Hs.530024, UniProt code O75223, CESG target number go.35223).

Before the Emergence of Homo sapiens: Overview on the Early-to-Middle Pleistocene Fossil Record (with a Proposal about Homo heidelbergensis at the subspecific level)

Science.gov (United States)

Manzi, Giorgio

2011-01-01

The origin of H. sapiens has deep roots, which include two crucial nodes: (1) the emergence and diffusion of the last common ancestor of later Homo (in the Early Pleistocene) and (2) the tempo and mode of the appearance of distinct evolutionary lineages (in the Middle Pleistocene). The window between 1,000 and 500 thousand years before present appears of crucial importance, including the generation of a new and more encephalised kind of humanity, referred to by many authors as H. heidelbergensis. This species greatly diversified during the Middle Pleistocene up to the formation of new variants (i.e., incipient species) that, eventually, led to the allopatric speciation of H. neanderthalensis and H. sapiens. The special case furnished by the calvarium found near Ceprano (Italy), dated to 430–385 ka, offers the opportunity to investigate this matter from an original perspective. It is proposed to separate the hypodigm of a single, widespread, and polymorphic human taxon of the Middle Pleistocene into distinct subspecies (i.e., incipient species). The ancestral one should be H. heidelbergensis, including specimens such as Ceprano and the mandible from Mauer. PMID:21716742

Evolution of the Genus Homo

Science.gov (United States)

Tattersall, Ian; Schwartz, Jeffrey H.

2009-05-01

Definition of the genus Homo is almost as fraught as the definition of Homo sapiens. We look at the evidence for “early Homo,” finding little morphological basis for extending our genus to any of the 2.5-1.6-myr-old fossil forms assigned to “early Homo” or Homo habilis/rudolfensis. We also point to heterogeneity among “early African Homo erectus,” and the lack of apomorphies linking these fossils to the Asian Homo erectus group, a cohesive regional clade that shows some internal variation, including brain size increase over time. The first truly cosmopolitan Homo species is Homo heidelbergensis, known from Africa, Europe, and China following 600 kyr ago. One species sympatric with it included the >500-kyr-old Sima de los Huesos fossils from Spain, clearly distinct from Homo heidelbergensis and the oldest hominids assignable to the clade additionally containing Homo neanderthalensis. This clade also shows evidence of brain size expansion with time; but although Homo neanderthalensis had a large brain, it left no unequivocal evidence of the symbolic consciousness that makes our species unique. Homo sapiens clearly originated in Africa, where it existed as a physical entity before it began (also in that continent) to show the first stirrings of symbolism. Most likely, the biological underpinnings of symbolic consciousness were exaptively acquired in the radical developmental reorganization that gave rise to the highly characteristic osteological structure of Homo sapiens, but lay fallow for tens of thousands of years before being “discovered” by a cultural stimulus, plausibly the invention of language.

Homo sapiens zestárl o 100 tisíc let

Czech Academy of Sciences Publication Activity Database

Nývltová Fišáková, Miriam

2017-01-01

Roč. 1, č. 3 (2017), s. 12 ISSN 2533-784X Institutional support: RVO:68081758 Keywords : paleoanthropology * hominization * Homo sapiens * human fossils * archaeological dating Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.avcr.cz/opencms/export/sites/avcr.cz/.content/galerie-souboru/AB/A_03_2017_web.pdf

Fossil evidence for the origin of Homo sapiens.

Science.gov (United States)

Schwartz, Jeffrey H; Tattersall, Ian

2010-01-01

Our species Homo sapiens has never received a satisfactory morphological definition. Deriving partly from Linnaeus's exhortation simply to "know thyself," and partly from the insistence by advocates of the Evolutionary Synthesis in the mid-20th Century that species are constantly transforming ephemera that by definition cannot be pinned down by morphology, this unfortunate situation has led to huge uncertainty over which hominid fossils ought to be included in H. sapiens, and even over which of them should be qualified as "archaic" or as "anatomically modern," a debate that is an oddity in the broader context of paleontology. Here, we propose a suite of features that seems to characterize all H. sapiens alive today, and we review the fossil evidence in light of those features, paying particular attention to the bipartite brow and the "chin" as examples of how, given the continuum from developmentally regulated genes to adult morphology, we might consider features preserved in fossil specimens in a comparative analysis that includes extant taxa. We also suggest that this perspective on the origination of novelty, which has gained a substantial foothold in the general field of evolutionary developmental biology, has an intellectual place in paleoanthropology and hominid systematics, including in defining our species, H. sapiens. Beginning solely with the distinctive living species reveals a startling variety in morphologies among late middle and late Pleistocene hominids, none of which can be plausibly attributed to H. sapiens/H. neanderthalensis admixture. Allowing for a slightly greater envelope of variation than exists today, basic "modern" morphology seems to have appeared significantly earlier in time than the first stirrings of the modern symbolic cognitive system. Copyright © 2010 Wiley-Liss, Inc.

Life as a Cosmic Phenomenon: 2. the Panspermic Trajectory of Homo Sapiens

Science.gov (United States)

Tokoro, Gensuke; Wickramasinghe, N. Chandra

We discuss the origin and evolution of Homo sapiens in a cosmic context, and in relation to the Hoyle-Wickramasinghe theory of panspermia for which there is now overwhelming evidence. It is argued that the first bacteria (archea) incident on the Earth via the agency of comets 3.8-4 billion years ago continued at later times to be augmented by viral genes (DNA, RNA) from space that eventually led to the evolutionary patterns we see in present-day biology. We argue that the current evolutionary status of Homo sapiens as well as its future trajectory is circumscribed by evolutionary processes that were pre-determined on a cosmic scale -- over vast distances and enormous spans of cosmic time. Based on this teleological hypothesis we postulate that two distinct classes of cosmic viruses (cosmic viral genes) are involved in accounting for the facts relating to the evolution of life.

Sacral Variability in Tailless Species: Homo sapiens and Ochotona princeps.

Science.gov (United States)

Tague, Robert G

2017-05-01

Homo sapiens is variable in number of sacral vertebrae, and this variability can lead to obstetrical complication. This study uses the comparative method to test the hypothesis that sacral variability in H. sapiens is associated with absence of a tail. Three species of lagomorphs are studied: Ochotona princeps (N = 271), which is tailless, and Lepus californicus (N = 212) and Sylvilagus audubonii (N = 206), which have tails. Results show that O. princeps has (1) higher diversity index for number of sacral vertebrae (0.49) compared to L. californicus (0.25) and S. audubonii (0.26) and (2) significantly higher percentage of individuals with the species-specific nonmodal number of sacral vertebrae (43.9%) compared to L. californicus (14.2%) and S. audubonii (15.5%). Comparison of H. sapiens (N = 1,030; individuals of age 20-39 years) with O. princeps shows similarities between the species in diversity index (also 0.49 in H. sapiens) and percentage of individuals with nonmodal number of sacral vertebrae (37.3% in H. sapiens). Homeotic transformation best explains the results. H. sapiens and O. princeps show propensity for caudal shift at the sacral-caudal border (i.e., homeotic transformation of the first caudal vertebra to a sacral vertebra). Caudal and cranial shift among presacral vertebrae increases or decreases this propensity, respectively. Increase in number of sacral vertebrae in H. sapiens by homeotic transformation reduces pelvic outlet capacity and can be obstetrically hazardous. Anat Rec, 300:798-809, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

LB1 and LB6 Homo floresiensis are not modern human (Homo sapiens) cretins.

Science.gov (United States)

Brown, Peter

2012-02-01

Excavations in the late Pleistocene deposits at Liang Bua cave, Flores, have uncovered the skeletal remains of several small-bodied and small-brained hominins in association with stone artefacts and the bones of Stegodon. Due to their combination of plesiomorphic, unique and derived traits, they were ascribed to a new species, Homo floresiensis, which, along with Stegodon, appears to have become extinct ∼17 ka (thousand years ago). However, recently it has been argued that several characteristics of H. floresiensis were consistent with dwarfism and evidence of delayed development in modern human (Homo sapiens) myxoedematous endemic (ME) cretins. This research compares the skeletal and dental morphology in H. floresiensis with the clinical and osteological indicators of cretinism, and the traits that have been argued to be associated with ME cretinism in LB1 and LB6. Contrary to published claims, morphological and statistical comparisons did not identify the distinctive skeletal and dental indicators of cretinism in LB1 or LB6 H. floresiensis. Brain mass, skeletal proportions, epiphyseal union, orofacial morphology, dental development, size of the pituitary fossa and development of the paranasal sinuses, vault bone thickness and dimensions of the hands and feet all distinguish H. floresiensis from modern humans with ME cretinism. The research team responsible for the diagnosis of ME cretinism had not examined the original H. floresiensis skeletal materials, and perhaps, as a result, their research confused taphonomic damage with evidence of disease, and thus contained critical errors of fact and interpretation. Behavioural scenarios attempting to explain the presence of cretinous H. sapiens in the Liang Bua Pleistocene deposits, but not unaffected H. sapiens, are both unnecessary and not supported by the available archaeological and geochronological evidence from Flores. Crown Copyright © 2011. Published by Elsevier Ltd. All rights reserved.

Structural and molecular study of the supraspinatus muscle of modern humans (Homo sapiens) and common chimpanzees (Pan troglodytes).

Science.gov (United States)

Potau, J M; Casado, A; de Diego, M; Ciurana, N; Arias-Martorell, J; Bello-Hellegouarch, G; Barbosa, M; de Paz, F J; Pastor, J F; Pérez-Pérez, A

2018-04-21

To analyze the muscle architecture and the expression pattern of the myosin heavy chain (MyHC) isoforms in the supraspinatus of Pan troglodytes and Homo sapiens in order to identify differences related to their different types of locomotion. We have analyzed nine supraspinatus muscles of Pan troglodytes and ten of Homo sapiens. For each sample, we have recorded the muscle fascicle length (MFL), the pennation angle, and the physiological cross-sectional area (PCSA). In the same samples, by real-time quantitative polymerase chain reaction, we have assessed the percentages of expression of the MyHC-I, MyHC-IIa, and MyHC-IIx isoforms. The mean MFL of the supraspinatus was longer (p = 0.001) and the PCSA was lower (p sapiens than in Pan troglodytes. Although the percentage of expression of MyHC-IIa was lower in Homo sapiens than in Pan troglodytes (p = 0.035), the combination of MyHC-IIa and MyHC-IIx was expressed at a similar percentage in the two species. The longer MFL in the human supraspinatus is associated with a faster contractile velocity, which reflects the primary function of the upper limbs in Homo sapiens-the precise manipulation of objects-an adaptation to bipedal locomotion. In contrast, the larger PCSA in Pan troglodytes is related to the important role of the supraspinatus in stabilizing the glenohumeral joint during the support phase of knuckle-walking. These functional differences of the supraspinatus in the two species are not reflected in differences in the expression of the MyHC isoforms. © 2018 Wiley Periodicals, Inc.

Self-domestication in Homo sapiens: Insights from comparative genomics.

Science.gov (United States)

Theofanopoulou, Constantina; Gastaldon, Simone; O'Rourke, Thomas; Samuels, Bridget D; Messner, Angela; Martins, Pedro Tiago; Delogu, Francesco; Alamri, Saleh; Boeckx, Cedric

2017-01-01

This study identifies and analyzes statistically significant overlaps between selective sweep screens in anatomically modern humans and several domesticated species. The results obtained suggest that (paleo-)genomic data can be exploited to complement the fossil record and support the idea of self-domestication in Homo sapiens, a process that likely intensified as our species populated its niche. Our analysis lends support to attempts to capture the "domestication syndrome" in terms of alterations to certain signaling pathways and cell lineages, such as the neural crest.

The success of failed Homo sapiens dispersals out of Africa and into Asia.

Science.gov (United States)

Rabett, Ryan J

2018-02-01

The evidence for an early dispersal of Homo sapiens from Africa into the Levant during Marine Isotope Stage 5 (MIS-5) 126-74 ka (thousand years ago) was characterized for many years as an 'abortive' expansion: a precursor to a sustained dispersal from which all extant human populations can be traced. Recent archaeological and genetic data from both western and eastern parts of Eurasia and from Australia are starting to challenge that interpretation. This Perspective reviews the current evidence for a scenario where the MIS-5 dispersal encompassed a much greater geographic distribution and temporal duration. The implications of this for tracking and understanding early human dispersal in Southeast Asia specifically are considered, and the validity of measuring dispersal success only through genetic continuity into the present is examined.

L'evolució del cervell humà: des d'Homo erectus a Homo sapiens

OpenAIRE

Coma Almenar, Herena

2017-01-01

Homo sapiens presenta unes característiques morfològiques cerebrals que han possibilitat les capacitats cognitives que podem observar actualment. Però no ha estat a causa d'un fet puntual en la nostra historia evolutiva, sinó que anys de canvis en la dotació genètica i l'adaptació a l'entorn ha procurat el nostre augment del volum encefàlic i de la seva reorganització i connectivitat, on la asimetria cerebral ha estat l'estratègia per optimitzar els recursos neuronals. No obstant, en el regis...

The mitogenome of a 35,000-year-old Homo sapiens from Europe supports a Palaeolithic back-migration to Africa

OpenAIRE

Hervella, M.; Svensson, E. M.; Alberdi, A.; G?nther, T.; Izagirre, N.; Munters, A. R.; Alonso, S.; Ioana, M.; Ridiche, F.; Soficaru, A.; Jakobsson, M.; Netea, M. G.; de-la-Rua, C.

2016-01-01

After the dispersal of modern humans (Homo sapiens) Out of Africa, hominins with a similar morphology to that of present-day humans initiated the gradual demographic expansion into Eurasia. The mitogenome (33-fold coverage) of the Pestera Muierii 1 individual (PM1) from Romania (35 ky cal BP) we present in this article corresponds fully to Homo sapiens, whilst exhibiting a mosaic of morphological features related to both modern humans and Neandertals. We have identified the PM1 mitogenome as ...

Prediction of host - pathogen protein interactions between Mycobacterium tuberculosis and Homo sapiens using sequence motifs.

Science.gov (United States)

Huo, Tong; Liu, Wei; Guo, Yu; Yang, Cheng; Lin, Jianping; Rao, Zihe

2015-03-26

Emergence of multiple drug resistant strains of M. tuberculosis (MDR-TB) threatens to derail global efforts aimed at reigning in the pathogen. Co-infections of M. tuberculosis with HIV are difficult to treat. To counter these new challenges, it is essential to study the interactions between M. tuberculosis and the host to learn how these bacteria cause disease. We report a systematic flow to predict the host pathogen interactions (HPIs) between M. tuberculosis and Homo sapiens based on sequence motifs. First, protein sequences were used as initial input for identifying the HPIs by 'interolog' method. HPIs were further filtered by prediction of domain-domain interactions (DDIs). Functional annotations of protein and publicly available experimental results were applied to filter the remaining HPIs. Using such a strategy, 118 pairs of HPIs were identified, which involve 43 proteins from M. tuberculosis and 48 proteins from Homo sapiens. A biological interaction network between M. tuberculosis and Homo sapiens was then constructed using the predicted inter- and intra-species interactions based on the 118 pairs of HPIs. Finally, a web accessible database named PATH (Protein interactions of M. tuberculosis and Human) was constructed to store these predicted interactions and proteins. This interaction network will facilitate the research on host-pathogen protein-protein interactions, and may throw light on how M. tuberculosis interacts with its host.

Inter- and Intraspecific Variations in the Pectoral Muscles of Common Chimpanzees (Pan troglodytes), Bonobos (Pan paniscus), and Humans (Homo sapiens)

OpenAIRE

Potau, J. M.; Arias-Martorell, J.; Bello-Hellegouarch, G.; Casado, A.; Pastor, J. F.; de Paz, F.; Diogo, R.

2018-01-01

We have analyzed anatomic variations in the pectoralis major and pectoralis minor muscles of common chimpanzees (Pan\\ud troglodytes) and bonobos(Pan paniscus) and compared them to anatomic variations in these muscles in humans(Homo sapiens). We\\ud have macroscopically dissected these muscles in six adult Pan troglodytes, five Pan paniscus of ages ranging from fetus to adult, and\\ud five adult Homo sapiens. Although Pan troglodytes are thought to lack a separate pectoralis abdominis muscle, we...

Human evolution. Evolution of early Homo: an integrated biological perspective.

Science.gov (United States)

Antón, Susan C; Potts, Richard; Aiello, Leslie C

2014-07-04

Integration of evidence over the past decade has revised understandings about the major adaptations underlying the origin and early evolution of the genus Homo. Many features associated with Homo sapiens, including our large linear bodies, elongated hind limbs, large energy-expensive brains, reduced sexual dimorphism, increased carnivory, and unique life history traits, were once thought to have evolved near the origin of the genus in response to heightened aridity and open habitats in Africa. However, recent analyses of fossil, archaeological, and environmental data indicate that such traits did not arise as a single package. Instead, some arose substantially earlier and some later than previously thought. From ~2.5 to 1.5 million years ago, three lineages of early Homo evolved in a context of habitat instability and fragmentation on seasonal, intergenerational, and evolutionary time scales. These contexts gave a selective advantage to traits, such as dietary flexibility and larger body size, that facilitated survival in shifting environments. Copyright © 2014, American Association for the Advancement of Science.

Homo sapiens as physician and patient: a view from Darwinian medicine.

Science.gov (United States)

Román-Franco, Angel A

2013-09-01

Medicine's cardinal diagnostic and therapeutic resource is the clinical encounter. Over the last two centuries and particularly over the last five decades the function of the clinical encounter has been eroded to the point of near irrelevance because of the atomized and atomizing influence of technology and microspecialization. Meanwhile, over the past five decades the exceptionalist view of Homo sapiens inherent in the social and religious traditions of the West has similarly undergone radical changes. H. sapiens is now best understood as a microecosystem integrated into a much broader ecosystem: the biosphere. That human microecosystem is composed of constituents derived from the archaeal, bacterial, and eukaryan domains via endosymbiotic, commensalistic and mutualistic interactions. This amalgamation of 100 trillion cells and viral elements is regulated by a composite genome aggregated over the 3.8 billion years of evolutionary history of organic life. No component of H. sapiens or its genome can be identified as irreducibly and exclusively human. H. sapiens' humanity is an emergent property of the microecosystem. Ironically as H. sapiens is viewed by evolutionary science in a highly integrated manner medicine approaches it as a balkanized, deaggregated entity through the eye of 150 different specialties. To effectively address the needs of H sapiens in its role as patient by the same species in its role as physician the disparate views must be harmonized. Here I review some conceptual elements that would assist a physician in addressing the needs of the patient in integrum, as a microecosystem, by the former address the latter as a historical gestalt being. The optimal way to recover the harmony between patient and physician is through a revitalization of the clinical encounter via an ecological and Darwinian epistemology.

Is Homo sapiens polytypic? Human taxonomic diversity and its implications.

Science.gov (United States)

Woodley, Michael A

2010-01-01

The term race is a traditional synonym for subspecies, however it is frequently asserted that Homo sapiens is monotypic and that what are termed races are nothing more than biological illusions. In this manuscript a case is made for the hypothesis that H. sapiens is polytypic, and in this way is no different from other species exhibiting similar levels of genetic and morphological diversity. First it is demonstrated that the four major definitions of race/subspecies can be shown to be synonymous within the context of the framework of race as a correlation structure of traits. Next the issue of taxonomic classification is considered where it is demonstrated that H. sapiens possesses high levels morphological diversity, genetic heterozygosity and differentiation (F(ST)) compared to many species that are acknowledged to be polytypic with respect to subspecies. Racial variation is then evaluated in light of the phylogenetic species concept, where it is suggested that the least inclusive monophyletic units exist below the level of species within H. sapiens indicating the existence of a number of potential human phylogenetic species; and the biological species concept, where it is determined that racial variation is too small to represent differentiation at the level of biological species. Finally the implications of this are discussed in the context of anthropology where an accurate picture of the sequence and timing of events during the evolution of human taxa are required for a complete picture of human evolution, and medicine, where a greater appreciation of the role played by human taxonomic differences in disease susceptibility and treatment responsiveness will save lives in the future.

Inter- and Intraspecific Variations in the Pectoral Muscles of Common Chimpanzees (Pan troglodytes), Bonobos (Pan paniscus), and Humans (Homo sapiens).

Science.gov (United States)

Potau, J M; Arias-Martorell, J; Bello-Hellegouarch, G; Casado, A; Pastor, J F; de Paz, F; Diogo, R

2018-01-01

We have analyzed anatomic variations in the pectoralis major and pectoralis minor muscles of common chimpanzees (Pan troglodytes) and bonobos (Pan paniscus) and compared them to anatomic variations in these muscles in humans (Homo sapiens) . We have macroscopically dissected these muscles in six adult Pan troglodytes , five Pan paniscus of ages ranging from fetus to adult, and five adult Homo sapiens . Although Pan troglodytes are thought to lack a separate pectoralis abdominis muscle, we have identified this muscle in three of the Pan troglodytes ; none of the Pan paniscus , however, had this muscle. We have also found deep supernumerary fascicles in the pectoralis major of two Pan troglodytes and all five Pan paniscus . In all six Pan troglodytes , the pectoralis minor was inserted at the supraspinatus tendon, while, in Pan paniscus and Homo sapiens , it was inserted at the coracoid process of the scapula. Some of the anatomic features and variations of these muscles in common chimpanzees and bonobos are similar to those found in humans, therefore enhancing our knowledge of primate comparative anatomy and evolution and also shedding light on several clinical issues.

Inter- and Intraspecific Variations in the Pectoral Muscles of Common Chimpanzees (Pan troglodytes, Bonobos (Pan paniscus, and Humans (Homo sapiens

Directory of Open Access Journals (Sweden)

J. M. Potau

2018-01-01

Full Text Available We have analyzed anatomic variations in the pectoralis major and pectoralis minor muscles of common chimpanzees (Pan troglodytes and bonobos (Pan paniscus and compared them to anatomic variations in these muscles in humans (Homo sapiens. We have macroscopically dissected these muscles in six adult Pan troglodytes, five Pan paniscus of ages ranging from fetus to adult, and five adult Homo sapiens. Although Pan troglodytes are thought to lack a separate pectoralis abdominis muscle, we have identified this muscle in three of the Pan troglodytes; none of the Pan paniscus, however, had this muscle. We have also found deep supernumerary fascicles in the pectoralis major of two Pan troglodytes and all five Pan paniscus. In all six Pan troglodytes, the pectoralis minor was inserted at the supraspinatus tendon, while, in Pan paniscus and Homo sapiens, it was inserted at the coracoid process of the scapula. Some of the anatomic features and variations of these muscles in common chimpanzees and bonobos are similar to those found in humans, therefore enhancing our knowledge of primate comparative anatomy and evolution and also shedding light on several clinical issues.

The Homo sapiens 'hemibun': its developmental pattern and the problem of homology.

Science.gov (United States)

Nowaczewska, W; Kuźmiński, L

2009-01-01

The occipital bun is widely considered a Neanderthal feature. Its homology to the 'hemibun' observed in some European Upper Palaeolithic anatomically modern humans is a current problem. This study quantitatively evaluates the degree of occipital plane convexity in African and Australian modern human crania to analyse a relationship between this feature and some neurocranial variables. Neanderthal and European Upper Palaeolithic Homo sapiens crania were included in the analysis as well. The results of this study indicated that there is a significant relationship between the degree of occipital plane convexity and the following two features in the examined crania of modern humans: the ratio of the maximum neurocranial height to the maximum width of the vault and the ratio of bregma-lambda chord to bregma-lambda arc. The results also revealed that some H. sapiens crania (modern and fossil) show the Neanderthal shape of the occipital plane and that the neurocranial height and shape of parietal midsagittal profile has an influence on occipital plane convexity in the hominins included in this study. This study suggests that the occurrence of the great convexity of the occipital plane in the Neanderthals and H. sapiens is a "by-product" of the relationship between the same neurocranial features and there is no convincing evidence that the Neanderthal occipital bun and the similar structure in H. sapiens develop during ontogeny in the same way.

Identification of the ancestral haplotype for apolipoprotein B suggests an African origin of Homo sapiens sapiens and traces their subsequent migration to Europe and the Pacific

Energy Technology Data Exchange (ETDEWEB)

Rapacz, J.; Hasler-Rapacz, J.O. (Univ. of Wisconsin, Madison (United States)); Chen, L.; Wu, Mingjiuan; Schumaker, V.N. (Univ. of California, Los Angeles (United States)); Butler-Brunner, E.; Butler, R. (Swiss Red Cross Blood Transfusion Service, Bern (Switzerland))

1991-02-15

The probable ancestral haplotype for human apolipoprotein B (apoB) has been identified through immunological analysis of chimpanzee and gorilla serum and sequence analysis of their DNA. Moreover, the frequency of this ancestral apoB haplotype among different human populations provides strong support for the African origin of Homo sapiens sapiens and their subsequent migration from Africa to Europe and to the Pacific. The approach used here for the identification of the ancestral human apoB haplotype is likely to be applicable to many other genes.

Identification of the ancestral haplotype for apolipoprotein B suggests an African origin of Homo sapiens sapiens and traces their subsequent migration to Europe and the Pacific

International Nuclear Information System (INIS)

Rapacz, J.; Hasler-Rapacz, J.O.; Chen, L.; Wu, Mingjiuan; Schumaker, V.N.; Butler-Brunner, E.; Butler, R.

1991-01-01

The probable ancestral haplotype for human apolipoprotein B (apoB) has been identified through immunological analysis of chimpanzee and gorilla serum and sequence analysis of their DNA. Moreover, the frequency of this ancestral apoB haplotype among different human populations provides strong support for the African origin of Homo sapiens sapiens and their subsequent migration from Africa to Europe and to the Pacific. The approach used here for the identification of the ancestral human apoB haplotype is likely to be applicable to many other genes

Cold Spring Harbor symposia on quantitative biology: Volume 51, Molecular biology of /ital Homo sapiens/

International Nuclear Information System (INIS)

1986-01-01

This volume is the second part of a collection of papers submitted by the participants to the 1986 Cold Spring Harbor Symposium on Quantitative Biology entitled Molecular Biology of /ital Homo sapiens/. The 49 papers included in this volume are grouped by subject into receptors, human cancer genes, and gene therapy. (DT)

The mitogenome of a 35,000-year-old Homo sapiens from Europe supports a Palaeolithic back-migration to Africa.

Science.gov (United States)

Hervella, M; Svensson, E M; Alberdi, A; Günther, T; Izagirre, N; Munters, A R; Alonso, S; Ioana, M; Ridiche, F; Soficaru, A; Jakobsson, M; Netea, M G; de-la-Rua, C

2016-05-19

After the dispersal of modern humans (Homo sapiens) Out of Africa, hominins with a similar morphology to that of present-day humans initiated the gradual demographic expansion into Eurasia. The mitogenome (33-fold coverage) of the Peştera Muierii 1 individual (PM1) from Romania (35 ky cal BP) we present in this article corresponds fully to Homo sapiens, whilst exhibiting a mosaic of morphological features related to both modern humans and Neandertals. We have identified the PM1 mitogenome as a basal haplogroup U6*, not previously found in any ancient or present-day humans. The derived U6 haplotypes are predominantly found in present-day North-Western African populations. Concomitantly, those found in Europe have been attributed to recent gene-flow from North Africa. The presence of the basal haplogroup U6* in South East Europe (Romania) at 35 ky BP confirms a Eurasian origin of the U6 mitochondrial lineage. Consequently, we propose that the PM1 lineage is an offshoot to South East Europe that can be traced to the Early Upper Paleolithic back migration from Western Asia to North Africa, during which the U6 lineage diversified, until the emergence of the present-day U6 African lineages.

Similarity analysis between chromosomes of Homo sapiens and monkeys with correlation coefficient, rank correlation coefficient and cosine similarity measures.

Science.gov (United States)

Someswara Rao, Chinta; Viswanadha Raju, S

2016-03-01

In this paper, we consider correlation coefficient, rank correlation coefficient and cosine similarity measures for evaluating similarity between Homo sapiens and monkeys. We used DNA chromosomes of genome wide genes to determine the correlation between the chromosomal content and evolutionary relationship. The similarity among the H. sapiens and monkeys is measured for a total of 210 chromosomes related to 10 species. The similarity measures of these different species show the relationship between the H. sapiens and monkey. This similarity will be helpful at theft identification, maternity identification, disease identification, etc.

Emergence of a Homo sapiens-specific gene family and chromosome 16p11.2 CNV susceptibility.

Science.gov (United States)

Nuttle, Xander; Giannuzzi, Giuliana; Duyzend, Michael H; Schraiber, Joshua G; Narvaiza, Iñigo; Sudmant, Peter H; Penn, Osnat; Chiatante, Giorgia; Malig, Maika; Huddleston, John; Benner, Chris; Camponeschi, Francesca; Ciofi-Baffoni, Simone; Stessman, Holly A F; Marchetto, Maria C N; Denman, Laura; Harshman, Lana; Baker, Carl; Raja, Archana; Penewit, Kelsi; Janke, Nicolette; Tang, W Joyce; Ventura, Mario; Banci, Lucia; Antonacci, Francesca; Akey, Joshua M; Amemiya, Chris T; Gage, Fred H; Reymond, Alexandre; Eichler, Evan E

2016-08-11

Genetic differences that specify unique aspects of human evolution have typically been identified by comparative analyses between the genomes of humans and closely related primates, including more recently the genomes of archaic hominins. Not all regions of the genome, however, are equally amenable to such study. Recurrent copy number variation (CNV) at chromosome 16p11.2 accounts for approximately 1% of cases of autism and is mediated by a complex set of segmental duplications, many of which arose recently during human evolution. Here we reconstruct the evolutionary history of the locus and identify bolA family member 2 (BOLA2) as a gene duplicated exclusively in Homo sapiens. We estimate that a 95-kilobase-pair segment containing BOLA2 duplicated across the critical region approximately 282 thousand years ago (ka), one of the latest among a series of genomic changes that dramatically restructured the locus during hominid evolution. All humans examined carried one or more copies of the duplication, which nearly fixed early in the human lineage--a pattern unlikely to have arisen so rapidly in the absence of selection (P sapiens-specific duplication. In summary, the duplicative transposition of BOLA2 at the root of the H. sapiens lineage about 282 ka simultaneously increased copy number of a gene associated with iron homeostasis and predisposed our species to recurrent rearrangements associated with disease.

Similarity analysis between chromosomes of Homo sapiens and monkeys with correlation coefficient, rank correlation coefficient and cosine similarity measures

OpenAIRE

Someswara Rao, Chinta; Viswanadha Raju, S.

2016-01-01

In this paper, we consider correlation coefficient, rank correlation coefficient and cosine similarity measures for evaluating similarity between Homo sapiens and monkeys. We used DNA chromosomes of genome wide genes to determine the correlation between the chromosomal content and evolutionary relationship. The similarity among the H. sapiens and monkeys is measured for a total of 210 chromosomes related to 10 species. The similarity measures of these different species show the relationship b...

Evaluating the transitional mosaic: frameworks of change from Neanderthals to Homo sapiens in eastern Europe

Science.gov (United States)

Davies, William; White, Dustin; Lewis, Mark; Stringer, Chris

2015-06-01

Defining varying spatial and temporal analytical scales is essential before evaluating the responses of late Neanderthals and early Homo sapiens to Abrupt Environmental Transitions (AETs) and environmental disasters for the period 130-25 ka. Recent advances in addressing the population histories and interactions (using both genetic and archaeological evidence) of Neanderthals and H. sapiens have encouraged consideration of more subtle dynamics of archaeological change. Descriptions of change based on methodologies pioneered some 160 years ago are no longer adequate to explain the patterning we now see in the record. New chronological results, using multiple dating methods, allow us to begin to unpick the spatial and temporal scales of change. Isochronic markers (such as specific volcanic eruptions) can be used to create temporal frameworks (lattices), and results from other dating techniques compared against them. A combination of chronological lattices and direct dating of diagnostic artefacts and human fossils permits us, for the first time, to have greater confidence in connecting human (recent hominin) species and their behavioural responses to environmental conditions, and in quantifying scales of change over time and space (time-transgression). The timing of innovations, particularly those in bone, antler and ivory, can be directly quantified and tested, and used to re-evaluate longstanding models of cultural change. This paper also uses these new chronologies to explore the ecologies of late Neanderthals and early H. sapiens: their population densities, mobilities, resources exploited and possible interactions. Environmental productivity estimates are used to generate new questions of potential population densities and mobilities, and thus the sensitivity of these groups to environmental perturbations. Scales and intensities of effect on environments from natural disasters and AETs (notably Heinrich Events and the Campanian Ignimbrite eruption) are defined

Data of 10 SSR markers for genomes of homo sapiens and monkeys.

Science.gov (United States)

Reddy, K K V V V S; Raju, S Viswanadha; Someswara Rao, Chinta

2017-06-01

In this data, we present 10 Simple Sequence Repeat(SSR) markers TAGA, TCAT, GAAT, AGAT, AGAA, GATA, TATC, CTTT, TCTG and TCTA which are extracted from the genomes of homo sapiens and monkeys using string matching mechanism [1]. All loci showed 4 Base Pair(bp) in allele size, indicating that there are some polymorphisms between individuals correlating to the number of SSR repeats that maybe useful for the detection of similarity among the genotypes. Collectively, these data show that the SSR extraction is a valuable method to illustrate genetic variation of genomes.

The affinities of Homo floresiensis based on phylogenetic analyses of cranial, dental, and postcranial characters.

Science.gov (United States)

Argue, Debbie; Groves, Colin P; Lee, Michael S Y; Jungers, William L

2017-06-01

Although the diminutive Homo floresiensis has been known for a decade, its phylogenetic status remains highly contentious. A broad range of potential explanations for the evolution of this species has been explored. One view is that H. floresiensis is derived from Asian Homo erectus that arrived on Flores and subsequently evolved a smaller body size, perhaps to survive the constrained resources they faced in a new island environment. Fossil remains of H. erectus, well known from Java, have not yet been discovered on Flores. The second hypothesis is that H. floresiensis is directly descended from an early Homo lineage with roots in Africa, such as Homo habilis; the third is that it is Homo sapiens with pathology. We use parsimony and Bayesian phylogenetic methods to test these hypotheses. Our phylogenetic data build upon those characters previously presented in support of these hypotheses by broadening the range of traits to include the crania, mandibles, dentition, and postcrania of Homo and Australopithecus. The new data and analyses support the hypothesis that H. floresiensis is an early Homo lineage: H. floresiensis is sister either to H. habilis alone or to a clade consisting of at least H. habilis, H. erectus, Homo ergaster, and H. sapiens. A close phylogenetic relationship between H. floresiensis and H. erectus or H. sapiens can be rejected; furthermore, most of the traits separating H. floresiensis from H. sapiens are not readily attributable to pathology (e.g., Down syndrome). The results suggest H. floresiensis is a long-surviving relict of an early (>1.75 Ma) hominin lineage and a hitherto unknown migration out of Africa, and not a recent derivative of either H. erectus or H. sapiens. Copyright © 2017 Elsevier Ltd. All rights reserved.

Pygmoid Australomelanesian Homo sapiens skeletal remains from Liang Bua, Flores: population affinities and pathological abnormalities.

Science.gov (United States)

Jacob, T; Indriati, E; Soejono, R P; Hsü, K; Frayer, D W; Eckhardt, R B; Kuperavage, A J; Thorne, A; Henneberg, M

2006-09-05

Liang Bua 1 (LB1) exhibits marked craniofacial and postcranial asymmetries and other indicators of abnormal growth and development. Anomalies aside, 140 cranial features place LB1 within modern human ranges of variation, resembling Australomelanesian populations. Mandibular and dental features of LB1 and LB6/1 either show no substantial deviation from modern Homo sapiens or share features (receding chins and rotated premolars) with Rampasasa pygmies now living near Liang Bua Cave. We propose that LB1 is drawn from an earlier pygmy H. sapiens population but individually shows signs of a developmental abnormality, including microcephaly. Additional mandibular and postcranial remains from the site share small body size but not microcephaly.

Dating Of Remains Of Neanderthals And Homo Sapiens From Anatolian Region By ESR-US Combined Methods Preliminary Results

Directory of Open Access Journals (Sweden)

Samer Farkh

2015-08-01

Full Text Available We tried in the present study to apply the electron spin resonance method ESR combined with uranium-series method US for dating fossilized human teeth and found valuable archaeological sites such as Karain Cave in Anatolia. Karain Cave is a crucial site in a region that has yielded remains of Neanderthals and Homo sapiens our direct ancestors. The dating of these remains allowed us to trace the history since the presence of man on earth. Indeed Anatolia in Turkey is an important region of the world because it represents a passage between Africa the Middle East and Europe. Our study was conducted on faunal teeth found near human remains. The combination of ESR and US data on the teeth provides an understanding of their complex geochemical evolution and get better estimated results. Our samples were taken from the central cutting where geological layers are divided into archaeological horizons each 10 cm. The AH4 horizon of I.3 layer which represents the boundary between the Middle Paleolithic and Upper Paleolithic is dated to 29 4 ka by the ESR-US model. Below two horizons AH6 and AH8 in the same layer I.4 are dated respectively 40 6 and 45 7 ka using the ESR-US model. In layer II where a stalagmite floor was taken we made two U-Th dating at the base and on the top ages oscillated around 120 ka. Since human remains were collected from AH3 horizon for Homo sapiens and AH5 and AH7 horizons for the Neanderthal man so the dates obtained in AH4 AH6 and AH8 represent maximum ages. Thus they provide the disappearance of Neanderthal man between 45 and 40 ka and the appearance of Homo sapiens in 29 ka in Anatolia region. Undoubtedly there is a chronological gap between the Middle and Upper Paleolithic represented by the disappearance of Neanderthals and the appearance of sapiens and none of our results confirm the contemporaneity of these two species in this region.

The Centre for Early Human Behaviour (EHB) at the University of Bergen: A transdisciplinary exploration into the evolution of homo sapiens behaviour

Science.gov (United States)

Sobolowski, Stefan; Henshilwood, Christopher; Jansen, Eystein

2017-04-01

Homo sapiens was anatomically modern by 200 000 years ago in Africa, but there is no archaeological evidence to demonstrate that behaviour was modern at the time. Attributes of modern behaviour, perhaps inspired by changes in the human brain, are only recognizable after 100 000 years ago. Before we can study the process, we must critically define the criteria for the term 'modern behaviour' and then find a means to recognize such behavior in the record. This seemingly simple research statement involves complex exploration by a team of specialists. In this highly competitive research field our centre will, for the first time, be able to rise to the challenge by combining the skills of cutting-edge scientists in archaeology, climate reconstruction and modelling, and the cognitive and social sciences. Over the next decade we will integrate knowledge and methods from different disciplines to synthesize approaches and contribute to a sophisticated understanding of early human behaviour. Our highly ambitious research program will focus explicitly on rare, well preserved archaeological sites occupied in the period between 100-50 000 years ago because these contain the 'keys' for unlocking the past. A major competitive edge is the EHB Director's 25 years of archaeological experience and his long-term exclusive access, with permits, to a number of the best-preserved sites in the southern Cape, South Africa - a region regarded as a major locus for vital evidence that could inform on the behaviour of early humans. Our planned excavations at existing and new sites and our ground-breaking and innovative interdisciplinary approaches, including climate (The Bjerknes Centre for Climate Research) and cognitive research, to understanding the processes that shaped human cultures. Primarily, EHB will directly address unanswered, first order questions about Homo sapiens: a) what defines the switch to 'modern behaviour', exactly how should this term be defined and then, when, why and

Pygmoid Australomelanesian Homo sapiens skeletal remains from Liang Bua, Flores: Population affinities and pathological abnormalities

OpenAIRE

Jacob, T.; Indriati, E.; Soejono, R. P.; Hsü, K.; Frayer, D. W.; Eckhardt, R. B.; Kuperavage, A. J.; Thorne, A.; Henneberg, M.

2006-01-01

Liang Bua 1 (LB1) exhibits marked craniofacial and postcranial asymmetries and other indicators of abnormal growth and development. Anomalies aside, 140 cranial features place LB1 within modern human ranges of variation, resembling Australomelanesian populations. Mandibular and dental features of LB1 and LB6/1 either show no substantial deviation from modern Homo sapiens or share features (receding chins and rotated premolars) with Rampasasa pygmies now living near Liang Bua Cave. We propose ...

The mitogenome of a 35,000-year-old Homo sapiens from Europe supports a Palaeolithic back-migration to Africa

NARCIS (Netherlands)

Hervella, M.; Svensson, E.M.; Alberdi, A.; Gunther, T.; Izagirre, N.; Munters, A.R.; Alonso, S.; Ioana, M.; Ridiche, F.; Soficaru, A.; Jakobsson, M.; Netea, M.G.; Rua, C. de la

2016-01-01

After the dispersal of modern humans (Homo sapiens) Out of Africa, hominins with a similar morphology to that of present-day humans initiated the gradual demographic expansion into Eurasia. The mitogenome (33-fold coverage) of the Pestera Muierii 1 individual (PM1) from Romania (35 ky cal BP) we

Forearm articular proportions and the antebrachial index in Homo sapiens, Australopithecus afarensis and the great apes.

Science.gov (United States)

Williams, Frank L'Engle; Cunningham, Deborah L; Amaral, Lia Q

2015-12-01

When hominin bipedality evolved, the forearms were free to adopt nonlocomotor tasks which may have resulted in changes to the articular surfaces of the ulna and the relative lengths of the forearm bones. Similarly, sex differences in forearm proportions may be more likely to emerge in bipeds than in the great apes given the locomotor constraints in Gorilla, Pan and Pongo. To test these assumptions, ulnar articular proportions and the antebrachial index (radius length/ulna length) in Homo sapiens (n=51), Gorilla gorilla (n=88), Pan troglodytes (n=49), Pongo pygmaeus (n=36) and Australopithecus afarensis A.L. 288-1 and A.L. 438-1 are compared. Intercept-adjusted ratios are used to control for size and minimize the effects of allometry. Canonical scores axes show that the proximally broad and elongated trochlear notch with respect to size in H. sapiens and A. afarensis is largely distinct from G. gorilla, P. troglodytes and P. pygmaeus. A cluster analysis of scaled ulnar articular dimensions groups H. sapiens males with A.L. 438-1 ulna length estimates, while one A.L. 288-1 ulna length estimate groups with Pan and another clusters most closely with H. sapiens, G. gorilla and A.L. 438-1. The relatively low antebrachial index characterizing H. sapiens and non-outlier estimates of A.L. 288-1 and A.L. 438-1 differs from those of the great apes. Unique sex differences in H. sapiens suggest a link between bipedality and forearm functional morphology. Copyright © 2015 Elsevier GmbH. All rights reserved.

The Arrival of Homo sapiens into the Southern Cone at 14,000 Years Ago.

Science.gov (United States)

Politis, Gustavo G; Gutiérrez, María A; Rafuse, Daniel J; Blasi, Adriana

The Arroyo Seco 2 site contains a rich archaeological record, exceptional for South America, to explain the expansion of Homo sapiens into the Americas and their interaction with extinct Pleistocene mammals. The following paper provides a detailed overview of material remains found in the earliest cultural episodes at this multi-component site, dated between ca. 12,170 14C yrs B.P. (ca. 14,064 cal yrs B.P.) and 11,180 14C yrs B.P. (ca. 13,068 cal yrs B.P.). Evidence of early occupations includes the presence of lithic tools, a concentration of Pleistocene species remains, human-induced fractured animal bones, and a selection of skeletal parts of extinct fauna. The occurrence of hunter-gatherers in the Southern Cone at ca. 14,000 cal yrs B.P. is added to the growing list of American sites that indicate a human occupation earlier than the Clovis dispersal episode, but posterior to the onset of the deglaciation of the Last Glacial Maximum (LGM) in the North America.

The Arrival of Homo sapiens into the Southern Cone at 14,000 Years Ago.

Directory of Open Access Journals (Sweden)

Gustavo G Politis

Full Text Available The Arroyo Seco 2 site contains a rich archaeological record, exceptional for South America, to explain the expansion of Homo sapiens into the Americas and their interaction with extinct Pleistocene mammals. The following paper provides a detailed overview of material remains found in the earliest cultural episodes at this multi-component site, dated between ca. 12,170 14C yrs B.P. (ca. 14,064 cal yrs B.P. and 11,180 14C yrs B.P. (ca. 13,068 cal yrs B.P.. Evidence of early occupations includes the presence of lithic tools, a concentration of Pleistocene species remains, human-induced fractured animal bones, and a selection of skeletal parts of extinct fauna. The occurrence of hunter-gatherers in the Southern Cone at ca. 14,000 cal yrs B.P. is added to the growing list of American sites that indicate a human occupation earlier than the Clovis dispersal episode, but posterior to the onset of the deglaciation of the Last Glacial Maximum (LGM in the North America.

Craniofacial morphology of Homo floresiensis: description, taxonomic affinities, and evolutionary implication.

Science.gov (United States)

Kaifu, Yousuke; Baba, Hisao; Sutikna, Thomas; Morwood, Michael J; Kubo, Daisuke; Saptomo, E Wahyu; Jatmiko; Awe, Rokhus Due; Djubiantono, Tony

2011-12-01

This paper describes in detail the external morphology of LB1/1, the nearly complete and only known cranium of Homo floresiensis. Comparisons were made with a large sample of early groups of the genus Homo to assess primitive, derived, and unique craniofacial traits of LB1 and discuss its evolution. Principal cranial shape differences between H. floresiensis and Homo sapiens are also explored metrically. The LB1 specimen exhibits a marked reductive trend in its facial skeleton, which is comparable to the H. sapiens condition and is probably associated with reduced masticatory stresses. However, LB1 is craniometrically different from H. sapiens showing an extremely small overall cranial size, and the combination of a primitive low and anteriorly narrow vault shape, a relatively prognathic face, a rounded oval foramen that is greatly separated anteriorly from the carotid canal/jugular foramen, and a unique, tall orbital shape. Whereas the neurocranium of LB1 is as small as that of some Homo habilis specimens, it exhibits laterally expanded parietals, a weak suprameatal crest, a moderately flexed occipital, a marked facial reduction, and many other derived features that characterize post-habilis Homo. Other craniofacial characteristics of LB1 include, for example, a relatively narrow frontal squama with flattened right and left sides, a marked frontal keel, posteriorly divergent temporal lines, a posteriorly flexed anteromedial corner of the mandibular fossa, a bulbous lateral end of the supraorbital torus, and a forward protruding maxillary body with a distinct infraorbital sulcus. LB1 is most similar to early Javanese Homo erectus from Sangiran and Trinil in these and other aspects. We conclude that the craniofacial morphology of LB1 is consistent with the hypothesis that H. floresiensis evolved from early Javanese H. erectus with dramatic island dwarfism. However, further field discoveries of early hominin skeletal remains from Flores and detailed analyses of the

Molecular biology of Homo sapiens: Abstracts of papers presented at the 51st Cold Spring Harbor symposium on quantitative biology

International Nuclear Information System (INIS)

Watson, J.D.; Siniscalco, M.

1986-01-01

This volume contains abstracts of papers presented at the 51st Cold Springs Harbor Symposium on Quantitative Biology. The topic for this meeting was the ''Molecular Biology of Homo sapiens.'' Sessions were entitled Human Gene Map, Human Cancer Genes, Genetic Diagnosis, Human Evolution, Drugs Made Off Human Genes, Receptors, and Gene Therapy. (DT)

Protamines and spermatogenesis in Drosophila and Homo sapiens : A comparative analysis.

Science.gov (United States)

Kanippayoor, Rachelle L; Alpern, Joshua H M; Moehring, Amanda J

2013-04-01

The production of mature and motile sperm is a detailed process that utilizes many molecular players to ensure the faithful execution of spermatogenesis. In most species that have been examined, spermatogenesis begins with a single cell that undergoes dramatic transformation, culminating with the hypercompaction of DNA into the sperm head by replacing histones with protamines. Precise execution of the stages of spermatogenesis results in the production of motile sperm. While comparative analyses have been used to identify similarities and differences in spermatogenesis between species, the focus has primarily been on vertebrate spermatogenesis, particularly mammals. To understand the evolutionary basis of spermatogenetic variation, however, a more comprehensive comparison is needed. In this review, we examine spermatogenesis and the final packaging of DNA into the sperm head in the insect Drosophila melanogaster and compare it to spermatogenesis in Homo sapiens.

Body composition in Pan paniscus compared with Homo sapiens has implications for changes during human evolution.

Science.gov (United States)

Zihlman, Adrienne L; Bolter, Debra R

2015-06-16

The human body has been shaped by natural selection during the past 4-5 million years. Fossils preserve bones and teeth but lack muscle, skin, fat, and organs. To understand the evolution of the human form, information about both soft and hard tissues of our ancestors is needed. Our closest living relatives of the genus Pan provide the best comparative model to those ancestors. Here, we present data on the body composition of 13 bonobos (Pan paniscus) measured during anatomical dissections and compare the data with Homo sapiens. These comparative data suggest that both females and males (i) increased body fat, (ii) decreased relative muscle mass, (iii) redistributed muscle mass to lower limbs, and (iv) decreased relative mass of skin during human evolution. Comparison of soft tissues between Pan and Homo provides new insights into the function and evolution of body composition.

Molecular biology of Homo sapiens: Abstracts of papers presented at the 51st Cold Spring Harbor symposium on quantitative biology

Energy Technology Data Exchange (ETDEWEB)

Watson, J.D.; Siniscalco, M.

1986-01-01

This volume contains abstracts of papers presented at the 51st Cold Springs Harbor Symposium on Quantitative Biology. The topic for this meeting was the ''Molecular Biology of Homo sapiens.'' Sessions were entitled Human Gene Map, Human Cancer Genes, Genetic Diagnosis, Human Evolution, Drugs Made Off Human Genes, Receptors, and Gene Therapy. (DT)

Inferential reasoning by exclusion in children (Homo sapiens).

Science.gov (United States)

Hill, Andrew; Collier-Baker, Emma; Suddendorf, Thomas

2012-08-01

The cups task is the most widely adopted forced-choice paradigm for comparative studies of inferential reasoning by exclusion. In this task, subjects are presented with two cups, one of which has been surreptitiously baited. When the empty cup is shaken or its interior shown, it is possible to infer by exclusion that the alternative cup contains the reward. The present study extends the existing body of comparative work to include human children (Homo sapiens). Like chimpanzees (Pan troglodytes) that were tested with the same equipment and near-identical procedures, children aged three to five made apparent inferences using both visual and auditory information, although the youngest children showed the least-developed ability in the auditory modality. However, unlike chimpanzees, children of all ages used causally irrelevant information in a control test designed to examine the possibility that their apparent auditory inferences were the product of contingency learning (the duplicate cups test). Nevertheless, the children's ability to reason by exclusion was corroborated by their performance on a novel verbal disjunctive syllogism test, and we found preliminary evidence consistent with the suggestion that children used their causal-logical understanding to reason by exclusion in the cups task, but subsequently treated the duplicate cups information as symbolic or communicative, rather than causal. Implications for future comparative research are discussed. 2012 APA, all rights reserved

A Review on Structures and Functions of Bcl-2 Family Proteins from Homo sapiens.

Science.gov (United States)

Sivakumar, Dakshinamurthy; Sivaraman, Thirunavukkarasu

2016-01-01

Cancer cells evade apoptosis, which is regulated by proteins of Bcl-2 family in the intrinsic pathways. Numerous experimental three-dimensional (3D) structures of the apoptotic proteins and the proteins bound with small chemical molecules/peptides/proteins have been reported in the literature. In this review article, the 3D structures of the Bcl-2 family proteins from Homo sapiens and as well complex structures of the anti-apoptotic proteins bound with small molecular inhibitors reported in the literature to date have been comprehensively listed out and described in detail. Moreover, the molecular mechanisms by which the Bcl-2 family proteins modulate the apoptotic processes and strategies for designing antagonists to anti-apoptotic proteins have been concisely discussed.

Variability in first Homo: Analysis of the ratio between the skulls KNM-ER 1470 and KNM-ER 1813 based on sexual dimorphism of Homo sapiens.

Science.gov (United States)

Guimarães, S W Ferreira; Lorenzo, C

2015-10-01

The study of the skulls KNM-ER 1470 and KNM-ER 1813, considered the first members of the genus Homo, has raised some debates. While some of researchers maintain that there is only one species, another group argues that there are two species. On one hand these two fossils are still taxonomically undetermined, on the other hand they bring up another problem related to the existence of a genus with multiple species since its beginning, according to the last discoveries. In this paper, we have compared the size ratio between these fossils with ratios established in populations of Homo sapiens, in order to know if they fit into the human standard, considering intra-sexual and inter-sexual variation. Results help to establish whether these fossils correspond to different species or their differences could be related to sexual dimorphism within a single species. Copyright © 2015 Elsevier GmbH. All rights reserved.

Evolutionary genetic analyses of MEF2C gene: implications for learning and memory in Homo sapiens.

Science.gov (United States)

Kalmady, Sunil V; Venkatasubramanian, Ganesan; Arasappa, Rashmi; Rao, Naren P

2013-02-01

MEF2C facilitates context-dependent fear conditioning (CFC) which is a salient aspect of hippocampus-dependent learning and memory. CFC might have played a crucial role in human evolution because of its advantageous influence on survival of species. In this study, we analyzed 23 orthologous mammalian gene sequences of MEF2C gene to examine the evidence for positive selection on this gene in Homo sapiens using Phylogenetic Analysis by Maximum Likelihood (PAML) and HyPhy software. Both PAML Bayes Empirical Bayes (BEB) and HyPhy Fixed Effects Likelihood (FEL) analyses supported significant positive selection on 4 codon sites in H. sapiens. Also, haplotter analysis revealed significant ongoing positive selection on this gene in Central European population. The study findings suggest that adaptive selective pressure on this gene might have influenced human evolution. Further research on this gene might unravel the potential role of this gene in learning and memory as well as its pathogenetic effect in certain hippocampal disorders with evolutionary basis like schizophrenia. Copyright © 2012 Elsevier B.V. All rights reserved.

Protein-protein interaction site prediction in Homo sapiens and E. coli using an interaction-affinity based membership function in fuzzy SVM.

Science.gov (United States)

Sriwastava, Brijesh Kumar; Basu, Subhadip; Maulik, Ujjwal

2015-10-01

Protein-protein interaction (PPI) site prediction aids to ascertain the interface residues that participate in interaction processes. Fuzzy support vector machine (F-SVM) is proposed as an effective method to solve this problem, and we have shown that the performance of the classical SVM can be enhanced with the help of an interaction-affinity based fuzzy membership function. The performances of both SVM and F-SVM on the PPI databases of the Homo sapiens and E. coli organisms are evaluated and estimated the statistical significance of the developed method over classical SVM and other fuzzy membership-based SVM methods available in the literature. Our membership function uses the residue-level interaction affinity scores for each pair of positive and negative sequence fragments. The average AUC scores in the 10-fold cross-validation experiments are measured as 79.94% and 80.48% for the Homo sapiens and E. coli organisms respectively. On the independent test datasets, AUC scores are obtained as 76.59% and 80.17% respectively for the two organisms. In almost all cases, the developed F-SVM method improves the performances obtained by the corresponding classical SVM and the other classifiers, available in the literature.

The mystery of the seven spheres how homo sapiens will conquer space

CERN Document Server

Bignami, Giovanni F

2015-01-01

In this book, Giovanni Bignami, the outstanding Italian scientist and astronomer, takes the reader on a journey through the “seven spheres”, from our own planet to neighboring stars. The author offers a gripping account of the evolution of Homo Sapiens to the stage where our species is developing capabilities, in the form of new energy propulsion systems, that will enable us to conquer space. The reader will learn how we first expanded our activities to reach beyond our planet, to the Moon, and how nuclear energy, nuclear fusion, and matter–antimatter annihilation will enable us to extend our exploration. After Mars and Jupiter we shall finally reach the nearest stars, which we now know are surrounded by numerous planets, some of which are bound to be habitable. The book includes enticing descriptions of such newly discovered planets and also brings alive key historical characters in our story, such as Jules Verne and Werner von Braun.

From Homo Abilis to Homo Rationalis through Analytic Perception and Mathematics

Directory of Open Access Journals (Sweden)

Domenico Lenzi

2017-02-01

Full Text Available Starting from the stage of “Homo habilis” man has gained - in the course  of about two million years during which he has undergone a gradual evolution from the initial animal stage - its status as “Homo rationalis”. However, not all individuals are able to satisfactorily activate the skill of reasoning. It is undeniable that a fundamental step towards this activation is the development of mathematical skills, which are a common heritage of all human beings. Hence the need for more concrete and better coordinateddidactic approaches, ultimately leading to the basic concepts of this discipline, which has an essential role in the acquisition of rationality.   Dall’Homo Abilis all’Homo Rationalis tramite la Percezione Analitica e la Matematica A partire dall’Homo abilis, l’uomo ha conquistato – nel corso di circa 2 milioni di anni, in cui si è progressivamente allontanato da uno stadio bestiale – il suo status di Homo rationalis. Però non tutti gli individui sono in grado di attivare in modo soddisfacente le abiltà di ragionamento. È innegabile che una tappa fondamentale verso quest’attivazione sia costituita dallo sviluppo delle abilità matematiche, che sono patrimonio di ogni essere umano. Da ciò deriva la necessità di impostazioni didattiche più concrete e meglio coordinate, da cui far scaturire in modo comprensibile i concetti fondamentali di tale disciplina, che ha un ruolo essenziale per l’acquisizione della razionalità.  Paole Chiave: filogenesi; memoria di specie; Homo sapiens sapiens; percezione

Further morphological evidence on South African earliest Homo lower postcanine dentition: Enamel thickness and enamel dentine junction.

Science.gov (United States)

Pan, Lei; Dumoncel, Jean; de Beer, Frikkie; Hoffman, Jakobus; Thackeray, John Francis; Duployer, Benjamin; Tenailleau, Christophe; Braga, José

2016-07-01

The appearance of the earliest members of the genus Homo in South Africa represents a key event in human evolution. Although enamel thickness and enamel dentine junction (EDJ) morphology preserve important information about hominin systematics and dietary adaptation, these features have not been sufficiently studied with regard to early Homo. We used micro-CT to compare enamel thickness and EDJ morphology among the mandibular postcanine dentitions of South African early hominins (N = 30) and extant Homo sapiens (N = 26), with special reference to early members of the genus Homo. We found that South African early Homo shows a similar enamel thickness distribution pattern to modern humans, although three-dimensional average and relative enamel thicknesses do not distinguish australopiths, early Homo, and modern humans particularly well. Based on enamel thickness distributions, our study suggests that a dietary shift occurred between australopiths and the origin of the Homo lineage. We also observed that South African early Homo postcanine EDJ combined primitive traits seen in australopith molars with derived features observed in modern human premolars. Our results confirm that some dental morphological patterns in later Homo actually occurred early in the Homo lineage, and highlight the taxonomic value of premolar EDJ morphology in hominin species. Copyright © 2016 Elsevier Ltd. All rights reserved.

Object permanence in orangutans (Pongo pygmaeus), chimpanzees (Pan troglodytes), and children (Homo sapiens).

Science.gov (United States)

Call, J

2001-06-01

Juvenile and adult orangutans (n = 5; Pongo pygmaeus), chimpanzees (n = 7; Pan troglodytes), and 19- and 26-month-old children (n = 24; Homo sapiens) received visible and invisible displacements. Three containers were presented forming a straight line, and a small box was used to displace a reward under them. Subjects received 3 types of displacement: single (the box visited 1 container), double adjacent (the box visited 2 contiguous containers), and double nonadjacent (the box visited 2 noncontiguous containers). All species performed at comparable levels, solving all problems except the invisible nonadjacent displacements. Visible displacements were easier than invisible, and single were easier than double displacements. In a 2nd experiment, subjects saw the baiting of either 2 adjacent or 2 nonadjacent containers with no displacements. All species selected the empty container more often when the baited containers were nonadjacent than when they were adjacent. It is hypothesized that a response bias and inhibition problem were responsible for the poor performance in nonadjacent displacements.

Terrestrial environmental changes around the Gulf of Aden over the last 210 kyr deduced from the sediment n-alkane record: Implications for the dispersal of Homo sapiens

Science.gov (United States)

Isaji, Yuta; Kawahata, Hodaka; Ohkouchi, Naohiko; Murayama, Masafumi; Tamaki, Kensaku

2015-03-01

We analyzed long-chain (C25-C36) n-alkanes and pollen grains in sediments from the Gulf of Aden covering the last 212 kyr to reconstruct the surrounding terrestrial environment, a critical region for the dispersal of Homo sapiens. Substantial increases in the flux of n-alkanes during 200-185, 120-95, and 70-50 ka were interpreted to indicate enhanced vegetation biomass in the Arabian Peninsula and the northern part of the Horn of Africa or increase in lithogenic material inputs. Periods of enhanced n-alkane flux occurred during or immediately after pluvial episodes, indicating that the increased precipitation may have induced substantially enhanced vegetation biomass, creating favorable conditions for Homo sapiens. Additionally, vegetation may have increased due to moderate precipitation unrecorded by speleothems or in accordance with the lowering of sea level, indicating that the dispersal might have been possible even after the shift to an arid environment indicated by the speleothems.

ABOUT OTHER KIND OF PRODUCTIVITY AND GROWTH (HOMO-SAPIENS TO HOMO-OECONOMICUS

Directory of Open Access Journals (Sweden)

Jivan Alexandru

2011-07-01

Full Text Available Part of a larger research, this paper ranges among the matter of ideas confrontation concerning the causes of the economic crises and those keys to be passed. Paper aims at finding and praising the defining elements of our economy, in the purpose of better understanding the nowadays crisis, and at presenting certain conceptually different approaches. In this purpose, analytical presentations are focussed on the specific realities of the economic life that are in position in the last centuries, which are considered to be favouring the arriving to the critical states in the last years and to be promoting those maintaining, or which allow explaining certain effects and tendencies. The approach is made from the angle of the nature of the productivity that is had in view and highlighted in the market regulating mechanisms, and of the due growth. The paper is grounded on important analysis on the matter (including anterior researches of the author, but their dimensions does not allow their presentation in the abstract. Analysis starts from interpreting the very nowadays crisis, from different sites concerning the core (general causes, by correlating with certain features of the industrialized consuming society. More recent references are made in the literature on the matter. Modern western economy is defined from the angle of focussing on material-quantitative productivity and growth. Analysis tries to explain certain effects concerning this kind of focus. Interesting effects and tendencies are noticed, that miss to the traditional approaches. Further on an opposed theoretic model is discussed. This is built and developed inside the service economy (on the case of two conceptually similar approaches, came from two different sources of economic thought in the field; original contributions of the author are involved. Adequately to the knowledge society, this last one is considered more favourable for homo sapiens, at least once the visible effects of

A comparative analysis of global and local processing of hierarchical visual stimuli in young children (Homo sapiens) and monkeys (Cebus apella).

Science.gov (United States)

De Lillo, Carlo; Spinozzi, Giovanna; Truppa, Valentina; Naylor, Donna M

2005-05-01

Results obtained with preschool children (Homo sapiens) were compared with results previously obtained from capuchin monkeys (Cebus apella) in matching-to-sample tasks featuring hierarchical visual stimuli. In Experiment 1, monkeys, in contrast with children, showed an advantage in matching the stimuli on the basis of their local features. These results were replicated in a 2nd experiment in which control trials enabled the authors to rule out that children used spurious cues to solve the matching task. In a 3rd experiment featuring conditions in which the density of the stimuli was manipulated, monkeys' accuracy in the processing of the global shape of the stimuli was negatively affected by the separation of the local elements, whereas children's performance was robust across testing conditions. Children's response latencies revealed a global precedence in the 2nd and 3rd experiments. These results show differences in the processing of hierarchical stimuli by humans and monkeys that emerge early during childhood. 2005 APA, all rights reserved

Structural modelling and comparative analysis of homologous, analogous and specific proteins from Trypanosoma cruzi versus Homo sapiens: putative drug targets for chagas' disease treatment.

Science.gov (United States)

Capriles, Priscila V S Z; Guimarães, Ana C R; Otto, Thomas D; Miranda, Antonio B; Dardenne, Laurent E; Degrave, Wim M

2010-10-29

Trypanosoma cruzi is the etiological agent of Chagas' disease, an endemic infection that causes thousands of deaths every year in Latin America. Therapeutic options remain inefficient, demanding the search for new drugs and/or new molecular targets. Such efforts can focus on proteins that are specific to the parasite, but analogous enzymes and enzymes with a three-dimensional (3D) structure sufficiently different from the corresponding host proteins may represent equally interesting targets. In order to find these targets we used the workflows MHOLline and AnEnΠ obtaining 3D models from homologous, analogous and specific proteins of Trypanosoma cruzi versus Homo sapiens. We applied genome wide comparative modelling techniques to obtain 3D models for 3,286 predicted proteins of T. cruzi. In combination with comparative genome analysis to Homo sapiens, we were able to identify a subset of 397 enzyme sequences, of which 356 are homologous, 3 analogous and 38 specific to the parasite. In this work, we present a set of 397 enzyme models of T. cruzi that can constitute potential structure-based drug targets to be investigated for the development of new strategies to fight Chagas' disease. The strategies presented here support the concept of structural analysis in conjunction with protein functional analysis as an interesting computational methodology to detect potential targets for structure-based rational drug design. For example, 2,4-dienoyl-CoA reductase (EC 1.3.1.34) and triacylglycerol lipase (EC 3.1.1.3), classified as analogous proteins in relation to H. sapiens enzymes, were identified as new potential molecular targets.

Azole affinity of sterol 14α-demethylase (CYP51) enzymes from Candida albicans and Homo sapiens.

Science.gov (United States)

Warrilow, Andrew G; Parker, Josie E; Kelly, Diane E; Kelly, Steven L

2013-03-01

Candida albicans CYP51 (CaCYP51) (Erg11), full-length Homo sapiens CYP51 (HsCYP51), and truncated Δ60HsCYP51 were expressed in Escherichia coli and purified to homogeneity. CaCYP51 and both HsCYP51 enzymes bound lanosterol (K(s), 14 to 18 μM) and catalyzed the 14α-demethylation of lanosterol using Homo sapiens cytochrome P450 reductase and NADPH as redox partners. Both HsCYP51 enzymes bound clotrimazole, itraconazole, and ketoconazole tightly (dissociation constants [K(d)s], 42 to 131 nM) but bound fluconazole (K(d), ~30,500 nM) and voriconazole (K(d), ~2,300 nM) weakly, whereas CaCYP51 bound all five medical azole drugs tightly (K(d)s, 10 to 56 nM). Selectivity for CaCYP51 over HsCYP51 ranged from 2-fold (clotrimazole) to 540-fold (fluconazole) among the medical azoles. In contrast, selectivity for CaCYP51 over Δ60HsCYP51 with agricultural azoles ranged from 3-fold (tebuconazole) to 9-fold (propiconazole). Prothioconazole bound extremely weakly to CaCYP51 and Δ60HsCYP51, producing atypical type I UV-visible difference spectra (K(d)s, 6,100 and 910 nM, respectively), indicating that binding was not accomplished through direct coordination with the heme ferric ion. Prothioconazole-desthio (the intracellular derivative of prothioconazole) bound tightly to both CaCYP51 and Δ60HsCYP51 (K(d), ~40 nM). These differences in binding affinities were reflected in the observed 50% inhibitory concentration (IC(50)) values, which were 9- to 2,000-fold higher for Δ60HsCYP51 than for CaCYP51, with the exception of tebuconazole, which strongly inhibited both CYP51 enzymes. In contrast, prothioconazole weakly inhibited CaCYP51 (IC(50), ~150 μM) and did not significantly inhibit Δ60HsCYP51.

Differential effects of visual context on pattern discrimination by pigeons (Columba livia) and humans (Homo sapiens).

Science.gov (United States)

Kelly, Debbie M; Cook, Robert G

2003-06-01

Three experiment examined the role of contextual information during line orientation and line position discriminations by pigeons (Columba livia) and humans (Homo sapiens). Experiment 1 tested pigeons' performance with these stimuli in a target localization task using texture displays. Experiments 2 and 3 tested pigeons and humans, respectively, with small and large variations of these stimuli in a same-different task. Humans showed a configural superiority effect when tested with displays constructed from large elements but not when tested with the smaller, more densely packed texture displays. The pigeons, in contrast, exhibited a configural inferiority effect when required to discriminate line orientation, regardless of stimulus size. These contrasting results suggest a species difference in the perceptionand use of features and contextual information in the discrimination of line information.

Homo floresiensis: microcephalic, pygmoid, Australopithecus, or Homo?

Science.gov (United States)

Argue, Debbie; Donlon, Denise; Groves, Colin; Wright, Richard

2006-10-01

The remarkable partial adult skeleton (LB1) excavated from Liang Bua cave on the island of Flores, Indonesia, has been attributed to a new species, Homo floresiensis, based upon a unique mosaic of primitive and derived features compared to any other hominin. The announcement precipitated widespread interest, and attention quickly focused on its possible affinities. LB1 is a small-bodied hominin with an endocranial volume of 380-410 cm3, a stature of 1m, and an approximate geological age of 18,000 years. The describers [Brown, P., Sutikna, T., Morwood, M.J., Soejono, R.P., Jatmiko, Wayhu Saptomo, E., Awe Due, R., 2004. A new small-bodied hominin from the Late Pleistocene of Flores, Indonesia. Nature 431, 1055-1061] originally proposed that H. floresiensis was the end product of a long period of isolation of H. erectus or early Homo on a small island, a process known as insular dwarfism. More recently Morwood, Brown, and colleagues [Morwood, M.J., Brown, P., Jatmiko, Sutikna, T., Wahyu Saptomo, E., Westaway, K.E., Awe Due, R., Roberts, R.G., Maeda, T., Wasisto, S., Djubiantono, T., 2005. Further evidence for small-bodied hominins from the Late Pleistocene of Flores, Indonesia. Nature 437, 1012-1017] reviewed this assessment in light of new material from the site and concluded that H. floresiensis is not likely to be descended from H. erectus, with the genealogy of the species remaining uncertain. Other interpretations, namely that LB1 is a pygmy or afflicted with microcephaly, have also been put forward. We explore the affinities of LB1 using cranial and postcranial metric and non-metric analyses. LB1 is compared to early Homo, two microcephalic humans, a 'pygmoid' excavated from another cave on Flores, H. sapiens (including African pygmies and Andaman Islanders), Australopithecus, and Paranthropus. Based on these comparisons, we conclude that it is unlikely that LB1 is a microcephalic human, and it cannot be attributed to any known species. Its attribution to a new

Pair-bonding, romantic love, and evolution: the curious case of Homo sapiens.

Science.gov (United States)

Fletcher, Garth J O; Simpson, Jeffry A; Campbell, Lorne; Overall, Nickola C

2015-01-01

This article evaluates a thesis containing three interconnected propositions. First, romantic love is a "commitment device" for motivating pair-bonding in humans. Second, pair-bonding facilitated the idiosyncratic life history of hominins, helping to provide the massive investment required to rear children. Third, managing long-term pair bonds (along with family relationships) facilitated the evolution of social intelligence and cooperative skills. We evaluate this thesis by integrating evidence from a broad range of scientific disciplines. First, consistent with the claim that romantic love is an evolved commitment device, our review suggests that it is universal; suppresses mate-search mechanisms; has specific behavioral, hormonal, and neuropsychological signatures; and is linked to better health and survival. Second, we consider challenges to this thesis posed by the existence of arranged marriage, polygyny, divorce, and infidelity. Third, we show how the intimate relationship mind seems to be built to regulate and monitor relationships. Fourth, we review comparative evidence concerning links among mating systems, reproductive biology, and brain size. Finally, we discuss evidence regarding the evolutionary timing of shifts to pair-bonding in hominins. We conclude there is interdisciplinary support for the claim that romantic love and pair-bonding, along with alloparenting, played critical roles in the evolution of Homo sapiens. © The Author(s) 2014.

Relative orientation of collagen molecules within a fibril: a homology model for homo sapiens type I collagen.

Science.gov (United States)

Collier, Thomas A; Nash, Anthony; Birch, Helen L; de Leeuw, Nora H

2018-02-15

Type I collagen is an essential extracellular protein that plays an important structural role in tissues that require high tensile strength. However, owing to the molecule's size, to date no experimental structural data are available for the Homo sapiens species. Therefore, there is a real need to develop a reliable homology model and a method to study the packing of the collagen molecules within the fibril. Through the use of the homology model and implementation of a novel simulation technique, we have ascertained the orientations of the collagen molecules within a fibril, which is currently below the resolution limit of experimental techniques. The longitudinal orientation of collagen molecules within a fibril has a significant effect on the mechanical and biological properties of the fibril, owing to the different amino acid side chains available at the interface between the molecules.

Carabelli's trait revisited: an examination of mesiolingual features at the enamel-dentine junction and enamel surface of Pan and Homo sapiens upper molars.

Science.gov (United States)

Ortiz, Alejandra; Skinner, Matthew M; Bailey, Shara E; Hublin, Jean-Jacques

2012-10-01

Carabelli's trait is a morphological feature that frequently occurs on the mesiolingual aspect of Homo sapiens upper molars. Similar structures also referred to as Carabelli's trait have been reported in apes and fossil hominins. However, the morphological development and homology of these mesiolingual structures among hominoids are poorly understood. In this study, we employ micro-computed tomography to image the enamel-dentine junction (EDJ) and outer enamel surface (OES) of Pan (n = 48) and H. sapiens (n = 52) upper molars. We investigate the developmental origin of mesiolingual features in these taxa and establish the relative contribution of the EDJ and enamel cap to feature expression. Results demonstrate that mesiolingual features of H. sapiens molars develop at the EDJ and are similarly expressed at the OES. Morphological variation at both surfaces in this taxon can satisfactorily be assessed using standards for Carabelli's trait developed by the Arizona State University Dental Anthropology System (ASUDAS). Relative to H. sapiens, Pan has an even greater degree of correspondence in feature expression between the EDJ and OES. Morphological manifestations in Pan molars are not necessarily limited to the protocone and are best characterized by a lingual cingulum that cannot be captured by the ASUDAS. Cusp-like structures, similar to those seen in marked Carabelli's trait expressions in H. sapiens, were not found in Pan. This study provides a foundation for further analyses on the evolutionary history of mesiolingual dental traits within the hominoid lineage. It also highlights the wealth of morphological data that can be obtained at the EDJ for understanding tooth development and for characterizing tooth crown variation in worn fossil teeth. Copyright © 2012 Elsevier Ltd. All rights reserved.

Dental microwear and diets of African early Homo.

Science.gov (United States)

Ungar, Peter S; Grine, Frederick E; Teaford, Mark F; El Zaatari, Sireen

2006-01-01

Conventional wisdom ties the origin and early evolution of the genus Homo to environmental changes that occurred near the end of the Pliocene. The basic idea is that changing habitats led to new diets emphasizing savanna resources, such as herd mammals or underground storage organs. Fossil teeth provide the most direct evidence available for evaluating this theory. In this paper, we present a comprehensive study of dental microwear in Plio-Pleistocene Homo from Africa. We examined all available cheek teeth from Ethiopia, Kenya, Tanzania, Malawi, and South Africa and found 18 that preserved antemortem microwear. Microwear features were measured and compared for these specimens and a baseline series of five extant primate species (Cebus apella, Gorilla gorilla, Lophocebus albigena, Pan troglodytes, and Papio ursinus) and two protohistoric human foraging groups (Aleut and Arikara) with documented differences in diet and subsistence strategies. Results confirmed that dental microwear reflects diet, such that hard-object specialists tend to have more large microwear pits, whereas tough food eaters usually have more striations and smaller microwear features. Early Homo specimens clustered with baseline groups that do not prefer fracture resistant foods. Still, Homo erectus and individuals from Swartkrans Member 1 had more small pits than Homo habilis and specimens from Sterkfontein Member 5C. These results suggest that none of the early Homo groups specialized on very hard or tough foods, but that H. erectus and Swartkrans Member 1 individuals ate, at least occasionally, more brittle or tough items than other fossil hominins studied.

Variations and asymmetries in regional brain surface in the genus Homo.

Science.gov (United States)

Balzeau, Antoine; Holloway, Ralph L; Grimaud-Hervé, Dominique

2012-06-01

Paleoneurology is an important field of research within human evolution studies. Variations in size and shape of an endocast help to differentiate among fossil hominin species whereas endocranial asymmetries are related to behavior and cognitive function. Here we analyse variations of the surface of the frontal, parieto-temporal and occipital lobes among different species of Homo, including 39 fossil hominins, ten fossil anatomically modern Homo sapiens and 100 endocasts of extant modern humans. We also test for the possible asymmetries of these features in a large sample of modern humans and observe individual particularities in the fossil specimens. This study contributes important new information about the brain evolution in the genus Homo. Our results show that the general pattern of surface asymmetry for the different regional brain surfaces in fossil species of Homo does not seem to be different from the pattern described in a large sample of anatomically modern H. sapiens, i.e., the right hemisphere has a larger surface than the left, as do the right frontal, the right parieto-temporal and the left occipital lobes compared with the contra-lateral side. It also appears that Asian Homo erectus specimens are discriminated from all other samples of Homo, including African and Georgian specimens that are also sometimes included in that taxon. The Asian fossils show a significantly smaller relative size of the parietal and temporal lobes. Neandertals and anatomically modern H. sapiens, who share the largest endocranial volume of all hominins, show differences when considering the relative contribution of the frontal, parieto-temporal and occipital lobes. These results illustrate an original variation in the pattern of brain organization in hominins independent of variations in total size. The globularization of the brain and the enlargement of the parietal lobes could be considered derived features observed uniquely in anatomically modern H. sapiens. Copyright

Hominid mandibular corpus shape variation and its utility for recognizing species diversity within fossil Homo.

Science.gov (United States)

Lague, Michael R; Collard, Nicole J; Richmond, Brian G; Wood, Bernard A

2008-12-01

Mandibular corpora are well represented in the hominin fossil record, yet few studies have rigorously assessed the utility of mandibular corpus morphology for species recognition, particularly with respect to the linear dimensions that are most commonly available. In this study, we explored the extent to which commonly preserved mandibular corpus morphology can be used to: (i) discriminate among extant hominid taxa and (ii) support species designations among fossil specimens assigned to the genus Homo. In the first part of the study, discriminant analysis was used to test for significant differences in mandibular corpus shape at different taxonomic levels (genus, species and subspecies) among extant hominid taxa (i.e. Homo, Pan, Gorilla, Pongo). In the second part of the study, we examined shape variation among fossil mandibles assigned to Homo (including H. habilis sensu stricto, H. rudolfensis, early African H. erectus/H. ergaster, late African H. erectus, Asian H. erectus, H. heidelbergensis, H. neanderthalensis and H. sapiens). A novel randomization procedure designed for small samples (and using group 'distinctness values') was used to determine whether shape variation among the fossils is consistent with conventional taxonomy (or alternatively, whether a priori taxonomic groupings are completely random with respect to mandibular morphology). The randomization of 'distinctness values' was also used on the extant samples to assess the ability of the test to recognize known taxa. The discriminant analysis results demonstrated that, even for a relatively modest set of traditional mandibular corpus measurements, we can detect significant differences among extant hominids at the genus and species levels, and, in some cases, also at the subspecies level. Although the randomization of 'distinctness values' test is more conservative than discriminant analysis (based on comparisons with extant specimens), we were able to detect at least four distinct groups among the

What do cranial bones of LB1 tell us about Homo floresiensis?

Science.gov (United States)

Balzeau, Antoine; Charlier, Philippe

2016-04-01

Cranial vault thickness (CVT) of Liang Bua 1, the specimen that is proposed to be the holotype of Homo floresiensis, has not yet been described in detail and compared with samples of fossil hominins, anatomically modern humans or microcephalic skulls. In addition, a complete description from a forensic and pathological point of view has not yet been carried out. It is important to evaluate scientifically if features related to CVT bring new information concerning the possible pathological status of LB1, and if it helps to recognize affinities with any hominin species and particularly if the specimen could belong to the species Homo sapiens. Medical examination of the skull based on a micro-CT examination clearly brings to light the presence of a sincipital T (a non-metrical variant of normal anatomy), a scar from an old frontal trauma without any evident functional consequence, and a severe bilateral hyperostosis frontalis interna that may have modified the anterior morphology of the endocranium of LB1. We also show that LB1 displays characteristics, related to the distribution of bone thickness and arrangements of cranial structures, that are plesiomorphic traits for hominins, at least for Homo erectus s.l. relative to Homo neanderthalensis and H. sapiens. All the microcephalic skulls analyzed here share the derived condition of anatomically modern H. sapiens. Cranial vault thickness does not help to clarify the definition of the species H. floresiensis but it also does not support an attribution of LB1 to H. sapiens. We conclude that there is no support for the attribution of LB1 to H. sapiens as there is no evidence of systemic pathology and because it does not have any of the apomorphic traits of our species. Copyright © 2016 Elsevier Ltd. All rights reserved.

The Watinglo mandible: a second terminal Pleistocene Homo sapiens fossil from tropical Sahul with a test on existing models for the human settlement of the region.

Science.gov (United States)

Bulbeck, D; O'Connor, S

2011-02-01

This paper analyses a fossil human mandible, dated to circa 10ka, from Watinglo rockshelter on the north coast of Papua New Guinea. The fossil is metrically and morphologically similar to male mandibles of recent Melanesians and Australian Aborigines. It is distinguished from Kow Swamp and Coobool Creek male mandibles (Murray Valley, terminal Pleistocene) by being smaller and having different shape characteristics, as well as smaller teeth and a slower rate of tooth wear. It pairs with the Liang Lemdubu female (Late Glacial Maximum, Aru Islands) in suggesting that the morphology of the terminal Pleistocene inhabitants of tropical Sahul was gracile compared to their contemporaries within the southern Murray drainage. An explanatory scenario for this morphological contrast is developed in the context of the Homo sapiens early fossil record, Australasian mtDNA evidence, terminal Pleistocene climatic variation, and the possibility of multiple entry points into Sahul. Copyright © 2010 Elsevier GmbH. All rights reserved.

Do humans (Homo sapiens) and fish (Pterophyllum scalare) make similar numerosity judgments?

Science.gov (United States)

Miletto Petrazzini, Maria Elena; Agrillo, Christian; Izard, Véronique; Bisazza, Angelo

2016-11-01

Numerous studies have shown that many animal species can be trained to discriminate between stimuli differing in numerosity. However, in the absence of generalization tests with untrained numerosities, what decision criterion was used by subjects remains unclear: the subjects may succeed by selecting a specific number of items (a criterion over absolute numerosities), or by applying a more general relative numerosity rule, for example, selecting the larger/smaller quantity of items. The latter case may require more powerful representations, supporting judgments of order ("more/less") beyond simple "same/different" judgments, but a relative numerosity rule may also be more adaptive. In previous research, we showed that guppies (Poecilia reticulata) spontaneously prefer relative numerosity rules. To date it is unclear whether this preference is shared by other fish and, more broadly, other species. Here we compared the performance of angelfish (Pterophyllum scalare) with that of human adults (Homo sapiens) in a task in which subjects were initially trained to select arrays containing 10 dots (either in 5 vs. 10 or 10 vs. 20 comparisons). Subsequently they were tested with the previously trained numerosity and a novel numerosity (respectively, 20 or 5). In the absence of explicit instructions, both species spontaneously favored a relative rule, selecting the novel numerosity. These similarities demonstrate that, beyond shared representations for numerical quantities, vertebrate species may also share a system for taking decisions about quantities. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

Anatomické změny na kostrách v evoluci rodu Homo

OpenAIRE

Hoffmannová, Valérie

2016-01-01

The aim of this thesis is to describe the anatomical features on the skeletons of species Homo habilis, Homo erectus, Homo neanderthalensi, Homo sapiens and Homo naledi. For each type are described those features which characterize it. Emphasis is placed on changes in the anatomy of the skull and pelvis, but they are also mentioned other features typical for the species. Part of this work is to outline the mobility and function of the skeleton. Information about individual species are supplem...

Female-directed violence as a form of sexual coercion in humans (Homo sapiens).

Science.gov (United States)

Barbaro, Nicole; Shackelford, Todd K

2016-11-01

Male-perpetrated female-directed violence (FDV) may be associated with greater sexual access to a female. Accordingly, FDV is expected to be associated with greater copulation frequency. Research on nonhuman primates affirms this hypothesis, but no previous research has investigated this relationship in humans (Homo sapiens). The current research tests the hypothesis that FDV is associated with in-pair copulation frequency and, thus, may function as a form of sexual coercion. It was predicted that men who perpetrate FDV will secure more in-pair copulations than men who do not perpetrate violence (Prediction 1a), and that average monthly rates of FDV would positively correlate with in-pair copulation frequency (Prediction 1b). Male participants (n = 355) completed a survey, reporting limited demographic information (e.g., age, relationship length), in-pair copulation frequency, and history of physical violence perpetration. As predicted, violent men secured more in-pair copulations, on average, than nonviolent men, and monthly rates of violence positively correlated with in-pair copulation frequency. In humans, as in nonhuman primates, FDV by males may facilitate greater sexual access to a female. We discuss the implications of the current research for an evolutionary perspective on partner violence, and draw on research on nonhuman primates to highlight profitable avenues of research on FDV in humans. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

Normalization of Complete Genome Characteristics: Application to Evolution from Primitive Organisms to Homo sapiens.

Science.gov (United States)

Sorimachi, Kenji; Okayasu, Teiji; Ohhira, Shuji

2015-04-01

Normalized nucleotide and amino acid contents of complete genome sequences can be visualized as radar charts. The shapes of these charts depict the characteristics of an organism's genome. The normalized values calculated from the genome sequence theoretically exclude experimental errors. Further, because normalization is independent of both target size and kind, this procedure is applicable not only to single genes but also to whole genomes, which consist of a huge number of different genes. In this review, we discuss the applications of the normalization of the nucleotide and predicted amino acid contents of complete genomes to the investigation of genome structure and to evolutionary research from primitive organisms to Homo sapiens. Some of the results could never have been obtained from the analysis of individual nucleotide or amino acid sequences but were revealed only after the normalization of nucleotide and amino acid contents was applied to genome research. The discovery that genome structure was homogeneous was obtained only after normalization methods were applied to the nucleotide or predicted amino acid contents of genome sequences. Normalization procedures are also applicable to evolutionary research. Thus, normalization of the contents of whole genomes is a useful procedure that can help to characterize organisms.

Light Has Been Thrown (on Human Origins: a Brief History of Palaeoanthropology, with Notes on the "Punctuated" Origin of Homo Sapiens

Directory of Open Access Journals (Sweden)

Giorgio Manzi

2013-12-01

Full Text Available “Light will be thrown on the origin of man and his history”: this was the single line that Charles Darwin devoted to human evolution in the Origin of Species (1859. At present, there is a number of extinct species, which we understand  to be related to human evolution, demonstrating that the Darwin’s prediction was correct: light has been thrown, indeed. Moreover, the science of human origin (or palaeoanthropology appears to be able to shed much light not only on the natural history of humankind, but also on mechanisms and patterns of "evolution" as a general phenomenon. This is of special interest when we focus on data and hypotheses concerning the origin of our own species, Homo sapiens.

Associated ilium and femur from Koobi Fora, Kenya, and postcranial diversity in early Homo.

Science.gov (United States)

Ward, Carol V; Feibel, Craig S; Hammond, Ashley S; Leakey, Louise N; Moffett, Elizabeth A; Plavcan, J Michael; Skinner, Matthew M; Spoor, Fred; Leakey, Meave G

2015-04-01

During the evolution of hominins, it is generally accepted that there was a shift in postcranial morphology between Australopithecus and the genus Homo. Given the scarcity of associated remains of early Homo, however, relatively little is known about early Homo postcranial morphology. There are hints of postcranial diversity among species, but our knowledge of the nature and extent of potential differences is limited. Here we present a new associated partial ilium and femur from Koobi Fora, Kenya, dating to 1.9 Ma (millions of years ago) that is clearly attributable to the genus Homo but documents a pattern of morphology not seen in eastern African early Homo erectus. The ilium and proximal femur share distinctive anatomy found only in Homo. However, the geometry of the femoral midshaft and contour of the pelvic inlet do not resemble that of any specimens attributed to H. erectus from eastern Africa. This new fossil confirms the presence of at least two postcranial morphotypes within early Homo, and documents diversity in postcranial morphology among early Homo species that may reflect underlying body form and/or adaptive differences. Copyright © 2015 Elsevier Ltd. All rights reserved.

Cloning, purification, crystallization and preliminary X-ray crystallographic analysis of SET/TAF-Iβ ΔN from Homo sapiens

International Nuclear Information System (INIS)

Xu, Zhen; Yang, Weili; Shi, Nuo; Gao, Yongxiang; Teng, Maikun; Niu, Liwen

2010-01-01

The SET/TAF-Iβ that lacked the first 22 residues of the N-terminus from Homo sapiens was recombinantly expressed in Escherichia coli and crystallized. X-ray diffraction data were collected to 2.7 Å resolution. The histone chaperone SET encoded by the SET gene, which is also known as template-activating factor Iβ (TAF-Iβ), is a multifunctional molecule that is involved in many biological phenomena such as histone binding, nucleosome assembly, chromatin remodelling, replication, transcription and apoptosis. A truncated SET/TAF-Iβ ΔN protein that lacked the first 22 residues of the N-terminus but contained the C-terminal acidic domain and an additional His 6 tag at the C-terminus was overexpressed in Escherichia coli and crystallized by the hanging-drop vapour-diffusion method using sodium acetate as precipitant at 283 K. The crystals diffracted to 2.7 Å resolution and belonged to space group P4 3 2 1 2

Early Homo and the role of the genus in paleoanthropology.

Science.gov (United States)

Villmoare, Brian

2018-01-01

The history of the discovery of early fossils attributed to the genus Homo has been contentious, with scholars disagreeing over the generic assignment of fossils proposed as members of our genus. In this manuscript I review the history of discovery and debate over early Homo and evaluate the various taxonomic hypotheses for the genus. To get a sense of how hominin taxonomy compares to taxonomic practice outside paleoanthropology, I compare the diversity of Homo to genera in other vertebrate clades. Finally, I propose a taxonomic model that hews closely to current models for hominin phylogeny and is consistent with taxonomic practice across evolutionary biology. © 2018 American Association of Physical Anthropologists.

Homo sapiens-Specific Binding Site Variants within Brain Exclusive Enhancers Are Subject to Accelerated Divergence across Human Population.

Science.gov (United States)

Zehra, Rabail; Abbasi, Amir Ali

2018-03-01

Empirical assessments of human accelerated noncoding DNA frgaments have delineated presence of many cis-regulatory elements. Enhancers make up an important category of such accelerated cis-regulatory elements that efficiently control the spatiotemporal expression of many developmental genes. Establishing plausible reasons for accelerated enhancer sequence divergence in Homo sapiens has been termed significant in various previously published studies. This acceleration by including closely related primates and archaic human data has the potential to open up evolutionary avenues for deducing present-day brain structure. This study relied on empirically confirmed brain exclusive enhancers to avoid any misjudgments about their regulatory status and categorized among them a subset of enhancers with an exceptionally accelerated rate of lineage specific divergence in humans. In this assorted set, 13 distinct transcription factor binding sites were located that possessed unique existence in humans. Three of 13 such sites belonging to transcription factors SOX2, RUNX1/3, and FOS/JUND possessed single nucleotide variants that made them unique to H. sapiens upon comparisons with Neandertal and Denisovan orthologous sequences. These variants modifying the binding sites in modern human lineage were further substantiated as single nucleotide polymorphisms via exploiting 1000 Genomes Project Phase3 data. Long range haplotype based tests laid out evidence of positive selection to be governing in African population on two of the modern human motif modifying alleles with strongest results for SOX2 binding site. In sum, our study acknowledges acceleration in noncoding regulatory landscape of the genome and highlights functional parts within it to have undergone accelerated divergence in present-day human population.

Early stone technology on Flores and its implications for Homo floresiensis.

Science.gov (United States)

Brumm, Adam; Aziz, Fachroel; van den Bergh, Gert D; Morwood, Michael J; Moore, Mark W; Kurniawan, Iwan; Hobbs, Douglas R; Fullagar, Richard

2006-06-01

In the Soa Basin of central Flores, eastern Indonesia, stratified archaeological sites, including Mata Menge, Boa Lesa and Kobatuwa (Fig. 1), contain stone artefacts associated with the fossilized remains of Stegodon florensis, Komodo dragon, rat and various other taxa. These sites have been dated to 840-700 kyr bp (thousand years before present). The authenticity of the Soa Basin artefacts and their provenance have been demonstrated by previous work, but to quell lingering doubts, here we describe the context, attributes and production modes of 507 artefacts excavated at Mata Menge. We also note specific similarities, and apparent technological continuity, between the Mata Menge stone artefacts and those excavated from Late Pleistocene levels at Liang Bua cave, 50 km to the west. The latter artefacts, dated to between 95-74 and 12 kyr ago, are associated with the remains of a dwarfed descendent of S. florensis, Komodo dragon, rat and a small-bodied hominin species, Homo floresiensis, which had a brain size of about 400 cubic centimetres. The Mata Menge evidence negates claims that stone artefacts associated with H. floresiensis are so complex that they must have been made by modern humans (Homo sapiens).

Phylogenetic rate shifts in feeding time during the evolution of Homo.

Science.gov (United States)

Organ, Chris; Nunn, Charles L; Machanda, Zarin; Wrangham, Richard W

2011-08-30

Unique among animals, humans eat a diet rich in cooked and nonthermally processed food. The ancestors of modern humans who invented food processing (including cooking) gained critical advantages in survival and fitness through increased caloric intake. However, the time and manner in which food processing became biologically significant are uncertain. Here, we assess the inferred evolutionary consequences of food processing in the human lineage by applying a Bayesian phylogenetic outlier test to a comparative dataset of feeding time in humans and nonhuman primates. We find that modern humans spend an order of magnitude less time feeding than predicted by phylogeny and body mass (4.7% vs. predicted 48% of daily activity). This result suggests that a substantial evolutionary rate change in feeding time occurred along the human branch after the human-chimpanzee split. Along this same branch, Homo erectus shows a marked reduction in molar size that is followed by a gradual, although erratic, decline in H. sapiens. We show that reduction in molar size in early Homo (H. habilis and H. rudolfensis) is explicable by phylogeny and body size alone. By contrast, the change in molar size to H. erectus, H. neanderthalensis, and H. sapiens cannot be explained by the rate of craniodental and body size evolution. Together, our results indicate that the behaviorally driven adaptations of food processing (reduced feeding time and molar size) originated after the evolution of Homo but before or concurrent with the evolution of H. erectus, which was around 1.9 Mya.

Temporal coherence for pure tones in budgerigars (Melopsittacus undulatus) and humans (Homo sapiens).

Science.gov (United States)

Neilans, Erikson G; Dent, Micheal L

2015-02-01

Auditory scene analysis has been suggested as a universal process that exists across all animals. Relative to humans, however, little work has been devoted to how animals perceptually isolate different sound sources. Frequency separation of sounds is arguably the most common parameter studied in auditory streaming, but it is not the only factor contributing to how the auditory scene is perceived. Researchers have found that in humans, even at large frequency separations, synchronous tones are heard as a single auditory stream, whereas asynchronous tones with the same frequency separations are perceived as 2 distinct sounds. These findings demonstrate how both the timing and frequency separation of sounds are important for auditory scene analysis. It is unclear how animals, such as budgerigars (Melopsittacus undulatus), perceive synchronous and asynchronous sounds. In this study, budgerigars and humans (Homo sapiens) were tested on their perception of synchronous, asynchronous, and partially overlapping pure tones using the same psychophysical procedures. Species differences were found between budgerigars and humans in how partially overlapping sounds were perceived, with budgerigars more likely to segregate overlapping sounds and humans more apt to fuse the 2 sounds together. The results also illustrated that temporal cues are particularly important for stream segregation of overlapping sounds. Lastly, budgerigars were found to segregate partially overlapping sounds in a manner predicted by computational models of streaming, whereas humans were not. PsycINFO Database Record (c) 2015 APA, all rights reserved.

Learning a Weighted Sequence Model of the Nucleosome Core and Linker Yields More Accurate Predictions in Saccharomyces cerevisiae and Homo sapiens

Science.gov (United States)

Reynolds, Sheila M.; Bilmes, Jeff A.; Noble, William Stafford

2010-01-01

DNA in eukaryotes is packaged into a chromatin complex, the most basic element of which is the nucleosome. The precise positioning of the nucleosome cores allows for selective access to the DNA, and the mechanisms that control this positioning are important pieces of the gene expression puzzle. We describe a large-scale nucleosome pattern that jointly characterizes the nucleosome core and the adjacent linkers and is predominantly characterized by long-range oscillations in the mono, di- and tri-nucleotide content of the DNA sequence, and we show that this pattern can be used to predict nucleosome positions in both Homo sapiens and Saccharomyces cerevisiae more accurately than previously published methods. Surprisingly, in both H. sapiens and S. cerevisiae, the most informative individual features are the mono-nucleotide patterns, although the inclusion of di- and tri-nucleotide features results in improved performance. Our approach combines a much longer pattern than has been previously used to predict nucleosome positioning from sequence—301 base pairs, centered at the position to be scored—with a novel discriminative classification approach that selectively weights the contributions from each of the input features. The resulting scores are relatively insensitive to local AT-content and can be used to accurately discriminate putative dyad positions from adjacent linker regions without requiring an additional dynamic programming step and without the attendant edge effects and assumptions about linker length modeling and overall nucleosome density. Our approach produces the best dyad-linker classification results published to date in H. sapiens, and outperforms two recently published models on a large set of S. cerevisiae nucleosome positions. Our results suggest that in both genomes, a comparable and relatively small fraction of nucleosomes are well-positioned and that these positions are predictable based on sequence alone. We believe that the bulk of the

Learning a weighted sequence model of the nucleosome core and linker yields more accurate predictions in Saccharomyces cerevisiae and Homo sapiens.

Directory of Open Access Journals (Sweden)

Sheila M Reynolds

2010-07-01

Full Text Available DNA in eukaryotes is packaged into a chromatin complex, the most basic element of which is the nucleosome. The precise positioning of the nucleosome cores allows for selective access to the DNA, and the mechanisms that control this positioning are important pieces of the gene expression puzzle. We describe a large-scale nucleosome pattern that jointly characterizes the nucleosome core and the adjacent linkers and is predominantly characterized by long-range oscillations in the mono, di- and tri-nucleotide content of the DNA sequence, and we show that this pattern can be used to predict nucleosome positions in both Homo sapiens and Saccharomyces cerevisiae more accurately than previously published methods. Surprisingly, in both H. sapiens and S. cerevisiae, the most informative individual features are the mono-nucleotide patterns, although the inclusion of di- and tri-nucleotide features results in improved performance. Our approach combines a much longer pattern than has been previously used to predict nucleosome positioning from sequence-301 base pairs, centered at the position to be scored-with a novel discriminative classification approach that selectively weights the contributions from each of the input features. The resulting scores are relatively insensitive to local AT-content and can be used to accurately discriminate putative dyad positions from adjacent linker regions without requiring an additional dynamic programming step and without the attendant edge effects and assumptions about linker length modeling and overall nucleosome density. Our approach produces the best dyad-linker classification results published to date in H. sapiens, and outperforms two recently published models on a large set of S. cerevisiae nucleosome positions. Our results suggest that in both genomes, a comparable and relatively small fraction of nucleosomes are well-positioned and that these positions are predictable based on sequence alone. We believe that the

Learning a weighted sequence model of the nucleosome core and linker yields more accurate predictions in Saccharomyces cerevisiae and Homo sapiens.

Science.gov (United States)

Reynolds, Sheila M; Bilmes, Jeff A; Noble, William Stafford

2010-07-08

DNA in eukaryotes is packaged into a chromatin complex, the most basic element of which is the nucleosome. The precise positioning of the nucleosome cores allows for selective access to the DNA, and the mechanisms that control this positioning are important pieces of the gene expression puzzle. We describe a large-scale nucleosome pattern that jointly characterizes the nucleosome core and the adjacent linkers and is predominantly characterized by long-range oscillations in the mono, di- and tri-nucleotide content of the DNA sequence, and we show that this pattern can be used to predict nucleosome positions in both Homo sapiens and Saccharomyces cerevisiae more accurately than previously published methods. Surprisingly, in both H. sapiens and S. cerevisiae, the most informative individual features are the mono-nucleotide patterns, although the inclusion of di- and tri-nucleotide features results in improved performance. Our approach combines a much longer pattern than has been previously used to predict nucleosome positioning from sequence-301 base pairs, centered at the position to be scored-with a novel discriminative classification approach that selectively weights the contributions from each of the input features. The resulting scores are relatively insensitive to local AT-content and can be used to accurately discriminate putative dyad positions from adjacent linker regions without requiring an additional dynamic programming step and without the attendant edge effects and assumptions about linker length modeling and overall nucleosome density. Our approach produces the best dyad-linker classification results published to date in H. sapiens, and outperforms two recently published models on a large set of S. cerevisiae nucleosome positions. Our results suggest that in both genomes, a comparable and relatively small fraction of nucleosomes are well-positioned and that these positions are predictable based on sequence alone. We believe that the bulk of the

Description, new reconstruction, comparative anatomy, and classification of the Sterkfontein Stw 53 cranium, with discussions about the taxonomy of other southern African early Homo remains.

Science.gov (United States)

Curnoe, Darren; Tobias, Phillip V

2006-01-01

Specimen Stw 53 was recovered in 1976 from Member 5 of the Sterkfontein Formation. Since its incomplete initial description and comparison, the partial cranium has figured prominently in discussions about the systematics of early Homo. Despite publication of a preliminary reconstruction in 1985, Stw 53 has yet to be compared comprehensively to other Plio-Pleistocene fossils or assessed systematically. In this paper, we report on a new reconstruction of this specimen and provide a detailed description and comparison of its morphology. Our reconstruction differs in important respects from the earlier one, especially in terms of neurocranial length, breadth, and height. However, given that Stw 53 exhibits extensive damage, these dimensions are most likely prone to much error in reconstruction. In areas of well-preserved bone, Stw 53 shares many cranial features with Homo habilis, and we propose retaining it within this species. We also consider the affinities of dental remains from Sterkfontein Member 5, along with those from Swartkrans and Drimolen previously assigned to Homo. We find evidence for sympatry of H. habilis and Australopithecus robustus and possibly Plio-Pleistocene Homo sapiens sensu lato in Sterkfontein Member 5. At Swartkrans and Drimolen, we find evidence of H. habilis. We also compare the morphologies of Stw 53 and SK 847 and find compelling evidence to assign the latter specimen to H. habilis, as has been proposed.

Hominid mandibular corpus shape variation and its utility for recognizing species diversity within fossil Homo

Science.gov (United States)

Lague, Michael R; Collard, Nicole J; Richmond, Brian G; Wood, Bernard A

2008-01-01

Mandibular corpora are well represented in the hominin fossil record, yet few studies have rigorously assessed the utility of mandibular corpus morphology for species recognition, particularly with respect to the linear dimensions that are most commonly available. In this study, we explored the extent to which commonly preserved mandibular corpus morphology can be used to: (i) discriminate among extant hominid taxa and (ii) support species designations among fossil specimens assigned to the genus Homo. In the first part of the study, discriminant analysis was used to test for significant differences in mandibular corpus shape at different taxonomic levels (genus, species and subspecies) among extant hominid taxa (i.e. Homo, Pan, Gorilla, Pongo). In the second part of the study, we examined shape variation among fossil mandibles assigned to Homo(including H. habilis sensu stricto, H. rudolfensis, early African H. erectus/H. ergaster, late African H. erectus, Asian H. erectus, H. heidelbergensis, H. neanderthalensis and H. sapiens). A novel randomization procedure designed for small samples (and using group ‘distinctness values’) was used to determine whether shape variation among the fossils is consistent with conventional taxonomy (or alternatively, whether a priori taxonomic groupings are completely random with respect to mandibular morphology). The randomization of ‘distinctness values’ was also used on the extant samples to assess the ability of the test to recognize known taxa. The discriminant analysis results demonstrated that, even for a relatively modest set of traditional mandibular corpus measurements, we can detect significant differences among extant hominids at the genus and species levels, and, in some cases, also at the subspecies level. Although the randomization of ‘distinctness values’ test is more conservative than discriminant analysis (based on comparisons with extant specimens), we were able to detect at least four distinct groups

Cranial base morphology and temporal bone pneumatization in Asian Homo erectus.

Science.gov (United States)

Balzeau, Antoine; Grimaud-Hervé, Dominique

2006-10-01

The external morphological features of the temporal bone are used frequently to determine taxonomic affinities of fossils of the genus Homo. Temporal bone pneumatization has been widely studied in great apes and in early hominids. However, this feature is rarely examined in the later hominids, particularly in Asian Homo erectus. We provide a comparative morphological and quantitative analysis of Asian Homo erectus from the sites of Ngandong, Sambungmacan, and Zhoukoudian, and of Neandertals and anatomically modern Homo sapiens in order to discuss causes and modalities of temporal bone pneumatization during hominid evolution. The evolution of temporal bone pneumatization in the genus Homo is more complex than previously described. Indeed, the Zhoukoudian fossils have a unique pattern of temporal bone pneumatization, whereas Ngandong and Sambungmacan fossils, as well as the Neandertals, more closely resemble the modern human pattern. Moreover, these Chinese fossils are characterized by a wide midvault and a relatively narrow occipital bone. Our results support the point of view that cell development does not play an active role in determining cranial base morphology. Instead, pneumatization is related to available space and to temporal bone morphology, and its development is related to correlated morphology and the relative disposition of the bones and cerebral lobes. Because variation in pneumatization is extensive within the same species, the phyletic implications of pneumatization are limited in the taxa considered here.

Allometric scaling of infraorbital surface topography in Homo.

Science.gov (United States)

Maddux, Scott D; Franciscus, Robert G

2009-02-01

Infraorbital morphology is often included in phylogenetic and functional analyses of Homo. The inclusion of distinct infraorbital configurations, such as the "canine fossa" in Homo sapiens or the "inflated" maxilla in Neandertals, is generally based on either descriptive or qualitative assessments of this morphology, or simple linear chord and subtense measurements. However, the complex curvilinear surface of the infraorbital region has proven difficult to quantify through these traditional methods. In this study, we assess infraorbital shape and its potential allometric scaling in fossil Homo (n=18) and recent humans (n=110) with a geometric morphometric method well-suited for quantifying complex surface topographies. Our results indicate that important aspects of infraorbital shape are correlated with overall infraorbital size across Homo. Specifically, individuals with larger infraorbital areas tend to exhibit relatively flatter infraorbital surface topographies, taller and narrower infraorbital areas, sloped inferior orbital rims, anteroinferiorly oriented maxillary body facies, posteroinferiorly oriented maxillary processes of the zygomatic, and non-everted lateral nasal margins. In contrast, individuals with smaller infraorbital regions generally exhibit relatively depressed surface topographies, shorter and wider infraorbital areas, projecting inferior orbital rims, posteroinferiorly oriented maxillary body facies, anteroinferiorly oriented maxillary processes, and everted lateral nasal margins. These contrasts form a continuum and only appear dichotomized at the ends of the infraorbital size spectrum. In light of these results, we question the utility of incorporating traditionally polarized infraorbital morphologies in phylogenetic and functional analyses without due consideration of continuous infraorbital and facial size variation in Homo. We conclude that the essentially flat infraorbital surface topography of Neandertals is not unique and can be

Thickened cranial vault and parasagittal keeling: correlated traits and autapomorphies of Homo erectus?

Science.gov (United States)

Balzeau, Antoine

2013-06-01

Homo erectus sensu lato (s.l.) is a key species in the hominin fossil record for the study of human evolution, being one of the first species discovered and perhaps the most documented, but also because of its long temporal range and having dispersed out of Africa earlier than any other human species. Here I test two proposed autapomorphic traits of H. erectus, namely the increased thickness of the upper cranial vault and parasagittal keeling. The definition of these two anatomical features and their expression and variation among hominids are discussed. The results of this study indicate that the upper vault in Asian H. erectus is not absolutely thicker compared with fossil anatomically modern Homo sapiens, whereas Broken Hill and Petralona have values above the range of variation of H. erectus. Moreover, this anatomical region in Asian H. erectus is not significantly thicker compared with Pan paniscus. In addition, these results demonstrate that cranial vault thickness should not be used to make hypotheses regarding sexual attribution of fossil hominin specimens. I also show that the relation between relief on the external surface of the upper vault, parasagittal keeling and bregmatic eminence, and bone thickness is complex. In this context, the autapomorphic status of the two analysed traits in H. erectus may be rejected. Nevertheless, different patterns in the distribution of bone thickness on the upper vault were identified. Some individual variations are visible, but specificities are observable in samples of different species. The pattern of bone thickness distribution observed in Asian H. erectus, P. paniscus, possibly australopiths, and early Homo or Homo ergaster/erectus appears to be shared by these different species and would be a plesiomorphic trait among hominids. In contrast, two apomorphic states for this feature were identified for Neandertals and H. sapiens. Copyright © 2013 Elsevier Ltd. All rights reserved.

Gracility of the modern Homo sapiens skeleton is the result of decreased biomechanical loading.

Science.gov (United States)

Ryan, Timothy M; Shaw, Colin N

2015-01-13

The postcranial skeleton of modern Homo sapiens is relatively gracile compared with other hominoids and earlier hominins. This gracility predisposes contemporary humans to osteoporosis and increased fracture risk. Explanations for this gracility include reduced levels of physical activity, the dissipation of load through enlarged joint surfaces, and selection for systemic physiological characteristics that differentiate modern humans from other primates. This study considered the skeletal remains of four behaviorally diverse recent human populations and a large sample of extant primates to assess variation in trabecular bone structure in the human hip joint. Proximal femur trabecular bone structure was quantified from microCT data for 229 individuals from 31 extant primate taxa and 59 individuals from four distinct archaeological human populations representing sedentary agriculturalists and mobile foragers. Analyses of mass-corrected trabecular bone variables reveal that the forager populations had significantly higher bone volume fraction, thicker trabeculae, and consequently lower relative bone surface area compared with the two agriculturalist groups. There were no significant differences between the agriculturalist and forager populations for trabecular spacing, number, or degree of anisotropy. These results reveal a correspondence between human behavior and bone structure in the proximal femur, indicating that more highly mobile human populations have trabecular bone structure similar to what would be expected for wild nonhuman primates of the same body mass. These results strongly emphasize the importance of physical activity and exercise for bone health and the attenuation of age-related bone loss.

Craniometric ratios of microcephaly and LB1, Homo floresiensis, using MRI and endocasts

Science.gov (United States)

Vannucci, Robert C.; Barron, Todd F.; Holloway, Ralph L.

2011-01-01

The designation of Homo floresiensis as a new species derived from an ancient population is controversial, because the type specimen, LB1, might represent a pathological microcephalic modern Homo sapiens. Accordingly, two specific craniometric ratios (relative frontal breadth and cerebellar protrusion) were ascertained in 21 microcephalic infants and children by using MRI. Data on 118 age-equivalent control (normocephalic) subjects were collected for comparative purposes. In addition, the same craniometric ratios were determined on the endocasts of 10 microcephalic individuals, 79 normal controls (anatomically modern humans), and 17 Homo erectus specimens. These ratios were then compared with those of two LB1 endocasts. The findings showed that the calculated cerebral/cerebellar ratios of the LB1 endocast [Falk D, et al. (2007) Proc Natl Acad Sci USA 104:2513–2518] fall outside the range of living normocephalic individuals. The ratios derived from two LB1 endocasts also fall largely outside the range of modern normal human and H. erectus endocasts and within the range of microcephalic endocasts. The findings support but do not prove the contention that LB1 represents a pathological microcephalic Homo sapiens rather than a new species, (i.e., H. floresiensis). PMID:21825126

Greater Emphasis on Female Attractiveness in Homo Sapiens: A Revised Solution to an Old Evolutionary Riddle

Directory of Open Access Journals (Sweden)

Jonathan Gottschall

2007-04-01

Full Text Available Substantial evidence from psychology and cross-cultural anthropology supports a general rule of greater emphasis on female physical attractiveness in Homo sapiens. As sensed by Darwin (1871 and clarified by Trivers (1972, generally higher female parental investment is a key determinant of a common pattern of sexual selection in which male animals are more competitive, more eager sexually and more conspicuous in courtship display, ornamentation, and coloration. Therefore, given the larger minimal and average parental investment of human females, keener physical attractiveness pressure among women has long been considered an evolutionary riddle. This paper briefly surveys previous thinking on the question, before offering a revised explanation for why we should expect humans to sharply depart from general zoological pattern of greater emphasis on male attractiveness. This contribution hinges on the argument that humans have been seen as anomalies mainly because we have been held up to the wrong zoological comparison groups. I argue that humans are a partially sex-role reversed species, and more emphasis on female physical attractiveness is relatively common in such species. This solution to the riddle, like those of other evolutionists, is based on peculiarities in human mating behavior, so this paper is also presented as a refinement of current thinking about the evolution of human mating preferences.

Improved analyses of human mtDNA sequences support a recent African origin for Homo sapiens.

Science.gov (United States)

Penny, D; Steel, M; Waddell, P J; Hendy, M D

1995-09-01

New quantitative methods are applied to the 135 human mitochondrial sequences from the Vigilant et al. data set. General problems in analyzing large numbers of short sequences are discussed, and an improved strategy is suggested. A key feature is to focus not on individual trees but on the general "landscape" of trees. Over 1,000 searches were made from random starting trees with only one tree (a local optimum) being retained each time, thereby ensuring optima were found independently. A new tree comparison metric was developed that is unaffected by rearrangements of trees around many very short internal edges. Use of this metric showed that downweighting hypervariable sites revealed more evolutionary structure than studies that weighted all sites equally. Our results are consistent with convergence toward a global optimum. Crucial features are that the best optima show very strong regional differentiation, a common group of 49 African sequences is found in all the best optima, and the best optima contain the 16 !Kung sequences in a separate group of San people. The other 86 sequences form a heterogeneous mixture of Africans, Europeans, Australopapuans, and Asians. Thus all major human lineages occur in Africa, but only a subset occurs in the rest of the world. The existence of these African-only groups strongly contradicts multiregional theories for the origin of Homo sapiens that require widespread migration and interbreeding over the entire range of H. erectus. Only when the multiregional model is rejected is it appropriate to consider the root, based on a single locus, to be the center of origin of a population (otherwise different loci could give alternative geographic positions for the root). For this data, several methods locate the root within the group of 49 African sequences and are thus consistent with the recent African origin of H. sapiens. We demonstrate that the time of the last common ancestor cannot be the time of major expansion in human numbers

On the interconnection of stable protein complexes: inter-complex hubs and their conservation in Saccharomyces cerevisiae and Homo sapiens networks.

Science.gov (United States)

Guerra, Concettina

2015-01-01

Protein complexes are key molecular entities that perform a variety of essential cellular functions. The connectivity of proteins within a complex has been widely investigated with both experimental and computational techniques. We developed a computational approach to identify and characterise proteins that play a role in interconnecting complexes. We computed a measure of inter-complex centrality, the crossroad index, based on disjoint paths connecting proteins in distinct complexes and identified inter-complex hubs as proteins with a high value of the crossroad index. We applied the approach to a set of stable complexes in Saccharomyces cerevisiae and in Homo sapiens. Just as done for hubs, we evaluated the topological and biological properties of inter-complex hubs addressing the following questions. Do inter-complex hubs tend to be evolutionary conserved? What is the relation between crossroad index and essentiality? We found a good correlation between inter-complex hubs and both evolutionary conservation and essentiality.

Spatial and temporal variation of body size among early Homo.

Science.gov (United States)

Will, Manuel; Stock, Jay T

2015-05-01

The estimation of body size among the earliest members of the genus Homo (2.4-1.5Myr [millions of years ago]) is central to interpretations of their biology. It is widely accepted that Homo ergaster possessed increased body size compared with Homo habilis and Homo rudolfensis, and that this may have been a factor involved with the dispersal of Homo out of Africa. The study of taxonomic differences in body size, however, is problematic. Postcranial remains are rarely associated with craniodental fossils, and taxonomic attributions frequently rest upon the size of skeletal elements. Previous body size estimates have been based upon well-preserved specimens with a more reliable species assessment. Since these samples are small (n Koobi Fora after 1.7Myr, indicating regional size variation. The significant body size differences between specimens from Koobi Fora and Olduvai support the cranial evidence for at least two co-existing morphotypes in the Early Pleistocene of eastern Africa. Copyright © 2015 Elsevier Ltd. All rights reserved.

Discrimination of artificial categories structured by family resemblances: a comparative study in people (Homo sapiens) and pigeons (Columba livia).

Science.gov (United States)

Makino, Hiroshi; Jitsumori, Masako

2007-02-01

Adult humans (Homo sapiens) and pigeons (Columba livia) were trained to discriminate artificial categories that the authors created by mimicking 2 properties of natural categories. One was a family resemblance relationship: The highly variable exemplars, including those that did not have features in common, were structured by a similarity network with the features correlating to one another in each category. The other was a polymorphous rule: No single feature was essential for distinguishing the categories, and all the features overlapped between the categories. Pigeons learned the categories with ease and then showed a prototype effect in accord with the degrees of family resemblance for novel stimuli. Some evidence was also observed for interactive effects of learning of individual exemplars and feature frequencies. Humans had difficulty in learning the categories. The participants who learned the categories generally responded to novel stimuli in an all-or-none fashion on the basis of their acquired classification decision rules. The processes that underlie the classification performances of the 2 species are discussed.

Sapiens a brief history of humankind

CERN Document Server

Harari, Yuval Noah

2015-01-01

From a renowned historian comes a groundbreaking narrative of humanity’s creation and evolution—a #1 international bestseller—that explores the ways in which biology and history have defined us and enhanced our understanding of what it means to be “human.” One hundred thousand years ago, at least six different species of humans inhabited Earth. Yet today there is only one—homo sapiens. What happened to the others? And what may happen to us? Most books about the history of humanity pursue either a historical or a biological approach, but Dr. Yuval Noah Harari breaks the mold with this highly original book that begins about 70,000 years ago with the appearance of modern cognition. From examining the role evolving humans have played in the global ecosystem to charting the rise of empires, Sapiens integrates history and science to reconsider accepted narratives, connect past developments with contemporary concerns, and examine specific events within the context of larger ideas. Dr. Harari also comp...

Associated ilium and femur from Koobi Fora, Kenya, and postcranial diversity in early Homo

OpenAIRE

Ward, C.V.; Feibel, C.S.; Hammond, A.S.; Leakey, L.N.; Moffett, E.A.; Plavcan, J.M.; Skinner, Matthew M.; Spoor, F.; Leakey, M.G.

2015-01-01

During the evolution of hominins, it is generally accepted that there was a shift in postcranial morphology between Australopithecus and the genus Homo. Given the scarcity of associated remains of early Homo, however, relatively little is known about early Homo postcranial morphology. There are hints of postcranial diversity among species, but our knowledge of the nature and extent of potential differences is limited. Here we present a new associated partial ilium and femur from Koobi Fora, K...

Utilization of Boron Compounds for the Modification of Suberoyl Anilide Hydroxamic Acid as Inhibitor of Histone Deacetylase Class II Homo sapiens

Science.gov (United States)

Bakri, Ridla; Parikesit, Arli Aditya; Satriyanto, Cipta Prio; Kerami, Djati; Tambunan, Usman Sumo Friend

2014-01-01

Histone deacetylase (HDAC) has a critical function in regulating gene expression. The inhibition of HDAC has developed as an interesting anticancer research area that targets biological processes such as cell cycle, apoptosis, and cell differentiation. In this study, an HDAC inhibitor that is available commercially, suberoyl anilide hydroxamic acid (SAHA), has been modified to improve its efficacy and reduce the side effects of the compound. Hydrophobic cap and zinc-binding group of these compounds were substituted with boron-based compounds, whereas the linker region was substituted with p-aminobenzoic acid. The molecular docking analysis resulted in 8 ligands with ΔG binding value more negative than the standards, SAHA and trichostatin A (TSA). That ligands were analyzed based on the nature of QSAR, pharmacological properties, and ADME-Tox. It is conducted to obtain a potent inhibitor of HDAC class II Homo sapiens. The screening process result gave one best ligand, Nova2 (513246-99-6), which was then further studied by molecular dynamics simulations. PMID:25214833

Crystal Structure of the Homo sapiens Kynureninase-3-Hydroxyhippuric Acid Inhibitor Complex: Insights into the Molecular Basis Of Kynureninase Substrate Specificity

Energy Technology Data Exchange (ETDEWEB)

Lima,Santiago; Kumar,Sunil; Gawandi,Vijay; Momany,Cory; Phillips,Robert S.; (Georgia)

2009-02-23

Homo sapiens kynureninase is a pyridoxal-5'-phosphate dependent enzyme that catalyzes the hydrolytic cleavage of 3-hydroxykynurenine to yield 3-hydroxyanthranilate and L-alanine as part of the tryptophan catabolic pathway leading to the de novo biosynthesis of NAD{sup +}. This pathway results in quinolinate, an excitotoxin that is an NMDA receptor agonist. High levels of quinolinate have been correlated with the etiology of neurodegenerative disorders such as AIDS-related dementia and Alzheimer's disease. We have synthesized a novel kynureninase inhibitor, 3-hydroxyhippurate, cocrystallized it with human kynureninase, and solved the atomic structure. On the basis of an analysis of the complex, we designed a series of His-102, Ser-332, and Asn-333 mutants. The H102W/N333T and H102W/S332G/N333T mutants showed complete reversal of substrate specificity between 3-hydroxykynurenine and L-kynurenine, thus defining the primary residues contributing to substrate specificity in kynureninases.

Optimization of mNeonGreen for Homo sapiens increases its fluorescent intensity in mammalian cells.

Science.gov (United States)

Tanida-Miyake, Emiko; Koike, Masato; Uchiyama, Yasuo; Tanida, Isei

2018-01-01

Green fluorescent protein (GFP) is tremendously useful for investigating many cellular and intracellular events. The monomeric GFP mNeonGreen is about 3- to 5-times brighter than GFP and monomeric enhanced GFP and shows high photostability. The maturation half-time of mNeonGreen is about 3-fold faster than that of monomeric enhanced GFP. However, the cDNA sequence encoding mNeonGreen contains some codons that are rarely used in Homo sapiens. For better expression of mNeonGreen in human cells, we synthesized a human-optimized cDNA encoding mNeonGreen and generated an expression plasmid for humanized mNeonGreen under the control of the cytomegalovirus promoter. The resultant plasmid was introduced into HEK293 cells. The fluorescent intensity of humanized mNeonGreen was about 1.4-fold higher than that of the original mNeonGreen. The humanized mNeonGreen with a mitochondria-targeting signal showed mitochondrial distribution of mNeonGreen. We further generated an expression vector of humanized mNeonGreen with 3xFLAG tags at its carboxyl terminus as these tags are useful for immunological analyses. The 3xFLAG-tagged mNeonGreen was recognized well with an anti-FLAG-M2 antibody. These plasmids for the expression of humanized mNeonGreen and mNeonGreen-3xFLAG are useful tools for biological studies in mammalian cells using mNeonGreen.

Structural modeling and docking studies of ribose 5-phosphate isomerase from Leishmania major and Homo sapiens: a comparative analysis for Leishmaniasis treatment.

Science.gov (United States)

Capriles, Priscila V S Z; Baptista, Luiz Phillippe R; Guedes, Isabella A; Guimarães, Ana Carolina R; Custódio, Fabio L; Alves-Ferreira, Marcelo; Dardenne, Laurent E

2015-02-01

Leishmaniases are caused by protozoa of the genus Leishmania and are considered the second-highest cause of death worldwide by parasitic infection. The drugs available for treatment in humans are becoming ineffective mainly due to parasite resistance; therefore, it is extremely important to develop a new chemotherapy against these parasites. A crucial aspect of drug design development is the identification and characterization of novel molecular targets. In this work, through an in silico comparative analysis between the genomes of Leishmania major and Homo sapiens, the enzyme ribose 5-phosphate isomerase (R5PI) was indicated as a promising molecular target. R5PI is an important enzyme that acts in the pentose phosphate pathway and catalyzes the interconversion of d-ribose-5-phosphate (R5P) and d-ribulose-5-phosphate (5RP). R5PI activity is found in two analogous groups of enzymes called RpiA (found in H. sapiens) and RpiB (found in L. major). Here, we present the first report of the three-dimensional (3D) structures and active sites of RpiB from L. major (LmRpiB) and RpiA from H. sapiens (HsRpiA). Three-dimensional models were constructed by applying a hybrid methodology that combines comparative and ab initio modeling techniques, and the active site was characterized based on docking studies of the substrates R5P (furanose and ring-opened forms) and 5RP. Our comparative analyses show that these proteins are structural analogs and that distinct residues participate in the interconversion of R5P and 5RP. We propose two distinct reaction mechanisms for the reversible isomerization of R5P to 5RP, which is catalyzed by LmRpiB and HsRpiA. We expect that the present results will be important in guiding future molecular modeling studies to develop new drugs that are specially designed to inhibit the parasitic form of the enzyme without significant effects on the human analog. Copyright © 2014 Elsevier Inc. All rights reserved.

Tissue-Specific Methylation of Long Interspersed Nucleotide Element-1 of Homo Sapiens (L1Hs) During Human Embryogenesis and Roles in Neural Tube Defects.

Science.gov (United States)

Wang, L; Chang, S; Guan, J; Shangguan, S; Lu, X; Wang, Z; Wu, L; Zou, J; Zhao, H; Bao, Y; Qiu, Z; Niu, B; Zhang, T

2015-01-01

Epigenetic regulation of long interspersed nucleotide element-1 (LINE-1) retrotransposition events plays crucial roles during early development. Previously we showed that LINE-1 hypomethylation in neuronal tissues is associated with pathogenesis of neural tube defect (NTD). Herein, we further evaluated LINE-1 Homo sapiens (L1Hs) methylation in tissues derived from three germ layers of stillborn NTD fetuses, to define patterns of tissue specific methylation and site-specific hypomethylation at CpG sites within an L1Hs promoter region. Stable, tissue-specific L1Hs methylation patterns throughout three germ layer lineages of the fetus, placenta, and maternal peripheral blood were observed. Samples from maternal peripheral blood exhibited the highest level of L1Hs methylation (64.95%) and that from placenta showed the lowest (26.82%). Between samples from NTDs and controls, decrease in L1Hs methylation was only significant in NTD-affected brain tissue at 7.35%, especially in females (8.98%). L1Hs hypomethylation in NTDs was also associated with a significant increase in expression level of an L1Hs-encoded transcript in females (r = -0.846, p = 0.004). This could be due to genomic DNA instability and alternation in chromatins accessibility resulted from abnormal L1Hs hypomethylation, as showed in this study with HCT-15 cells treated with methylation inhibitor 5-Aza.

New fossils from Koobi Fora in northern Kenya confirm taxonomic diversity in early Homo.

Science.gov (United States)

Leakey, Meave G; Spoor, Fred; Dean, M Christopher; Feibel, Craig S; Antón, Susan C; Kiarie, Christopher; Leakey, Louise N

2012-08-09

Since its discovery in 1972 (ref. 1), the cranium KNM-ER 1470 has been at the centre of the debate over the number of species of early Homo present in the early Pleistocene epoch of eastern Africa. KNM-ER 1470 stands out among other specimens attributed to early Homo because of its larger size, and its flat and subnasally orthognathic face with anteriorly placed maxillary zygomatic roots. This singular morphology and the incomplete preservation of the fossil have led to different views as to whether KNM-ER 1470 can be accommodated within a single species of early Homo that is highly variable because of sexual, geographical and temporal factors, or whether it provides evidence of species diversity marked by differences in cranial size and facial or masticatory adaptation. Here we report on three newly discovered fossils, aged between 1.78 and 1.95 million years (Myr) old, that clarify the anatomy and taxonomic status of KNM-ER 1470. KNM-ER 62000, a well-preserved face of a late juvenile hominin, closely resembles KNM-ER 1470 but is notably smaller. It preserves previously unknown morphology, including moderately sized, mesiodistally long postcanine teeth. The nearly complete mandible KNM-ER 60000 and mandibular fragment KNM-ER 62003 have a dental arcade that is short anteroposteriorly and flat across the front, with small incisors; these features are consistent with the arcade morphology of KNM-ER 1470 and KNM-ER 62000. The new fossils confirm the presence of two contemporary species of early Homo, in addition to Homo erectus, in the early Pleistocene of eastern Africa.

Genetics and the making of Homo sapiens.

Science.gov (United States)

Carroll, Sean B

2003-04-24

Understanding the genetic basis of the physical and behavioural traits that distinguish humans from other primates presents one of the great new challenges in biology. Of the millions of base-pair differences between humans and chimpanzees, which particular changes contributed to the evolution of human features after the separation of the Pan and Homo lineages 5-7 million years ago? How can we identify the 'smoking guns' of human genetic evolution from neutral ticks of the molecular evolutionary clock? The magnitude and rate of morphological evolution in hominids suggests that many independent and incremental developmental changes have occurred that, on the basis of recent findings in model animals, are expected to be polygenic and regulatory in nature. Comparative genomics, population genetics, gene-expression analyses and medical genetics have begun to make complementary inroads into the complex genetic architecture of human evolution.

Leukotriene signaling in the extinct human subspecies Homo denisovan and Homo neanderthalensis. Structural and functional comparison with Homo sapiens.

Science.gov (United States)

Adel, Susan; Kakularam, Kumar Reddy; Horn, Thomas; Reddanna, Pallu; Kuhn, Hartmut; Heydeck, Dagmar

2015-01-01

Mammalian lipoxygenases (LOXs) have been implicated in cell differentiation and in the biosynthesis of pro- and anti-inflammatory lipid mediators. The initial draft sequence of the Homo neanderthalensis genome (coverage of 1.3-fold) suggested defective leukotriene signaling in this archaic human subspecies since expression of essential proteins appeared to be corrupted. Meanwhile high quality genomic sequence data became available for two extinct human subspecies (H. neanderthalensis, Homo denisovan) and completion of the human 1000 genome project provided a comprehensive database characterizing the genetic variability of the human genome. For this study we extracted the nucleotide sequences of selected eicosanoid relevant genes (ALOX5, ALOX15, ALOX12, ALOX15B, ALOX12B, ALOXE3, COX1, COX2, LTA4H, LTC4S, ALOX5AP, CYSLTR1, CYSLTR2, BLTR1, BLTR2) from the corresponding databases. Comparison of the deduced amino acid sequences in connection with site-directed mutagenesis studies and structural modeling suggested that the major enzymes and receptors of leukotriene signaling as well as the two cyclooxygenase isoforms were fully functional in these two extinct human subspecies. Copyright © 2014 Elsevier Inc. All rights reserved.

Similar Efficacies of Selection Shape Mitochondrial and Nuclear Genes in Both Drosophila melanogaster and Homo sapiens.

Science.gov (United States)

Cooper, Brandon S; Burrus, Chad R; Ji, Chao; Hahn, Matthew W; Montooth, Kristi L

2015-08-21

Deleterious mutations contribute to polymorphism even when selection effectively prevents their fixation. The efficacy of selection in removing deleterious mitochondrial mutations from populations depends on the effective population size (Ne) of the mitochondrial DNA and the degree to which a lack of recombination magnifies the effects of linked selection. Using complete mitochondrial genomes from Drosophila melanogaster and nuclear data available from the same samples, we reexamine the hypothesis that nonrecombining animal mitochondrial DNA harbor an excess of deleterious polymorphisms relative to the nuclear genome. We find no evidence of recombination in the mitochondrial genome, and the much-reduced level of mitochondrial synonymous polymorphism relative to nuclear genes is consistent with a reduction in Ne. Nevertheless, we find that the neutrality index, a measure of the excess of nonsynonymous polymorphism relative to the neutral expectation, is only weakly significantly different between mitochondrial and nuclear loci. This difference is likely the result of the larger proportion of beneficial mutations in X-linked relative to autosomal loci, and we find little to no difference between mitochondrial and autosomal neutrality indices. Reanalysis of published data from Homo sapiens reveals a similar lack of a difference between the two genomes, although previous studies have suggested a strong difference in both species. Thus, despite a smaller Ne, mitochondrial loci of both flies and humans appear to experience similar efficacies of purifying selection as do loci in the recombining nuclear genome. Copyright © 2015 Cooper et al.

Significance of some previously unrecognized apomorphies in the nasal region of Homo neanderthalensis.

OpenAIRE

Schwartz, J H; Tattersall, I

1996-01-01

For many years, the Neanderthals have been recognized as a distinctive extinct hominid group that occupied Europe and western Asia between about 200,000 and 30,000 years ago. It is still debated, however, whether these hominids belong in their own species, Homo neanderthalensis, or represent an extinct variant of Homo sapiens. Our ongoing studies indicate that the Neanderthals differ from modern humans in their skeletal anatomy in more ways than have been recognized up to now. The purpose of ...

Post-cranial skeletons of hypothyroid cretins show a similar anatomical mosaic as Homo floresiensis.

Science.gov (United States)

Oxnard, Charles; Obendorf, Peter J; Kefford, Ben J

2010-09-27

Human remains, some as recent as 15 thousand years, from Liang Bua (LB) on the Indonesian island of Flores have been attributed to a new species, Homo floresiensis. The definition includes a mosaic of features, some like modern humans (hence derived: genus Homo), some like modern apes and australopithecines (hence primitive: not species sapiens), and some unique (hence new species: floresiensis). Conversely, because only modern humans (H. sapiens) are known in this region in the last 40 thousand years, these individuals have also been suggested to be genetic human dwarfs. Such dwarfs resemble small humans and do not show the mosaic combination of the most complete individuals, LB1 and LB6, so this idea has been largely dismissed. We have previously shown that some features of the cranium of hypothyroid cretins are like those of LB1. Here we examine cretin postcrania to see if they show anatomical mosaics like H. floresiensis. We find that hypothyroid cretins share at least 10 postcranial features with Homo floresiensis and unaffected humans not found in apes (or australopithecines when materials permit). They share with H. floresiensis, modern apes and australopithecines at least 11 postcranial features not found in unaffected humans. They share with H. floresiensis, at least 8 features not found in apes, australopithecines or unaffected humans. Sixteen features can be rendered metrically and multivariate analyses demonstrate that H. floresiensis co-locates with cretins, both being markedly separate from humans and chimpanzees (P0.999). We therefore conclude that LB1 and LB6, at least, are, most likely, endemic cretins from a population of unaffected Homo sapiens. This is consistent with recent hypothyroid endemic cretinism throughout Indonesia, including the nearby island of Bali.

Post-cranial skeletons of hypothyroid cretins show a similar anatomical mosaic as Homo floresiensis.

Directory of Open Access Journals (Sweden)

Charles Oxnard

Full Text Available Human remains, some as recent as 15 thousand years, from Liang Bua (LB on the Indonesian island of Flores have been attributed to a new species, Homo floresiensis. The definition includes a mosaic of features, some like modern humans (hence derived: genus Homo, some like modern apes and australopithecines (hence primitive: not species sapiens, and some unique (hence new species: floresiensis. Conversely, because only modern humans (H. sapiens are known in this region in the last 40 thousand years, these individuals have also been suggested to be genetic human dwarfs. Such dwarfs resemble small humans and do not show the mosaic combination of the most complete individuals, LB1 and LB6, so this idea has been largely dismissed. We have previously shown that some features of the cranium of hypothyroid cretins are like those of LB1. Here we examine cretin postcrania to see if they show anatomical mosaics like H. floresiensis. We find that hypothyroid cretins share at least 10 postcranial features with Homo floresiensis and unaffected humans not found in apes (or australopithecines when materials permit. They share with H. floresiensis, modern apes and australopithecines at least 11 postcranial features not found in unaffected humans. They share with H. floresiensis, at least 8 features not found in apes, australopithecines or unaffected humans. Sixteen features can be rendered metrically and multivariate analyses demonstrate that H. floresiensis co-locates with cretins, both being markedly separate from humans and chimpanzees (P0.999. We therefore conclude that LB1 and LB6, at least, are, most likely, endemic cretins from a population of unaffected Homo sapiens. This is consistent with recent hypothyroid endemic cretinism throughout Indonesia, including the nearby island of Bali.

Homo erectus in Salkhit, Mongolia?

Science.gov (United States)

Lee, Sang-Hee

2015-08-01

In 2006, a skullcap was discovered in Salkhit, Mongolia. The Salkhit skullcap has a mostly complete frontal, two partially complete parietals, and nasals. No chronometric dating has been published yet, and suggested dates range from early Middle Pleistocene to terminal Late Pleistocene. While no chronometric date has been published, the presence of archaic features has led to a potential affiliation with archaic hominin species. If it is indeed Homo erectus or archaic Homo sapiens, Salkhit implies a much earlier spread of hominins farther north and inland Asia than previously thought. In this paper, the nature of the archaic features in Salkhit is investigated. The Salkhit skullcap morphology and metrics were compared with Middle and Late Pleistocene hominin fossils from northeast Asia: Zhoukoudian Locality 1, Dali, and Zhoukoudian Upper Cave. Results show an interesting pattern: on one hand, the archaic features that Salkhit shares with the Zhoukoudian Locality 1 sample also are shared with other later hominins; on the other hand, Salkhit is different from the Middle Pleistocene materials in the same way later hominins differ from the Middle Pleistocene sample, in having a broader frontal and thinner supraorbital region. This may reflect encephalization and gracilization, a modernization trend found in many places. It is concluded that the archaic features observed in Salkhit are regionally predominant features rather than diagnostic features of an archaic species. Copyright © 2015 Elsevier GmbH. All rights reserved.

What meaning means for same and different: Analogical reasoning in humans (Homo sapiens), chimpanzees (Pan troglodytes), and rhesus monkeys (Macaca mulatta).

Science.gov (United States)

Flemming, Timothy M; Beran, Michael J; Thompson, Roger K R; Kleider, Heather M; Washburn, David A

2008-05-01

Thus far, language- and token-trained apes (e.g., D. Premack, 1976; R. K. R. Thompson, D. L. Oden, & S. T. Boysen, 1997) have provided the best evidence that nonhuman animals can solve, complete, and construct analogies, thus implicating symbolic representation as the mechanism enabling the phenomenon. In this study, the authors examined the role of stimulus meaning in the analogical reasoning abilities of three different primate species. Humans (Homo sapiens), chimpanzees (Pan troglodytes), and rhesus monkeys (Macaca mulatta) completed the same relational matching-to-sample (RMTS) tasks with both meaningful and nonmeaningful stimuli. This discrimination of relations-between-relations serves as the basis for analogical reasoning. Meaningfulness facilitated the acquisition of analogical matching for human participants, whereas individual differences among the chimpanzees suggest that meaning can either enable or hinder their ability to complete analogies. Rhesus monkeys did not succeed in the RMTS task regardless of stimulus meaning, suggesting that their ability to reason analogically, if present at all, may be dependent on a dimension other than the representational value of stimuli. PsycINFO Database Record (c) 2008 APA, all rights reserved.

Molar macrowear reveals Neanderthal eco-geographic dietary variation.

Directory of Open Access Journals (Sweden)

Luca Fiorenza

Full Text Available Neanderthal diets are reported to be based mainly on the consumption of large and medium sized herbivores, while the exploitation of other food types including plants has also been demonstrated. Though some studies conclude that early Homo sapiens were active hunters, the analyses of faunal assemblages, stone tool technologies and stable isotopic studies indicate that they exploited broader dietary resources than Neanderthals. Whereas previous studies assume taxon-specific dietary specializations, we suggest here that the diet of both Neanderthals and early Homo sapiens is determined by ecological conditions. We analyzed molar wear patterns using occlusal fingerprint analysis derived from optical 3D topometry. Molar macrowear accumulates during the lifespan of an individual and thus reflects diet over long periods. Neanderthal and early Homo sapiens maxillary molar macrowear indicates strong eco-geographic dietary variation independent of taxonomic affinities. Based on comparisons with modern hunter-gatherer populations with known diets, Neanderthals as well as early Homo sapiens show high dietary variability in Mediterranean evergreen habitats but a more restricted diet in upper latitude steppe/coniferous forest environments, suggesting a significant consumption of high protein meat resources.

Dental topography and diets of Australopithecus afarensis and early Homo.

Science.gov (United States)

Ungar, Peter

2004-05-01

Diet is key to understanding the paleoecology of early hominins. We know little about the diets of these fossil taxa, however, in part because of a limited fossil record, and in part because of limitations in methods available to infer their feeding adaptations. This paper applies a new method, dental topographic analysis, to the inference of diet from fossil hominin teeth. This approach uses laser scanning to generate digital 3D models of teeth and geographic information systems software to measure surface attributes, such as slope and occlusal relief. Because it does not rely on specific landmarks that change with wear, dental topographic analysis allows measurement and comparison of variably worn teeth, greatly increasing sample sizes compared with techniques that require unworn teeth. This study involved comparison of occlusal slope and relief of the lower second molars of Australopithecus afarensis (n=15) and early Homo (n=8) with those of Gorilla gorilla gorilla (n=47) and Pan troglodytes troglodytes (n=54). Results indicate that while all groups show reduced slope and relief in progressively more worn specimens, there are consistent differences at given wear stages among the taxa. Early Homo shows steeper slopes and more relief than chimpanzees, whereas A. afarensis shows less slope and relief than any of the other groups. The differences between the two hominin taxa are on the same order as those between the extant apes, suggesting similar degrees of difference in diet. Because these chimpanzees and gorillas differ mostly in fallback foods where they are sympatric, results suggest that the early hominins may likewise have differed mostly in fallback foods, with A. afarensis emphasizing harder, more brittle foods, and early Homo relying on tougher, more elastic foods.

Spinal cord evolution in early Homo.

Science.gov (United States)

Meyer, Marc R; Haeusler, Martin

2015-11-01

The discovery at Nariokotome of the Homo erectus skeleton KNM-WT 15000, with a narrow spinal canal, seemed to show that this relatively large-brained hominin retained the primitive spinal cord size of African apes and that brain size expansion preceded postcranial neurological evolution. Here we compare the size and shape of the KNM-WT 15000 spinal canal with modern and fossil taxa including H. erectus from Dmanisi, Homo antecessor, the European middle Pleistocene hominins from Sima de los Huesos, and Pan troglodytes. In terms of shape and absolute and relative size of the spinal canal, we find all of the Dmanisi and most of the vertebrae of KNM-WT 15000 are within the human range of variation except for the C7, T2, and T3 of KNM-WT 15000, which are constricted, suggesting spinal stenosis. While additional fossils might definitively indicate whether H. erectus had evolved a human-like enlarged spinal canal, the evidence from the Dmanisi spinal canal and the unaffected levels of KNM-WT 15000 show that unlike Australopithecus, H. erectus had a spinal canal size and shape equivalent to that of modern humans. Subadult status is unlikely to affect our results, as spinal canal growth is complete in both individuals. We contest the notion that vertebrae yield information about respiratory control or language evolution, but suggest that, like H. antecessor and European middle Pleistocene hominins from Sima de los Huesos, early Homo possessed a postcranial neurological endowment roughly commensurate to modern humans, with implications for neurological, structural, and vascular improvements over Pan and Australopithecus. Copyright © 2015 Elsevier Ltd. All rights reserved.

Hominin teeth from the early Late Pleistocene site of Xujiayao, Northern China.

Science.gov (United States)

Xing, Song; Martinón-Torres, María; Bermúdez de Castro, Jose María; Wu, Xiujie; Liu, Wu

2015-02-01

It is generally accepted that from the late Middle to the early Late Pleistocene (∼340-90 ka BP), Neanderthals were occupying Europe and Western Asia, whereas anatomically modern humans were present in the African continent. In contrast, the paucity of hominin fossil evidence from East Asia from this period impedes a complete evolutionary picture of the genus Homo, as well as assessment of the possible contribution of or interaction with Asian hominins in the evolution of Homo sapiens and Homo neanderthalensis. Here we present a comparative study of a hominin dental sample recovered from the Xujiayao site, in Northern China, attributed to the early Late Pleistocene (MIS 5 to 4). Our dental study reveals a mosaic of primitive and derived dental features for the Xujiayao hominins that can be summarized as follows: i) they are different from archaic and recent modern humans, ii) they present some features that are common but not exclusive to the Neanderthal lineage, and iii) they retain some primitive conformations classically found in East Asian Early and Middle Pleistocene hominins despite their young geological age. Thus, our study evinces the existence in China of a population of unclear taxonomic status with regard to other contemporary populations such as H. sapiens and H. neanderthalensis. The morphological and metric studies of the Xujiayao teeth expand the variability known for early Late Pleistocene hominin fossils and suggest the possibility that a primitive hominin lineage may have survived late into the Late Pleistocene in China. Copyright © 2014 Wiley Periodicals, Inc.

The rhizome of Reclinomonas americana, Homo sapiens, Pediculus humanus and Saccharomyces cerevisiae mitochondria

Directory of Open Access Journals (Sweden)

Raoult Didier

2011-10-01

Full Text Available Abstract Background Mitochondria are thought to have evolved from eubacteria-like endosymbionts; however, the origin of the mitochondrion remains a subject of debate. In this study, we investigated the phenomenon of chimerism in mitochondria to shed light on the origin of these organelles by determining which species played a role in their formation. We used the mitochondria of four distinct organisms, Reclinomonas americana, Homo sapiens, Saccharomyces cerevisiae and multichromosome Pediculus humanus, and attempted to identify the origin of each mitochondrial gene. Results Our results suggest that the origin of mitochondrial genes is not limited to the Rickettsiales and that the creation of these genes did not occur in a single event, but through multiple successive events. Some of these events are very old and were followed by events that are more recent and occurred through the addition of elements originating from current species. The points in time that the elements were added and the parental species of each gene in the mitochondrial genome are different to the individual species. These data constitute strong evidence that mitochondria do not have a single common ancestor but likely have numerous ancestors, including proto-Rickettsiales, proto-Rhizobiales and proto-Alphaproteobacteria, as well as current alphaproteobacterial species. The analysis of the multichromosome P. humanus mitochondrion supports this mechanism. Conclusions The most plausible scenario of the origin of the mitochondrion is that ancestors of Rickettsiales and Rhizobiales merged in a proto-eukaryotic cell approximately one billion years ago. The fusion of the Rickettsiales and Rhizobiales cells was followed by gene loss, genomic rearrangements and the addition of alphaproteobacterial elements through ancient and more recent recombination events. Each gene of each of the four studied mitochondria has a different origin, while in some cases, multichromosomes may allow for

NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-0844 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0844 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OGAR-01-0999 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-0999 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-DNOV-01-2029 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2029 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OGAR-01-0964 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-0964 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-1968 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1968 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-1663 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1663 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-CJAC-01-1667 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1667 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-0265 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0265 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-2458 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-2458 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-HSAP-11-0146 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-11-0146 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-1150 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1150 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OCUN-01-0029 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0029 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-DNOV-01-2275 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2275 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OGAR-01-0573 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-0573 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-FCAT-01-0995 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0995 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-FCAT-01-0442 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0442 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OCUN-01-0191 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0191 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-CFAM-18-0231 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-18-0231 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-RMAC-14-0114 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-14-0114 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-LAFR-01-2889 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-2889 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-ETEL-01-0606 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0606 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-2401 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-2401 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-PTRO-12-0125 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-12-0125 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OCUN-01-1127 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1127 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-PTRO-12-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-12-0131 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-CFAM-21-0240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0240 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-OGAR-01-0162 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-0162 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-TBEL-01-1930 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1930 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-LAFR-01-0512 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-0512 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-HSAP-11-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-11-0137 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

NCBI nr-aa BLAST: CBRC-LAFR-01-0007 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-0007 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

Spatial determinants of the mandibular curve of Spee in modern and archaic Homo.

Science.gov (United States)

Laird, Myra F; Holton, Nathan E; Scott, Jill E; Franciscus, Robert G; Marshall, Steven D; Southard, Thomas E

2016-10-01

The curve of Spee (COS) is a mesio-distally curved alignment of the canine through distal molar cusp tips in certain mammals including modern humans and some fossil hominins. In humans, the alignment varies from concave to flat, and previous studies have suggested that this difference reflects craniofacial morphology, including the degree of alveolar prognathism. However, the relationship between prognathism and concavity of the COS has not been tested in craniofacially variant populations. We tested the hypothesis that greater alveolar prognathism covaries with a flatter COS in African-American and European-American populations. We further examined this relationship in fossil Homo including Homo neanderthalensis and early anatomically modern Homo sapiens, which are expected to extend the amount of variation in the COS from the extant sample. These hypotheses were tested using three-dimensional geometric morphometrics. Landmarks were recorded from the skulls of 166 African-Americans, 123 European-Americans, and 10 fossil hominin mandible casts. Landmarks were subjected to generalized Procrustes analysis, principal components analysis, and two-block partial least squares analysis. We documented covariation between the COS and alveolar prognathism such that relatively prognathic individuals have a flatter COS. Mandibular data from the fossil hominin taxa generally confirm and extend this correlation across a greater range of facial size and morphology in Homo. Our results suggest that the magnitude of the COS is related to a suite of features associated with alveolar prognathism in modern humans and across anthropoids. We also discuss the implications for spatial interactions between the dental arches. © 2016 Wiley Periodicals, Inc.

NCBI nr-aa BLAST: CBRC-OPRI-01-1309 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1309 gb|AAY78477.1| TLR10 [Homo sapiens] gb|AAY78481.1| TLR10 [Homo sapiens...] gb|AAY78489.1| TLR10 [Homo sapiens] gb|AAY78490.1| TLR10 [Homo sapiens] gb|AAY78491.1| TLR10 [Homo sapiens] AAY78477.1 0.0 71% ...

NCBI nr-aa BLAST: CBRC-MDOM-05-0061 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-05-0061 gb|AAY78477.1| TLR10 [Homo sapiens] gb|AAY78481.1| TLR10 [Homo sapiens...] gb|AAY78489.1| TLR10 [Homo sapiens] gb|AAY78490.1| TLR10 [Homo sapiens] gb|AAY78491.1| TLR10 [Homo sapiens] AAY78477.1 0.0 59% ...

NCBI nr-aa BLAST: CBRC-MEUG-01-1110 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1110 gb|AAY78477.1| TLR10 [Homo sapiens] gb|AAY78481.1| TLR10 [Homo sapiens...] gb|AAY78489.1| TLR10 [Homo sapiens] gb|AAY78490.1| TLR10 [Homo sapiens] gb|AAY78491.1| TLR10 [Homo sapiens] AAY78477.1 0.0 56% ...

NCBI nr-aa BLAST: CBRC-PTRO-12-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-12-0131 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 0.0 95% ...

NCBI nr-aa BLAST: CBRC-PABE-12-0079 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-12-0079 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-HSAP-11-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-11-0137 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 6e-69 49% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1442 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1442 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-77 54% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-0433 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0433 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-176 92% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1335 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1335 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 9e-77 50% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1413 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1413 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 6e-79 50% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-0007 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0007 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-57 52% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-0525 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0525 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-36 45% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-1667 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1667 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-159 84% ...

NCBI nr-aa BLAST: CBRC-PTRO-12-0125 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-12-0125 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-64 46% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-2856 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-2856 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-41 47% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-1150 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1150 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 3e-94 57% ...

NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1283 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1283 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-90 57% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-1264 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1264 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 3e-92 58% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0191 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0191 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-100 59% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-0913 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0913 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-50 41% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-1096 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1096 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 6e-30 36% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-0512 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-0512 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-88 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1086 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1086 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 3e-43 59% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-0125 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-0125 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-85 67% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1154 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1154 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-34 53% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0013 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 5e-45 40% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-0442 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0442 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-101 58% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0279 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0279 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 5e-68 64% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-0639 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0639 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 7e-57 61% ...

NCBI nr-aa BLAST: CBRC-EEUR-01-0127 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0127 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-63 60% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1119 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1119 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 3e-52 63% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-2458 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-2458 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 5e-45 49% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-1930 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1930 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-98 58% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0121 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0121 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-81 55% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1201 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1201 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-49 56% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0101 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0101 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 3e-93 58% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-0487 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0487 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-34 52% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-0472 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0472 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 5e-93 59% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-0268 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0268 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 8e-48 60% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-0844 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0844 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 5e-59 65% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0029 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0029 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-100 59% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0123 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0123 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 2e-66 57% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0902 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0902 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 6e-58 43% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-1685 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-1685 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-38 44% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-1127 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1127 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 7e-94 56% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-3215 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-3215 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-TBEL-01-2154 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-2154 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-ETEL-01-0353 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0353 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-FCAT-01-0282 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0282 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-OLAT-16-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-16-0022 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-PABE-01-0133 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-01-0133 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0569 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-XTRO-01-2431 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-2431 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-EEUR-01-1511 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-1511 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-BTAU-01-3054 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-3054 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-RMAC-01-0015 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-01-0015 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-GGAL-23-0008 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-23-0008 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-HSAP-01-0032 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-01-0032 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-CFAM-02-0024 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-02-0024 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-RNOR-05-0237 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0237 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-PTRO-01-0019 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-01-0019 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-OANA-01-1293 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-1293 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-TGUT-26-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-26-0004 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-CJAC-01-1490 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1490 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-TNIG-22-0071 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-22-0071 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

NCBI nr-aa BLAST: CBRC-MMUS-04-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0074 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

Differential Responding by Rhesus Monkeys (Macaca mulatta and Humans (Homo sapiens to Variable Outcomes in the Assurance Game

Directory of Open Access Journals (Sweden)

Audrey E. Parrish

2014-08-01

Full Text Available Behavioral flexibility in how one responds to variable partner play can be examined using economic coordination games in which subjects play against a variety of partners and therefore may need to alter their behavior to produce the highest payoff. But how do we study this behavioral flexibility once players have settled on a response? Here, we investigated how responding by rhesus monkeys (Macaca mulatta and humans (Homo sapiens playing a computerized single-player version of a coordination game, the Assurance game, changed as a function of the variable responses (Stag/Hare generated by multiple simulations (SIMs. We were interested in whether individuals could track and differentially respond to changing frequencies of Stag and Hare play by the SIMs, especially with regard to the payoff dominant (Stag-Stag outcome, something that could not be done with real partners as they quickly settled on the Stag response. For both monkeys and humans, there was a linear relationship between proportion of Stag play by the subject and the likelihood of the Stag choice by the SIM such that both species increased their use of Stag as the SIM increased its use of the Stag response. However, humans more closely matched their proportion of Stag responses to that of the SIM, whereas monkeys adopted a different, but equally effective, strategy of exploiting the higher-paying Stag alternative. These results suggest that monkeys and humans demonstrate sensitivity to a dynamic game environment in which they encounter variable contingencies for the same response options, although they may employ different strategies to maximize reward.

Repeat polymorphisms in the Homo sapiens heme oxygenase-1 gene in diabetic and idiopathic gastroparesis.

Directory of Open Access Journals (Sweden)

Simon J Gibbons

Full Text Available Idiopathic and diabetic gastroparesis in Homo sapiens cause significant morbidity. Etiology or risk factors have not been clearly identified. Failure to sustain elevated heme oxygenase-1 (HO1 expression is associated with delayed gastric emptying in diabetic mice and polymorphisms in the HO1 gene (HMOX1, NCBI Gene ID:3162 are associated with worse outcomes in other diseases.Our hypothesis was that longer polyGT alleles are more common in the HMOX1 genes of individuals with gastroparesis than in controls without upper gastrointestinal motility disorders.Repeat length was determined in genomic DNA. Controls with diabetes (84 type 1, 84 type 2 and without diabetes (n = 170 were compared to diabetic gastroparetics (99 type 1, 72 type 2 and idiopathic gastroparetics (n = 234. Correlations of repeat lengths with clinical symptom sub-scores on the gastroparesis cardinal symptom index (GCSI were done. Statistical analyses of short (32 repeat alleles and differences in allele length were used to test for associations with gastroparesis.The distribution of allele lengths was different between groups (P = 0.016. Allele lengths were longest in type 2 diabetics with gastroparesis (29.18±0.35, mean ± SEM and longer in gastroparetics compared to non-diabetic controls (28.50±0.14 vs 27.64±0.20 GT repeats/allele, P = 0.0008. Type 2 diabetic controls had longer alleles than non-diabetic controls. In all gastroparetic groups, allele lengths were longer in African Americans compared to other racial groups, differences in the proportion of African Americans in the groups accounted for the differences between gastroparetics and controls. Diabetic gastroparetics with 1 or 2 long alleles had worse GCSI nausea sub-scores (3.30±0.23 as compared to those with 0 long alleles (2.66±0.12, P = 0.022.Longer poly-GT repeats in the HMOX1 gene are more common in African Americans with gastroparesis. Nausea symptoms are worse in subjects with longer alleles.

Repeat polymorphisms in the Homo sapiens heme oxygenase-1 gene in diabetic and idiopathic gastroparesis.

Science.gov (United States)

Gibbons, Simon J; Grover, Madhusudan; Choi, Kyoung Moo; Wadhwa, Akhilesh; Zubair, Adeel; Wilson, Laura A; Wu, Yanhong; Abell, Thomas L; Hasler, William L; Koch, Kenneth L; McCallum, Richard W; Nguyen, Linda A B; Parkman, Henry P; Sarosiek, Irene; Snape, William J; Tonascia, James; Hamilton, Frank A; Pasricha, Pankaj J; Farrugia, Gianrico

2017-01-01

Idiopathic and diabetic gastroparesis in Homo sapiens cause significant morbidity. Etiology or risk factors have not been clearly identified. Failure to sustain elevated heme oxygenase-1 (HO1) expression is associated with delayed gastric emptying in diabetic mice and polymorphisms in the HO1 gene (HMOX1, NCBI Gene ID:3162) are associated with worse outcomes in other diseases. Our hypothesis was that longer polyGT alleles are more common in the HMOX1 genes of individuals with gastroparesis than in controls without upper gastrointestinal motility disorders. Repeat length was determined in genomic DNA. Controls with diabetes (84 type 1, 84 type 2) and without diabetes (n = 170) were compared to diabetic gastroparetics (99 type 1, 72 type 2) and idiopathic gastroparetics (n = 234). Correlations of repeat lengths with clinical symptom sub-scores on the gastroparesis cardinal symptom index (GCSI) were done. Statistical analyses of short (32) repeat alleles and differences in allele length were used to test for associations with gastroparesis. The distribution of allele lengths was different between groups (P = 0.016). Allele lengths were longest in type 2 diabetics with gastroparesis (29.18±0.35, mean ± SEM) and longer in gastroparetics compared to non-diabetic controls (28.50±0.14 vs 27.64±0.20 GT repeats/allele, P = 0.0008). Type 2 diabetic controls had longer alleles than non-diabetic controls. In all gastroparetic groups, allele lengths were longer in African Americans compared to other racial groups, differences in the proportion of African Americans in the groups accounted for the differences between gastroparetics and controls. Diabetic gastroparetics with 1 or 2 long alleles had worse GCSI nausea sub-scores (3.30±0.23) as compared to those with 0 long alleles (2.66±0.12), P = 0.022. Longer poly-GT repeats in the HMOX1 gene are more common in African Americans with gastroparesis. Nausea symptoms are worse in subjects with longer alleles.

Repeat polymorphisms in the Homo sapiens heme oxygenase-1 gene in diabetic and idiopathic gastroparesis

Science.gov (United States)

Gibbons, Simon J.; Grover, Madhusudan; Choi, Kyoung Moo; Wadhwa, Akhilesh; Zubair, Adeel; Wilson, Laura A.; Wu, Yanhong; Abell, Thomas L.; Hasler, William L.; Koch, Kenneth L.; McCallum, Richard W.; Nguyen, Linda A. B.; Parkman, Henry P.; Sarosiek, Irene; Snape, William J.; Tonascia, James; Hamilton, Frank A.; Pasricha, Pankaj J.

2017-01-01

Background Idiopathic and diabetic gastroparesis in Homo sapiens cause significant morbidity. Etiology or risk factors have not been clearly identified. Failure to sustain elevated heme oxygenase-1 (HO1) expression is associated with delayed gastric emptying in diabetic mice and polymorphisms in the HO1 gene (HMOX1, NCBI Gene ID:3162) are associated with worse outcomes in other diseases. Aim Our hypothesis was that longer polyGT alleles are more common in the HMOX1 genes of individuals with gastroparesis than in controls without upper gastrointestinal motility disorders. Methods Repeat length was determined in genomic DNA. Controls with diabetes (84 type 1, 84 type 2) and without diabetes (n = 170) were compared to diabetic gastroparetics (99 type 1, 72 type 2) and idiopathic gastroparetics (n = 234). Correlations of repeat lengths with clinical symptom sub-scores on the gastroparesis cardinal symptom index (GCSI) were done. Statistical analyses of short (32) repeat alleles and differences in allele length were used to test for associations with gastroparesis. Results The distribution of allele lengths was different between groups (P = 0.016). Allele lengths were longest in type 2 diabetics with gastroparesis (29.18±0.35, mean ± SEM) and longer in gastroparetics compared to non-diabetic controls (28.50±0.14 vs 27.64±0.20 GT repeats/allele, P = 0.0008). Type 2 diabetic controls had longer alleles than non-diabetic controls. In all gastroparetic groups, allele lengths were longer in African Americans compared to other racial groups, differences in the proportion of African Americans in the groups accounted for the differences between gastroparetics and controls. Diabetic gastroparetics with 1 or 2 long alleles had worse GCSI nausea sub-scores (3.30±0.23) as compared to those with 0 long alleles (2.66±0.12), P = 0.022. Conclusions Longer poly-GT repeats in the HMOX1 gene are more common in African Americans with gastroparesis. Nausea symptoms are worse in

Complementation of Myelodysplastic Syndrome Clones with Lentivirus Expression Libraries

Science.gov (United States)

2013-01-01

Description HRAS Homo sapiens v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript 1 CDC25C Homo sapiens cell division cycle 25...homolog C (CDC25C), transcript variant 1 MYC Homo sapiens v-myc myeloctomatosis viral oncogene homolog (avian) (MYC) MAP3K7 Homo sapiens mitogen...activated protein kinase kinase kinase 7 (MAP3K7) MAP3K8 Homo sapiens mitogen-activated protein kinase kinase kinase 8 (MAP3K8) SF3B1 Homo sapiens

Gene : CBRC-GGOR-01-1364 [SEVENS

Lifescience Database Archive (English)

Full Text Available bradykinin receptor B1 [Homo sapiens] sp|P46663|BKRB1_HUMAN RecName: Full=B1 bradykinin receptor; AltName: ...Full=BK-1 receptor; Short=B1R emb|CAB45650.1| bradykinin B1 receptor [Homo sapiens] dbj|BAC06112.1| seven tr...ansmembrane helix receptor [Homo sapiens] gb|AAH34705.1| Bradykinin receptor B1 [Homo sapi...ens] gb|AAP32296.1| bradykinin receptor B1 [Homo sapiens] gb|EAW81632.1| bradykinin receptor B1 [Homo sapi...1 [synthetic construct] dbj|BAF84659.1| unnamed protein product [Homo sapiens] 1e

Astronomical Theory of Early Human Migration (Milutin Milankovic Medal Lecture)

Science.gov (United States)

Timmermann, Axel; Friedrich, Tobias

2017-04-01

Our climate system varies on a wide range of timescales, from seasons to several millions of years. A large part of this variability is internally generated as a result of instabilities of the coupled atmosphere-ocean-ice-carbon cycle system. Other modes of variability, such as glacial cycles, are caused by astronomical forcings with periods of 20, 40, 100 thousand years. These so-called Milankovitch Cycles are associated with earth's axis wobble, axis obliquity and shifts in the eccentricity of earth's orbit around the sun, respectively. When these cycles conspire, they can cause the climate system to plunge into an ice-age. This happened last time 110,000 years ago, when Northern Hemisphere summer radiation decreased substantially and ice-sheets started to form as a result. Around 100,000 years ago northern Hemisphere summer moved again closer to the sun and Homo sapiens started to leave Africa across vegetated corridors in Northeastern Africa and the Arabian Peninsula. This first migration wave must have been relatively weak, but it left unequivocal traces in the fossil and archaeological record. Why Homo sapiens embarked on its grand journey across our planet during glacial climate conditions has been subject of an intense debate in various scientific communities. Moreover, the archaeological records of an early exodus around 100 thousand years ago seem to be at odds with paleo-genetic evidences, that place the first dispersal out of Africa around 70-60 thousand years ago. To elucidate what role climate and environmental conditions played in the dispersal of Anatomically Modern Humans out of Africa, we have developed and applied one of the first integrated climate/human migration computer models. The model simulates ice-ages, abrupt climate change, the "peopling" of our planet and captures the arrival time of Homo sapiens in the Levant, Arabian Peninsula, Southern China and Australia in close agreement with paleo climate reconstructions, fossil and

NCBI nr-aa BLAST: CBRC-FCAT-01-1153 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| polycystic kidney and hepatic disease 1 [Homo sapiens] emb|CAH73867.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAH72781.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI16676.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI20324.1| polycystic kidney and hepatic disease 1 (autosomal r...ecessive) [Homo sapiens] emb|CAI20233.1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_619639.3 0.0 76% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-1207 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| polycystic kidney and hepatic disease 1 [Homo sapiens] emb|CAH73867.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAH72781.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI16676.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI20324.1| polycystic kidney and hepatic disease 1 (autosomal r...ecessive) [Homo sapiens] emb|CAI20233.1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_619639.3 0.0 87% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-0677 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0677 ref|NP_055456.2| mediator of DNA-damage checkpoint 1 [Homo sapien...tor with BRCT domains 1 emb|CAI17440.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAI18195.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] gb|EAX03321.1| mediator of DNA ...damage checkpoint 1 [Homo sapiens] emb|CAQ06814.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ06770.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ07572.1| mediator of DNA damage checkpoi

NCBI nr-aa BLAST: CBRC-OCUN-01-1679 [SEVENS

Lifescience Database Archive (English)

Full Text Available ning 1 [Homo sapiens] sp|Q9Y239|NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 (Caspase recruitment...6897.1| unknown [Homo sapiens] gb|EAL24453.1| caspase recruitment domain family, member 4 [Homo sapiens] gb|EAW93945.1| caspase recru...itment domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93946.1| caspase recruitment... domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93947.1| caspase recruitment... domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93949.1| caspase recruitment

Gene : CBRC-GGOR-01-0100 [SEVENS

Lifescience Database Archive (English)

Full Text Available 98% ref|NP_001004479.1| olfactory receptor, family 11, subfamily H, member 4 [Homo sapiens] sp|Q8NGC9|O11H4_...transmembrane helix receptor [Homo sapiens] tpg|DAA04853.1| TPA_inf: olfactory receptor OR14-36 [Homo sapi...ens] gb|EAW66484.1| olfactory receptor, family 11, subfamily H, member 4 [Homo sapi...ens] gb|AAI37056.1| Olfactory receptor, family 11, subfamily H, member 4 [Homo sapiens] gb|AAI37055.1| Olfac...tory receptor, family 11, subfamily H, member 4 [Homo sapiens] dbj|BAI47453.1| ol

NCBI nr-aa BLAST: CBRC-RNOR-05-0227 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0227 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 91% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-2981 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2981 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 90% ...

NCBI nr-aa BLAST: CBRC-RMAC-01-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-01-0022 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-2099 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-2099 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 1e-122 73% ...

NCBI nr-aa BLAST: CBRC-OANA-01-1933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-1933 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 82% ...

NCBI nr-aa BLAST: CBRC-EEUR-01-1563 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-1563 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 88% ...

NCBI nr-aa BLAST: CBRC-CFAM-02-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-02-0020 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 93% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1953 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1953 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 82% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-1463 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1463 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 93% ...

NCBI nr-aa BLAST: CBRC-OGAR-01-0835 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-0835 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 6e-90 91% ...

NCBI nr-aa BLAST: CBRC-PTRO-01-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-01-0025 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 91% ...

NCBI nr-aa BLAST: CBRC-MMUS-04-0069 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0069 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 91% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-1293 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1293 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 93% ...

NCBI nr-aa BLAST: CBRC-HSAP-01-0038 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-01-0038 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-0950 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0950 gb|AAG28020.1| hypocretin receptor-1 [Homo sapiens] gb|AAL47214.1| hypocretin... receptor 1; orexin receptor 1 [Homo sapiens] gb|AAL50221.1| hypocretin receptor 1 [Homo sapiens...] gb|AAH74796.1| Hypocretin (orexin) receptor 1 [Homo sapiens] gb|EAX07602.1| hypocretin (orexin) receptor 1, isoform CRA_c [Homo sapiens] AAG28020.1 0.0 76% ...

Brain shape in human microcephalics and Homo floresiensis.

Science.gov (United States)

Falk, Dean; Hildebolt, Charles; Smith, Kirk; Morwood, M J; Sutikna, Thomas; Jatmiko; Saptomo, E Wayhu; Imhof, Herwig; Seidler, Horst; Prior, Fred

2007-02-13

Because the cranial capacity of LB1 (Homo floresiensis) is only 417 cm(3), some workers propose that it represents a microcephalic Homo sapiens rather than a new species. This hypothesis is difficult to assess, however, without a clear understanding of how brain shape of microcephalics compares with that of normal humans. We compare three-dimensional computed tomographic reconstructions of the internal braincases (virtual endocasts that reproduce details of external brain morphology, including cranial capacities and shape) from a sample of 9 microcephalic humans and 10 normal humans. Discriminant and canonical analyses are used to identify two variables that classify normal and microcephalic humans with 100% success. The classification functions classify the virtual endocast from LB1 with normal humans rather than microcephalics. On the other hand, our classification functions classify a pathological H. sapiens specimen that, like LB1, represents an approximately 3-foot-tall adult female and an adult Basuto microcephalic woman that is alleged to have an endocast similar to LB1's with the microcephalic humans. Although microcephaly is genetically and clinically variable, virtual endocasts from our highly heterogeneous sample share similarities in protruding and proportionately large cerebella and relatively narrow, flattened orbital surfaces compared with normal humans. These findings have relevance for hypotheses regarding the genetic substrates of hominin brain evolution and may have medical diagnostic value. Despite LB1's having brain shape features that sort it with normal humans rather than microcephalics, other shape features and its small brain size are consistent with its assignment to a separate species.

Implications of new early Homo fossils from Ileret, east of Lake Turkana, Kenya.

Science.gov (United States)

Spoor, F; Leakey, M G; Gathogo, P N; Brown, F H; Antón, S C; McDougall, I; Kiarie, C; Manthi, F K; Leakey, L N

2007-08-09

Sites in eastern Africa have shed light on the emergence and early evolution of the genus Homo. The best known early hominin species, H. habilis and H. erectus, have often been interpreted as time-successive segments of a single anagenetic evolutionary lineage. The case for this was strengthened by the discovery of small early Pleistocene hominin crania from Dmanisi in Georgia that apparently provide evidence of morphological continuity between the two taxa. Here we describe two new cranial fossils from the Koobi Fora Formation, east of Lake Turkana in Kenya, that have bearing on the relationship between species of early Homo. A partial maxilla assigned to H. habilis reliably demonstrates that this species survived until later than previously recognized, making an anagenetic relationship with H. erectus unlikely. The discovery of a particularly small calvaria of H. erectus indicates that this taxon overlapped in size with H. habilis, and may have shown marked sexual dimorphism. The new fossils confirm the distinctiveness of H. habilis and H. erectus, independently of overall cranial size, and suggest that these two early taxa were living broadly sympatrically in the same lake basin for almost half a million years.

NCBI nr-aa BLAST: CBRC-PMAR-01-0600 [SEVENS

Lifescience Database Archive (English)

Full Text Available 67.1| unnamed protein product [Homo sapiens] gb|AAH94002.1| Skin aspartic protease [Homo sapiens] gb|AAH94000.1| Skin... aspartic protease [Homo sapiens] gb|EAW99836.1| Skin ASpartic Protease [Homo sapiens] NP_690005.1 0.014 27% ...

NCBI nr-aa BLAST: CBRC-PMAR-01-0741 [SEVENS

Lifescience Database Archive (English)

Full Text Available 67.1| unnamed protein product [Homo sapiens] gb|AAH94002.1| Skin aspartic protease [Homo sapiens] gb|AAH94000.1| Skin... aspartic protease [Homo sapiens] gb|EAW99836.1| Skin ASpartic Protease [Homo sapiens] NP_690005.1 0.023 29% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-0837 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0837 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-120 69% ...

NCBI nr-aa BLAST: CBRC-HSAP-20-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-20-0025 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 0.0 100% ...

NCBI nr-aa BLAST: CBRC-RMAC-10-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-10-0000 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 0.0 94% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-1084 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1084 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-133 73% ...

NCBI nr-aa BLAST: CBRC-ACAR-01-1154 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-1154 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-124 69% ...

NCBI nr-aa BLAST: CBRC-EEUR-01-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0001 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 3e-78 62% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1614 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1614 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-150 79% ...

NCBI nr-aa BLAST: CBRC-TGUT-23-0007 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-23-0007 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-126 70% ...

NCBI nr-aa BLAST: CBRC-MMUS-02-0427 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-02-0427 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 2e-71 53% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-0572 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-0572 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-171 89% ...

NCBI nr-aa BLAST: CBRC-GACU-12-0035 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-12-0035 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-117 69% ...

NCBI nr-aa BLAST: CBRC-PABE-21-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-21-0026 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 0.0 96% ...

NCBI nr-aa BLAST: CBRC-DRER-23-0032 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-23-0032 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-116 68% ...

NCBI nr-aa BLAST: CBRC-GGAL-35-0089 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-35-0089 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-47 72% ...

NCBI nr-aa BLAST: CBRC-PMAR-01-0788 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PMAR-01-0788 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-109 61% ...

NCBI nr-aa BLAST: CBRC-FRUB-02-0580 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0580 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-121 68% ...

NCBI nr-aa BLAST: CBRC-RNOR-03-0524 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-03-0524 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 3e-41 55% ...

NCBI nr-aa BLAST: CBRC-OANA-01-2114 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-2114 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-129 76% ...

NCBI nr-aa BLAST: CBRC-OLAT-07-0045 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-07-0045 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-121 68% ...

NCBI nr-aa BLAST: CBRC-TNIG-22-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-22-0023 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-119 71% ...

NCBI nr-aa BLAST: CBRC-PTRO-21-0027 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-21-0027 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 0.0 99% ...

NCBI nr-aa BLAST: CBRC-DRER-26-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-26-0050 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-122 71% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1415 [SEVENS

Lifescience Database Archive (English)

Full Text Available g protein 1; AltName: Full=Caspase recruitment domain-containing protein 4 gb|AAD28350.1|AF113925_1 Nod1 [Ho...tein [Homo sapiens] gb|AAS46897.1| unknown [Homo sapiens] gb|EAL24453.1| caspase recruitment domain family, ...member 4 [Homo sapiens] gb|EAW93945.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapi...ens] gb|EAW93946.1| caspase recruitment domain family, member 4, isoform CRA_b [H...omo sapiens] gb|EAW93947.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93949.1| caspase recruitm

NCBI nr-aa BLAST: CBRC-OPRI-01-0714 [SEVENS

Lifescience Database Archive (English)

Full Text Available g protein 1; AltName: Full=Caspase recruitment domain-containing protein 4 gb|AAD28350.1|AF113925_1 Nod1 [Ho...tein [Homo sapiens] gb|AAS46897.1| unknown [Homo sapiens] gb|EAL24453.1| caspase recruitment domain family, ...member 4 [Homo sapiens] gb|EAW93945.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapi...ens] gb|EAW93946.1| caspase recruitment domain family, member 4, isoform CRA_b [H...omo sapiens] gb|EAW93947.1| caspase recruitment domain family, member 4, isoform CRA_b [Homo sapiens] gb|EAW93949.1| caspase recruitm

The relative use of proximity, shape similarity, and orientation as visual perceptual grouping cues in tufted capuchin monkeys (Cebus apella) and humans (Homo sapiens).

Science.gov (United States)

Spinozzi, Giovanna; De Lillo, Carlo; Truppa, Valentina; Castorina, Giulia

2009-02-01

Recent experimental results suggest that human and nonhuman primates differ in how they process visual information to assemble component parts into global shapes. To assess whether some of the observed differences in perceptual grouping could be accounted for by the prevalence of different grouping factors in different species, we carried out 2 experiments designed to evaluate the relative use of proximity, similarity of shape, and orientation as grouping cues in humans (Homo sapiens) and capuchin monkeys (Cebus apella). Both species showed similarly high levels of accuracy using proximity as a cue. Moreover, for both species, grouping by orientation similarity produced a lower level of performance than grouping by proximity. Differences emerged with respect to the use of shape similarity as a cue. In humans, grouping by shape similarity also proved less effective than grouping by proximity but the same was not observed in capuchins. These results suggest that there may be subtle differences between humans and capuchin monkeys in the weighting assigned to different grouping cues that may affect the way in which they combine local features into global shapes. Copyright 2009 APA, all rights reserved.

Visible spatial contiguity of social information and reward affects social learning in brown capuchins (Sapajus apella) and children (Homo sapiens).

Science.gov (United States)

Wood, Lara A; Whiten, Andrew

2017-11-01

Animal social learning is typically studied experimentally by the presentation of artificial foraging tasks. Although productive, results are often variable even for the same species. We present and test the hypothesis that one cause of variation is that spatial distance between rewards and the means of reward release causes conflicts for participants' attentional focus. We investigated whether spatial contiguity between a visible reward and the means of release would affect behavioral responses that evidence social learning, testing 21 brown capuchins ( Sapajus apella ), a much-studied species with variant evidence for social learning, and one hundred eighty 2- to 4-year-old human children ( Homo sapiens ), a benchmark species known for a strong social learning disposition. Participants were presented with a novel transparent apparatus where a reward was either proximal or distal to a demonstrated means of releasing it. A distal reward location decreased attention toward the location of the demonstration and impaired subsequent success in gaining rewards. Generally, the capuchins produced the alternative method to that demonstrated, whereas children copied the method demonstrated, although a distal reward location reduced copying in younger children. We conclude that some design features in common social learning tasks may significantly degrade the evidence for social learning. We have demonstrated this for 2 different primates but suggest that it is a significant factor to control for in social learning research across all taxa. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

Variation among early Homo crania from Olduvai Gorge and the Koobi Fora region.

Science.gov (United States)

Rightmire, G P

1993-01-01

Fossils recognized as early Homo were discovered first at Olduvai Gorge in 1959 and 1960. Teeth, skull parts and hand bones representing three individuals were found in Bed I, and more material followed from Bed I and lower Bed II. By 1964, L.S.B. Leakey, P.V. Tobias, and J.R. Napier were ready to name Homo habilis. But almost as soon as they had, there was confusion over the hypodigm of the new species. Tobias himself suggested that OH 13 resembles Homo erectus from Java, and he noted that OH 16 has teeth as large as those of Australopithecus. By the early 1970s, however, Tobias had put these thoughts behind him and returned to the opinion that all of the Olduvai remains are Homo habilis. At about this time, important discoveries began to flow from the Koobi Fora region in Kenya. To most observers, crania such as KNM-ER 1470 confirmed the presence of Homo in East Africa at an early date. Some of the other specimens were problematical. A.C. Walker and R.E. Leakey raised the possibility that larger skulls including KNM-ER 1470 differ significantly from smaller-brained, small-toothed individuals such as KNM-ER 1813. Other workers emphasized that there are differences of shape as well as size among the hominids from Koobi Fora. There is now substantial support for the view that in the Turkana and perhaps also in the Olduvai assemblages, there is more variation than would be expected among male and female conspecifics. One way to approach this question of sorting would be to compare all of the new fossils against the original material from Olduvai which was used to characterize Homo habilis in 1964. A problem is that the Olduvai remains are fragmentary, and none of them provides much information about vault form or facial structure. An alternative is to work first with the better crania, even if these are from other sites. I have elected to treat KNM-ER 1470 and KNM-ER 1813 as key individuals. Comparisons are based on discrete anatomy and measurements. Metric results

Comparative skeletal features between Homo floresiensis and patients with primary growth hormone insensitivity (Laron Syndrome).

Science.gov (United States)

Hershkovitz, Israel; Kornreich, Liora; Laron, Zvi

2007-10-01

Comparison between the skeletal remains of Homo floresiensis and the auxological and roentgenological findings in a large Israeli cohort of patients with Laron Syndrome (LS, primary or classical GH insensitivity or resistance) revealed striking morphological similarities, including extremely small stature and reduced cranial volume. LS is an autosomal recessive disease caused by a molecular defect of the Growth Hormone (GH) receptor or in the post-receptor cascades. Epidemiological studies have shown that LS occurs more often in consanguineous families and isolates, and it has been described in several countries in South East Asia. It is our conclusion that the findings from the island of Flores, which were attributed to a new species of the genus Homo, may in fact represent a local, highly inbred, Homo sapiens population in whom a mutation for the GH receptor had occurred. (c) 2007 Wiley-Liss, Inc.

Gene : CBRC-PABE-12-0253 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1e-160 92% ref|NP_001002918.1| olfactory receptor, family 8, subfamily D, member 2 [Homo sapiens] sp|Q9GZM6|... receptor-like protein JCG2 [Homo sapiens] gb|AAG43386.1| olfactory receptor-like protein JCG2 [Homo sapi...ens] tpg|DAA04600.1| TPA_inf: olfactory receptor OR11-303 [Homo sapiens] gb|EAW67579....1| olfactory receptor, family 8, subfamily D, member 2 [Homo sapiens] 1e-159 92% MTTSNHSSGAEFNLAGLTQRPELQLP...VIAEGYLLTAMAYDCCVAICRPLLYNIVMFHRVCSIMLAVVYSLGFLGATVHTTRMSVLSFCRSHTVSHYFCDILPLLTLSCSSTHINEILLFIIGGVNTLAPIMAVL

Gene : CBRC-DNOV-01-0430 [SEVENS

Lifescience Database Archive (English)

Full Text Available _HUMAN 6e-67 50% ref|NP_112163.1| olfactory receptor, family 7, subfamily A, member 17 [Homo sapiens] sp|O14...581|OR7AH_HUMAN Olfactory receptor 7A17 gb|AAB82060.1| OLF4 [Homo sapiens] tpg|DAA04604.1| TPA_inf: olfactor...y receptor OR19-20 [Homo sapiens] gb|AAI01588.1| Olfactory receptor, family 7, su...bfamily A, member 17 [Homo sapiens] gb|AAI17358.1| Olfactory receptor, family 7, subfamily A, member 17 [Homo sapi...ens] gb|EAW84453.1| olfactory receptor, family 7, subfamily A, member 17 [Homo sapiens] 1e-65 50% MNSR

Late Pleistocene climate drivers of early human migration

Science.gov (United States)

Timmermann, Axel; Friedrich, Tobias

2016-10-01

On the basis of fossil and archaeological data it has been hypothesized that the exodus of Homo sapiens out of Africa and into Eurasia between ~50-120 thousand years ago occurred in several orbitally paced migration episodes. Crossing vegetated pluvial corridors from northeastern Africa into the Arabian Peninsula and the Levant and expanding further into Eurasia, Australia and the Americas, early H. sapiens experienced massive time-varying climate and sea level conditions on a variety of timescales. Hitherto it has remained difficult to quantify the effect of glacial- and millennial-scale climate variability on early human dispersal and evolution. Here we present results from a numerical human dispersal model, which is forced by spatiotemporal estimates of climate and sea level changes over the past 125 thousand years. The model simulates the overall dispersal of H. sapiens in close agreement with archaeological and fossil data and features prominent glacial migration waves across the Arabian Peninsula and the Levant region around 106-94, 89-73, 59-47 and 45-29 thousand years ago. The findings document that orbital-scale global climate swings played a key role in shaping Late Pleistocene global population distributions, whereas millennial-scale abrupt climate changes, associated with Dansgaard-Oeschger events, had a more limited regional effect.

Geometric morphometrics in primatology: craniofacial variation in Homo sapiens and Pan troglodytes.

Science.gov (United States)

Lynch, J M; Wood, C G; Luboga, S A

1996-01-01

Traditionally, morphometric studies have relied on statistical analysis of distances, angles or ratios to investigate morphometric variation among taxa. Recently, geometric techniques have been developed for the direct analysis of landmark data. In this paper, we offer a summary (with examples) of three of these newer techniques, namely shape coordinate, thin-plate spline and relative warp analyses. Shape coordinate analysis detected significant craniofacial variation between 4 modern human populations, with African and Australian Aboriginal specimens being relatively prognathous compared with their Eurasian counterparts. In addition, the Australian specimens exhibited greater basicranial flexion than all other samples. The observed relationships between size and craniofacial shape were weak. The decomposition of shape variation into affine and non-affine components is illustrated via a thin-plate spline analysis of Homo and Pan cranial landmarks. We note differences between Homo and Pan in the degree of prognathism and basicranial flexion and the position and orientation of the foramen magnum. We compare these results with previous studies of these features in higher primates and discuss the utility of geometric morphometrics as a tool in primatology and physical anthropology. We conclude that many studies of morphological variation, both within and between taxa, would benefit from the graphical nature of these techniques.

Gene : CBRC-ACAR-01-0755 [SEVENS

Lifescience Database Archive (English)

Full Text Available tical protein FLJ13236 [Homo sapiens] gb|AAH33236.1| Hypothetical protein FLJ13236 [Homo sapiens] gb|EAW5806...6.1| hypothetical protein FLJ13236, isoform CRA_a [Homo sapiens] gb|EAW58067.1| hypothetical protein FLJ1323...LGGPVGLHHLYLGRDNHALLWMLTLGGFGFGWLWELWMLPGWVAQANHPLEKRHNDPPSFNPVRFLGQALVGIYFGLVALVGLSTLPGFYILALPLAVGLGVHLVSAVGNQTSDLQATLMAAFVTAPI...6, isoform CRA_a [Homo sapiens] 2e-95 61% MWDATFYYSFLLRTSASQQDVPPFTVMAKRLLVAVAFWA

Paleoneurology of two new neandertal occipitals from El Sidrón (asturias, Spain) in the context of homo endocranial evolution.

Science.gov (United States)

Peña-Melián, Angel; Rosas, Antonio; García-Tabernero, Antonio; Bastir, Markus; De La Rasilla, Marco

2011-08-01

The endocranial surface description and comparative analyses of two new neandertal occipital fragments (labelled SD-1149 and SD-370a) from the El Sidrón site (Asturias, Spain) reveal new aspects of neandertal brain morphological asymmetries. The dural sinus drainage pattern, as observed on the sagittal-transverse system, as well as the cerebral occipito-petalias, point out a slightly differential configuration of the neandertal brain when compared to other Homo species, especially H. sapiens. The neandertal dural sinus drainage pattern is organized in a more asymmetric mode, in such a way that the superior sagittal sinus (SSS) drains either to the right or to the left transverse sinuses, but in no case in a confluent mode (i.e. simultaneous continuation of SSS with both right (RTS) and left (LTS) transverse sinuses). Besides, the superior sagittal sinus shows an accentuated deviation from of the mid-sagittal plane in its way to the RTS in 35% of neandertals. This condition, which increases the asymmetry of the system, is almost nonexistent neither in the analyzed Homo fossil species sample nor in that of anatomically modern humans. Regarding the cerebral occipito-petalias, neandertals manifest one of the lowest percentages of left petalia of the Homo sample (including modern H. sapiens). As left occipito-petalia is the predominant pattern in hominins, it seems as if neandertals would have developed a different pattern of brain hemispheres asymmetry. Finally, the relief and position of the the cerebral sulci and gyri impressions observed in the El Sidrón occipital specimens look similar to those observed in modern H. sapiens. Copyright © 2011 Wiley-Liss, Inc.

Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

Science.gov (United States)

Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

2017-04-01

Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Structural Exploration and Conformational Transitions in MDM2 upon DHFR Interaction from Homo sapiens: A Computational Outlook for Malignancy via Epigenetic Disruption.

Science.gov (United States)

Banerjee, Arundhati; Ray, Sujay

2016-01-01

Structural basis for exploration into MDM2 and MDM2-DHFR interaction plays a vital role in analyzing the obstruction in folate metabolism, nonsynthesis of purines, and further epigenetic regulation in Homo sapiens. Therefore, it leads to suppression of normal cellular behavior and malignancy. This has been earlier documented via yeast two-hybrid assays. So, with a novel outlook, this study explores the molecular level demonstration of the best satisfactory MDM2 model selection after performing manifold modeling techniques. Z-scores and other stereochemical features were estimated for comparison. Further, protein-protein docking was executed with MDM2 and the experimentally validated X-ray crystallographic DHFR. Residual disclosure from the best suited simulated protein complex disclosed 18 side chain and 3 ionic interactions to strongly accommodate MDM2 protein into the pocket-like zone in DHFR due to the positive environment by charged residues. Lysine residues from MDM2 played a predominant role. Moreover, evaluation from varied energy calculations, folding rate, and net area for solvent accessibility implied the active participation of MDM2 with DHFR. Fascinatingly, conformational transitions from coils to helices and β-sheets after interaction with DHFR affirm the conformational strength and firmer interaction of human MDM2-DHFR. Therefore, this probe instigates near-future clinical research and interactive computational investigations with mutations.

Structural Exploration and Conformational Transitions in MDM2 upon DHFR Interaction from Homo sapiens: A Computational Outlook for Malignancy via Epigenetic Disruption

Directory of Open Access Journals (Sweden)

Arundhati Banerjee

2016-01-01

Full Text Available Structural basis for exploration into MDM2 and MDM2-DHFR interaction plays a vital role in analyzing the obstruction in folate metabolism, nonsynthesis of purines, and further epigenetic regulation in Homo sapiens. Therefore, it leads to suppression of normal cellular behavior and malignancy. This has been earlier documented via yeast two-hybrid assays. So, with a novel outlook, this study explores the molecular level demonstration of the best satisfactory MDM2 model selection after performing manifold modeling techniques. Z-scores and other stereochemical features were estimated for comparison. Further, protein-protein docking was executed with MDM2 and the experimentally validated X-ray crystallographic DHFR. Residual disclosure from the best suited simulated protein complex disclosed 18 side chain and 3 ionic interactions to strongly accommodate MDM2 protein into the pocket-like zone in DHFR due to the positive environment by charged residues. Lysine residues from MDM2 played a predominant role. Moreover, evaluation from varied energy calculations, folding rate, and net area for solvent accessibility implied the active participation of MDM2 with DHFR. Fascinatingly, conformational transitions from coils to helices and β-sheets after interaction with DHFR affirm the conformational strength and firmer interaction of human MDM2-DHFR. Therefore, this probe instigates near-future clinical research and interactive computational investigations with mutations.

NCBI nr-aa BLAST: CBRC-TSYR-01-1316 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1316 ref|NP_057167.2| cannabinoid receptor 1 isoform a [Homo sapiens] ref|NP_001013035.1| cann...abinoid receptor 1 [Pan troglodytes] ref|NP_001027997.1| cannabinoid receptor 1 [Mac...aca mulatta] ref|NP_001153698.1| cannabinoid receptor 1 isoform a [Homo sapiens] ref|NP_001153730.1| cannabi...noid receptor 1 isoform a [Homo sapiens] ref|NP_001153731.1| cannabinoid receptor... 1 isoform a [Homo sapiens] ref|NP_001153732.1| cannabinoid receptor 1 isoform a [Homo sapiens] sp|P21554|CN

NCBI nr-aa BLAST: CBRC-RMAC-08-0011 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-08-0011 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-179 97% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-0079 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-0079 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-175 94% ...

NCBI nr-aa BLAST: CBRC-EEUR-01-1539 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-1539 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-136 88% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0888 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0888 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-146 83% ...

NCBI nr-aa BLAST: CBRC-TGUT-37-0216 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-37-0216 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 6e-97 55% ...

NCBI nr-aa BLAST: CBRC-RNOR-05-0027 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-05-0027 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-157 86% ...

NCBI nr-aa BLAST: CBRC-OGAR-01-0338 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OGAR-01-0338 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-166 91% ...

NCBI nr-aa BLAST: CBRC-CFAM-29-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-29-0001 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 1e-162 88% ...

NCBI nr-aa BLAST: CBRC-PABE-09-0018 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-09-0018 ref|NP_005276.2| G protein-coupled receptor 7 [Homo sapiens] gb|AAH69117.1| Neuropeptides... B/W receptor 1 [Homo sapiens] gb|AAI07102.1| Neuropeptides B/W receptor 1 [Homo sap...iens] gb|EAW86722.1| neuropeptides B/W receptor 1 [Homo sapiens] NP_005276.2 0.0 100% ...

NCBI nr-aa BLAST: CBRC-CINT-01-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0131 ref|NP_149421.1| central cannabinoid receptor isoform b [Homo sap...iens] emb|CAA57019.1| central cannabinoid receptor [Homo sapiens] emb|CAI19916.1| cannabinoid receptor 1 (br...ain) [Homo sapiens] gb|EAW48575.1| cannabinoid receptor 1 (brain), isoform CRA_b [Homo sapiens] NP_149421.1 6e-31 29% ...

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_001258.2| chondroadherin precursor [Homo sapiens] sp|O15335|CHAD_HUMAN Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAK51556.1|AF371328_1 chondroadher...in [Homo sapiens] gb|AAH36360.1| Chondroadherin [Homo sapiens] gb|AAH73974.1| Chondroadherin [Homo sapiens] gb|EAW94613.1| chondroad

Perceived risk of female infidelity moderates the relationship between objective risk of female infidelity and sexual coercion in humans (Homo sapiens).

Science.gov (United States)

McKibbin, William F; Starratt, Valerie G; Shackelford, Todd K; Goetz, Aaron T

2011-08-01

Female extrapair copulation (EPC) can be costly to a woman's long-term romantic partner. If a woman has copulated recently with a man other than her long-term partner, her reproductive tract may contain the sperm of both men, initiating sperm competition (whereby sperm from multiple males compete to fertilize an egg). Should the woman become pregnant, her long-term partner is at risk of cuckoldry-investing unwittingly in offspring to whom he is not genetically related. Previous research in humans (Homo sapiens) and in nonhuman animals suggests that males have evolved tactics such as partner-directed sexual coercion that reduce the risk of cuckoldry. The current research provides preliminary evidence that mated men (n = 223) at greater risk of partner EPC, measured as having spent a greater proportion of time apart from their partner since the couple's last in-pair copulation, more frequently perform partner-directed sexually coercive behaviors. This relationship is moderated, however, by men's perceived risk of partner EPC, such that the correlation between the proportion of time spent apart since last in-pair copulation and sexually coercive behaviors remains significant only for those men who perceive themselves to be at some risk of partner EPC. Discussion addresses limitations of this research and highlights directions for future research investigating the relationship between female EPC and men's partner-directed sexual coercion. PsycINFO Database Record (c) 2011 APA, all rights reserved.

NCBI nr-aa BLAST: CBRC-MEUG-01-2747 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2747 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] sp|P...48146|NPBW2_HUMAN RecName: Full=Neuropeptides B/W receptor type 2; AltName: Full=G-protein coupled receptor ...8 emb|CAC17004.1| neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [H...omo sapiens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-104 69% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-0055 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-0055 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] sp|P...48146|NPBW2_HUMAN RecName: Full=Neuropeptides B/W receptor type 2; AltName: Full=G-protein coupled receptor ...8 emb|CAC17004.1| neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [H...omo sapiens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-133 98% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-0909 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0909 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] sp|P...48146|NPBW2_HUMAN RecName: Full=Neuropeptides B/W receptor type 2; AltName: Full=G-protein coupled receptor ...8 emb|CAC17004.1| neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [H...omo sapiens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 0.0 94% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0233 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0233 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] sp|P...48146|NPBW2_HUMAN RecName: Full=Neuropeptides B/W receptor type 2; AltName: Full=G-protein coupled receptor ...8 emb|CAC17004.1| neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [H...omo sapiens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-108 66% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0043 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0043 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] sp|P...48146|NPBW2_HUMAN RecName: Full=Neuropeptides B/W receptor type 2; AltName: Full=G-protein coupled receptor ...8 emb|CAC17004.1| neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [H...omo sapiens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-46 82% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-0810 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0810 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 96% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1001 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-163 95% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2918 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2918 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-164 78% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1631 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1631 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-173 86% ...

NCBI nr-aa BLAST: CBRC-OPRI-01-1192 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1192 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN RecName: Full=Melatonin receptor type 1B; AltName: Full=Mel1b melatonin receptor; Short=Mel-1B-R gb|AAC50612.1| Mel1b-mela...tonin receptor [Homo sapiens] dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin...ptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-167 81% ...

NCBI nr-aa BLAST: CBRC-TGUT-29-0009 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-29-0009 ref|NP_068741.1| Fanconi anemia, complementation group E [Homo sa...piens] sp|Q9HB96|FANCE_HUMAN Fanconi anemia group E protein (Protein FACE) gb|AAG16743.1|AF265210_1 fanconi anemia... protein E [Homo sapiens] gb|AAH46359.1| Fanconi anemia, complementation group E [Homo sapiens] emb|CAD92504.1| Fanconi anemia..., complementation group E [Homo sapiens] gb|AAY26395.1| Fanconi anemia..., complementation group E [Homo sapiens] gb|EAX03830.1| Fanconi anemia, complementation group E

NCBI nr-aa BLAST: CBRC-DDIS-01-0111 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-01-0111 ref|NP_060837.2| phytoceramidase, alkaline [Homo sapiens] ref|XP_...001175032.1| PREDICTED: phytoceramidase, alkaline isoform 3 [Pan troglodytes] sp|Q9NUN7|APHC_HUMAN Alkaline ...phytoceramidase (aPHC) (Alkaline ceramidase) (Alkaline dihydroceramidase SB89) gb|AAK71923.1|AF214454_1 alkali...ne phytoceramidase [Homo sapiens] gb|AAL56013.1|AF327353_1 alkaline dihydrocera...midase SB89 [Homo sapiens] gb|AAH73853.1| Phytoceramidase, alkaline [Homo sapiens] gb|EAW75010.1| phytoceramidase, alkaline, isoform CRA_b [Homo sapiens] NP_060837.2 3e-23 29% ...

Gene : CBRC-TSYR-01-0335 [SEVENS

Lifescience Database Archive (English)

Full Text Available ute carrier family 46, member 3 isoform b [Homo sapiens] gb|AAH60850.1| SLC46A3 protein [Homo sapiens] emb|C...AI17158.1| novel protein [Homo sapiens] gb|EAX08438.1| hypothetical protein LOC283537, isoform CRA_b [Homo sapi...YMLFKNASGRQRSLLCLLLFTMITYFFLVVGVAPIFILYELDSPLCWSEVFIGYGSALGSASFFTSFLGIWLFSYCMEDIHMAFIGIFTTMVGMAVIAFARTTLMMFLGEFQM ...

Role of microRNA in Aggressive Prostate Cancer

Science.gov (United States)

2015-09-01

Interleukin enhancer-binding factor 2 OS=Homo sapiens GN=ILF2 PE=1 SV=2 ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2...I3L1L3_HUMAN Myb-binding protein 1A (Fragment) OS=Homo sapiens GN=MYBBP1A PE=4 SV=1 XRCC5_HUMAN X-ray repair cross-complementing protein 5 OS=Homo sapiens GN...XRCC5 PE=1 SV=3 SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens GN=SFPQ PE=1 SV=2 ATPA_HUMAN ATP synthase subunit alpha

Gene : CBRC-STRI-01-0043 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0043 Novel UN B Neuropeptides B/W receptors NPBW2_HUMAN 7e-48 82% ref|NP_005277.2| neuropeptide...s B/W receptor 2 [Homo sapiens] sp|P48146|NPBW2_HUMAN RecName: Full=Neuropeptides B.../W receptor type 2; AltName: Full=G-protein coupled receptor 8 emb|CAC17004.1| neuropeptides B/W receptor 2 ...[Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|AAH67482.1| Neuropeptides... B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapien

NCBI nr-aa BLAST: CBRC-CJAC-01-1245 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1245 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-165 81% ...

NCBI nr-aa BLAST: CBRC-CFAM-21-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-21-0001 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-124 74% ...

NCBI nr-aa BLAST: CBRC-PTRO-12-0198 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-12-0198 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 98% ...

NCBI nr-aa BLAST: CBRC-MMUS-09-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-09-0013 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-164 80% ...

NCBI nr-aa BLAST: CBRC-GGAL-01-0069 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-01-0069 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-141 69% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-2040 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-2040 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 6e-55 84% ...

NCBI nr-aa BLAST: CBRC-RNOR-08-0020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-08-0020 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 1e-161 80% ...

NCBI nr-aa BLAST: CBRC-RMAC-14-0265 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-14-0265 ref|NP_005950.1| melatonin receptor 1B [Homo sapiens] sp|P49286|M...TR1B_HUMAN Melatonin receptor type 1B (Mel-1B-R) (Mel1b melatonin receptor) gb|AAC50612.1| Mel1b-melatonin r...eceptor dbj|BAA92315.1| melatonin 1b receptor [Homo sapiens] gb|AAS00461.1| melatonin receptor 1B [Homo sapi...ens] gb|AAH69163.1| Melatonin receptor 1B [Homo sapiens] gb|EAW66891.1| melatonin receptor 1B [Homo sapiens] NP_005950.1 0.0 95% ...

Demethylation-mediated miR-129-5p up-regulation inhibits malignant phenotype of osteogenic osteosarcoma by targeting Homo sapiens valosin-containing protein (VCP).

Science.gov (United States)

Long, Xin Hua; Zhou, Yun Fei; Peng, Ai Fen; Zhang, Zhi Hong; Chen, Xuan Yin; Chen, Wen Zhao; Liu, Jia Ming; Huang, Shan Hu; Liu, Zhi Li

2015-05-01

Previous studies demonstrated that increased Homo sapiens valosin-containing protein (VCP) may be involved in osteosarcoma (OS) metastasis. However, the underlying mechanism of VCP over-expression in OS remains unknown. In the present study, we found a significantly negative correlation between miR-129-5p and VCP protein expression in OS tissues with pulmonary metastasis (Spearman's rho, rs = -0.948). Bioinformatical prediction, Luciferase reporter assay, Western blot, and RT-PCR assays performed on OS cells indicated that VCP is a target of miR-129-5p. In addition, three CPG islands in the region of miR-129-5p promoter were detected by bioinformatical prediction, and significantly higher expression of miR-129-5p and lower methylation level of miR-129-2 gene in OS cells treated with 5-Aza-2'-deoxycytidine (a potent DNA demethylating agent) than in those untreated cells were observed. Furthermore, lower migratory and invasive ability was found in cells with elevated miR-129-5p than in those with decreased miR-129-5p. These findings indicated that increased miR-129-5p may be mediated by demethylation and inhibit OS cell migration and invasion by targeting VCP in OS, and targeting miR-129-5p/VCP signaling pathway may serve as a therapeutic strategy for OS management, although further studies will be necessary.

Adult Neandertal clavicles from the El Sidrón site (Asturias, Spain) in the context of Homo pectoral girdle evolution.

Science.gov (United States)

Rosas, Antonio; Rodriguez-Perez, Francisco Javier; Bastir, Markus; Estalrrich, Almudena; Huguet, Rosa; García-Tabernero, Antonio; Pastor, Juan Francisco; de la Rasilla, Marco

2016-06-01

We undertook a three-dimensional geometric morphometric (3DGM) analysis on 12 new Neandertal clavicle specimens from the El Sidrón site (Spain), dated to 49,000 years ago. The 3DGM methods were applied in a comparative framework in order to improve our understanding of trait polarity in features related to Homo pectoral girdle evolution, using other Neandertals, Homo sapiens, Pan, ATD6-50 (Homo antecessor), and KNM-WT 15000 (Homo ergaster/erectus) in the reference collection. Twenty-nine homologous landmarks were measured for each clavicle. Variation and morphological similarities were assessed through principal component analysis, conducted separately for the complete clavicle and the diaphysis. On average, Neandertal clavicles had significantly larger muscular entheses, double dorsal curvature, clavicle torsion, and cranial orientation of the acromial end than non-Neandertal clavicles; the El Sidrón clavicles fit this pattern. Variation within the samples was large, with extensive overlap between Homo species; only chimpanzee specimens clearly differed from the other specimens in morphometric terms. Taken together, our morphometric analyses are consistent with the following phylogenetic sequence. The primitive condition of the clavicle is manifest in the cranial orientation of both the acromial and sternal ends. The derived condition expressed in the H. sapiens + Neandertal clade is defined by caudal rotation of both the sternal and acromial ends, but with variation in the number of acromia remaining in a certain cranial orientation. Finally, the autapomorphic Neandertal condition is defined by secondarily acquired primitive cranial re-orientation of the acromial end, which varies from individual to individual. These results suggest that the pace of phylogenetic change in the pectoral girdle does not seem to follow that of other postcranial skeletal features. Copyright © 2016 Elsevier Ltd. All rights reserved.

Homo sapiens

DEFF Research Database (Denmark)

Køppe, Simo; Emmeche, Claus

2018-01-01

I den politiske kamp strides forskellige opfattelser af hvad mennesket er og bør være. De er blevet udformet af de humanistiske videnskaber igennem et langt historisk forløb med indspil fra også samfunds- og naturvidenskaberne. Dette kapitel beskriver den biologiske menneskeopfattelse: mennesket ...

Conduction Abnormalities and Pacemaker Implantations After SAPIEN 3 Vs SAPIEN XT Prosthesis Aortic Valve Implantation.

Science.gov (United States)

Husser, Oliver; Kessler, Thorsten; Burgdorf, Christof; Templin, Christian; Pellegrini, Costanza; Schneider, Simon; Kasel, Albert Markus; Kastrati, Adnan; Schunkert, Heribert; Hengstenberg, Christian

2016-02-01

Transcatheter aortic valve implantation is increasingly used in patients with aortic stenosis. Post-procedural intraventricular conduction abnormalities and permanent pacemaker implantations remain a serious concern. Recently, the Edwards SAPIEN 3 prosthesis has replaced the SAPIEN XT. We sought to determine the incidences of new-onset intraventricular conduction abnormalities and permanent pacemaker implantations by comparing the 2 devices. We analyzed the last consecutive 103 patients undergoing transcatheter aortic valve implantation with SAPIEN XT before SAPIEN 3 was used in the next 105 patients. To analyze permanent pacemaker implantations and new-onset intraventricular conduction abnormalities, patients with these conditions at baseline were excluded. Electrocardiograms were recorded at baseline, after the procedure, and before discharge. SAPIEN 3 was associated with higher device success (100% vs 92%; P=.005) and less paravalvular leakage (0% vs 7%; Ppacemaker implantations was 12.6% (23 of 183) with no difference between the 2 groups (SAPIEN 3: 12.5% [12 of 96] vs SAPIEN XT: 12.6% [11 of 87]; P=.99). SAPIEN 3 was associated with a higher rate of new-onset intraventricular conduction abnormalities (49% vs 27%; P=.007) due to a higher rate of fascicular blocks (17% vs 5%; P=.021). There was no statistically significant difference in transient (29% [20 of 69] vs persistent 19% [12 of 64]; P=.168) left bundle branch blocks (28% [19 of 69] vs 17% [11 of 64]; P=.154) when SAPIEN 3 was compared with SAPIEN XT. We found a trend toward a higher rate of new-onset intraventricular conduction abnormalities with SAPIEN 3 compared with SAPIEN XT, although this did not result in a higher permanent pacemaker implantation rate. Copyright © 2015 Sociedad Española de Cardiología. Published by Elsevier España, S.L.U. All rights reserved.

NCBI nr-aa BLAST: CBRC-BTAU-01-1973 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-1973 ref|NP_982299.1| porcupine isoform B [Homo sapiens] gb|AAG39629.1|AF317059_1 porcup...ine isoform B [Homo sapiens] gb|AAH19080.1| Porcupine homolog (Drosophila) [Homo sapiens] gb|EAW50778.1| porcup...ine homolog (Drosophila), isoform CRA_b [Homo sapiens] gb|ABM83558.1| porcupine homolog... (Drosophila) [synthetic construct] gb|ABM86795.1| porcupine homolog (Drosophila) [synthetic construct] NP_982299.1 0.0 91% ...

Gene : CBRC-HSAP-13-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-13-0003 13 B UNKNOWN PCFT_XENLA 8e-30 30% gb|AAH60850.1| SLC46A3 protein [Homo sapi...ens] emb|CAI17158.1| novel protein [Homo sapiens] gb|EAX08438.1| hypothetical protein LOC283537, isoform CRA_b [Homo sapi...ens] 1e-159 100% gnl|UG|Hs#S16817523 Homo sapiens mRNA; cDNA DKFZp686H0448 (from clon...SSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLGEFQV ...

Homo Sapiens to Robo Sapiens

CERN Document Server

AUTHOR|(CDS)2083520

1997-01-01

Is it possible for engineers to build robots that will be more intelligent than humans?Could such robots become conscious?Could Artificial Life be engineered?If so,how long will it be before this is achieved?

Exosomes in Development and Therapy of Malignant Mesothelioma

Science.gov (United States)

2015-09-01

exosomes. B. Dynamic light scattering (DLS) showing the size of the exosomes. 6 Histone H4 OS=Homo sapiens GN=HIST1H4A PE=1 SV=2 H4_HUMAN Keratin, type I...cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 K1C9_HUMAN Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC sp|Q00610-2|CLH1_HUMAN (+1...Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 sp|P53675|CLH2_HUMAN Cluster of Histone H2A type 1-B/E OS=Homo sapiens GN=HIST1H2AB PE=1 SV

NCBI nr-aa BLAST: CBRC-MEUG-01-1073 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-1073 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor [Homo sapiens] emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-132 85% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1521 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1521 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor [Homo sapiens] emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 88% ...

NCBI nr-aa BLAST: CBRC-MDOM-01-0094 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-01-0094 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor [Homo sapiens] emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 75% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-0810 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0810 gb|AAF78563.1|AF224751_1 corneodesmosin [Homo sapiens] gb|AAF78564.1|AF224752_1 corn...eodesmosin [Homo sapiens] gb|AAG02419.1|AF286165_1 corneodesmosin [Homo sapiens] AAF78563.1 1e-149 83% ...

Brain size and encephalization in early to Mid-Pleistocene Homo.

Science.gov (United States)

Rightmire, G Philip

2004-06-01

Important changes in the brain have occurred during the course of human evolution. Both absolute and relative size increases can be documented for species of Homo, culminating in the appearance of modern humans. One species that is particularly well-represented by fossil crania is Homo erectus. The mean capacity for 30 individuals is 973 cm(3). Within this group there is substantial variation, but brain size increases slightly in specimens from later time periods. Other Middle Pleistocene crania differ from those of Homo erectus. Characters of the facial skeleton, vault, and cranial base suggest that fossils from sites such as Arago Cave in France, the Sima de los Huesos in Spain, Bodo in Ethiopia, Broken Hill in Zambia, and perhaps Dali in China belong to the taxon Homo heidelbergensis. Ten of these mid-Quaternary hominins have brains averaging 1,206 cm(3) in volume, and many fall beyond the limits of size predicted for Homo erectus of equivalent age. When orbit height is used to construct an index of relative brain size, it is apparent that the (significant) increase in volume documented for the Middle Pleistocene individuals is not simply a consequence of larger body mass. Encephalization quotient values confirm this finding. These changes in absolute and relative brain size can be taken as further corroborative evidence for a speciation event, in which Homo erectus produced a daughter lineage. It is probable that Homo heidelbergensis originated in Africa or western Eurasia and then ranged widely across the Old World. Archaeological traces indicate that these populations differed in their technology and behavior from earlier hominins. Copyright 2003 Wiley-Liss, Inc.

NCBI nr-aa BLAST: CBRC-OPRI-01-1349 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-1349 dbj|BAC11282.1| unnamed protein product [Homo sapiens] emb|CAQ10191.1| caspase recruitment... domain family, member 10 [Homo sapiens] emb|CAQ08761.1| caspase recruitment domain family, member 10 [Homo sapiens] BAC11282.1 9.1 29% ...

Fractal dimension of the middle meningeal vessels: variation and evolution in Homo erectus, Neanderthals, and modern humans.

Science.gov (United States)

Bruner, Emiliano; Mantini, Simone; Perna, Agostino; Maffei, Carlotta; Manzi, Giorgio

2005-01-01

The middle meningeal vascular network leaves its traces on the endocranial surface because of the tight relationship between neurocranial development and brain growth. Analysing the endocast of fossil specimens, it is therefore possible to describe the morphology of these structures, leading inferences on the cerebral physiology and metabolism in extinct human groups. In this paper, general features of the meningeal vascular traces are described for specimens included in the Homo erectus, Homo neanderthalensis, and Homo sapiens hypodigms. The complexity of the arterial network is quantified by its fractal dimension, calculated through the box-counting method. Modern humans show significant differences from the other two taxa because of the anterior vascular dominance and the larger fractal dimension. Neither the fractal dimension nor the anterior development are merely associated with cranial size increase. Considering the differences between Neanderthals and modern humans, these results may be interpreted in terms of phylogeny, cerebral functions, or cranial structural network.

A comparative analysis of the categorization of multidimensional stimuli: I. Unidimensional classification does not necessarily imply analytic processing; evidence from pigeons (Columba livia), squirrels (Sciurus carolinensis), and humans (Homo sapiens).

Science.gov (United States)

Wills, A J; Lea, Stephen E G; Leaver, Lisa A; Osthaus, Britta; Ryan, Catriona M E; Suret, Mark B; Bryant, Catherine M L; Chapman, Sue J A; Millar, Louise

2009-11-01

Pigeons (Columba livia), gray squirrels (Sciurus carolinensis), and undergraduates (Homo sapiens) learned discrimination tasks involving multiple mutually redundant dimensions. First, pigeons and undergraduates learned conditional discriminations between stimuli composed of three spatially separated dimensions, after first learning to discriminate the individual elements of the stimuli. When subsequently tested with stimuli in which one of the dimensions took an anomalous value, the majority of both species categorized test stimuli by their overall similarity to training stimuli. However some individuals of both species categorized them according to a single dimension. In a second set of experiments, squirrels, pigeons, and undergraduates learned go/no-go discriminations using multiple simultaneous presentations of stimuli composed of three spatially integrated, highly salient dimensions. The tendency to categorize test stimuli including anomalous dimension values unidimensionally was higher than in the first set of experiments and did not differ significantly between species. The authors conclude that unidimensional categorization of multidimensional stimuli is not diagnostic for analytic cognitive processing, and that any differences between human's and pigeons' behavior in such tasks are not due to special features of avian visual cognition.

A new Homo erectus (Zhoukoudian V) brain endocast from China.

Science.gov (United States)

Wu, Xiujie; Schepartz, Lynne A; Liu, Wu

2010-01-22

A new Homo erectus endocast, Zhoukoudian (ZKD) V, is assessed by comparing it with ZKD II, ZKD III, ZKD X, ZKD XI, ZKD XII, Hexian, Trinil II, Sambungmacan (Sm) 3, Sangiran 2, Sangiran 17, KNM-ER 3733, KNM-WT 15 000, Kabwe, Liujiang and 31 modern Chinese. The endocast of ZKD V has an estimated endocranial volume of 1140 ml. As the geological age of ZKD V is younger than the other ZKD H. erectus, evolutionary changes in brain morphology are evaluated. The brain size of the ZKD specimens increases slightly over time. Compared with the other ZKD endocasts, ZKD V shows important differences, including broader frontal and occipital lobes, some indication of fuller parietal lobes, and relatively large brain size that reflect significant trends documented in later hominin brain evolution. Bivariate and principal component analyses indicate that geographical variation does not characterize the ZKD, African and other Asian specimens. The ZKD endocasts share some common morphological and morphometric features with other H. erectus endocasts that distinguish them from Homo sapiens.

Homo naledi, a new species of the genus Homo from the Dinaledi Chamber, South Africa

Science.gov (United States)

Berger, Lee R; Hawks, John; de Ruiter, Darryl J; Churchill, Steven E; Schmid, Peter; Delezene, Lucas K; Kivell, Tracy L; Garvin, Heather M; Williams, Scott A; DeSilva, Jeremy M; Skinner, Matthew M; Musiba, Charles M; Cameron, Noel; Holliday, Trenton W; Harcourt-Smith, William; Ackermann, Rebecca R; Bastir, Markus; Bogin, Barry; Bolter, Debra; Brophy, Juliet; Cofran, Zachary D; Congdon, Kimberly A; Deane, Andrew S; Dembo, Mana; Drapeau, Michelle; Elliott, Marina C; Feuerriegel, Elen M; Garcia-Martinez, Daniel; Green, David J; Gurtov, Alia; Irish, Joel D; Kruger, Ashley; Laird, Myra F; Marchi, Damiano; Meyer, Marc R; Nalla, Shahed; Negash, Enquye W; Orr, Caley M; Radovcic, Davorka; Schroeder, Lauren; Scott, Jill E; Throckmorton, Zachary; Tocheri, Matthew W; VanSickle, Caroline; Walker, Christopher S; Wei, Pianpian; Zipfel, Bernhard

2015-01-01

Homo naledi is a previously-unknown species of extinct hominin discovered within the Dinaledi Chamber of the Rising Star cave system, Cradle of Humankind, South Africa. This species is characterized by body mass and stature similar to small-bodied human populations but a small endocranial volume similar to australopiths. Cranial morphology of H. naledi is unique, but most similar to early Homo species including Homo erectus, Homo habilis or Homo rudolfensis. While primitive, the dentition is generally small and simple in occlusal morphology. H. naledi has humanlike manipulatory adaptations of the hand and wrist. It also exhibits a humanlike foot and lower limb. These humanlike aspects are contrasted in the postcrania with a more primitive or australopith-like trunk, shoulder, pelvis and proximal femur. Representing at least 15 individuals with most skeletal elements repeated multiple times, this is the largest assemblage of a single species of hominins yet discovered in Africa. DOI: http://dx.doi.org/10.7554/eLife.09560.001 PMID:26354291

NCBI nr-aa BLAST: CBRC-GACU-17-0011 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-17-0011 ref|NP_005540.1| potassium voltage-gated channel, shaker-related ...4990.1| Potassium voltage-gated channel, shaker-related subfamily, member 10 [Homo sapiens] emb|CAH74103.1| ...potassium voltage-gated channel, shaker-related subfamily, member 10 [Homo sapien...s] gb|EAW56454.1| potassium voltage-gated channel, shaker-related subfamily, member 10 [Homo sapiens] NP_005540.1 0.0 62% ...

NCBI nr-aa BLAST: CBRC-FRUB-02-0329 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0329 ref|NP_005540.1| potassium voltage-gated channel, shaker-related ...4990.1| Potassium voltage-gated channel, shaker-related subfamily, member 10 [Homo sapiens] emb|CAH74103.1| ...potassium voltage-gated channel, shaker-related subfamily, member 10 [Homo sapien...s] gb|EAW56454.1| potassium voltage-gated channel, shaker-related subfamily, member 10 [Homo sapiens] NP_005540.1 0.0 66% ...

Analysis of protein targets in pathogen-host interaction in infectious diseases: a case study on Plasmodium falciparum and Homo sapiens interaction network.

Science.gov (United States)

Saha, Sovan; Sengupta, Kaustav; Chatterjee, Piyali; Basu, Subhadip; Nasipuri, Mita

2017-09-23

Infection and disease progression is the outcome of protein interactions between pathogen and host. Pathogen, the role player of Infection, is becoming a severe threat to life as because of its adaptability toward drugs and evolutionary dynamism in nature. Identifying protein targets by analyzing protein interactions between host and pathogen is the key point. Proteins with higher degree and possessing some topologically significant graph theoretical measures are found to be drug targets. On the other hand, exceptional nodes may be involved in infection mechanism because of some pathway process and biologically unknown factors. In this article, we attempt to investigate characteristics of host-pathogen protein interactions by presenting a comprehensive review of computational approaches applied on different infectious diseases. As an illustration, we have analyzed a case study on infectious disease malaria, with its causative agent Plasmodium falciparum acting as 'Bait' and host, Homo sapiens/human acting as 'Prey'. In this pathogen-host interaction network based on some interconnectivity and centrality properties, proteins are viewed as central, peripheral, hub and non-hub nodes and their significance on infection process. Besides, it is observed that because of sparseness of the pathogen and host interaction network, there may be some topologically unimportant but biologically significant proteins, which can also act as Bait/Prey. So, functional similarity or gene ontology mapping can help us in this case to identify these proteins. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please email: journals.permissions@oup.com.

The evolution of modern human brain shape

Science.gov (United States)

Neubauer, Simon; Hublin, Jean-Jacques; Gunz, Philipp

2018-01-01

Modern humans have large and globular brains that distinguish them from their extinct Homo relatives. The characteristic globularity develops during a prenatal and early postnatal period of rapid brain growth critical for neural wiring and cognitive development. However, it remains unknown when and how brain globularity evolved and how it relates to evolutionary brain size increase. On the basis of computed tomographic scans and geometric morphometric analyses, we analyzed endocranial casts of Homo sapiens fossils (N = 20) from different time periods. Our data show that, 300,000 years ago, brain size in early H. sapiens already fell within the range of present-day humans. Brain shape, however, evolved gradually within the H. sapiens lineage, reaching present-day human variation between about 100,000 and 35,000 years ago. This process started only after other key features of craniofacial morphology appeared modern and paralleled the emergence of behavioral modernity as seen from the archeological record. Our findings are consistent with important genetic changes affecting early brain development within the H. sapiens lineage since the origin of the species and before the transition to the Later Stone Age and the Upper Paleolithic that mark full behavioral modernity. PMID:29376123

The evolution of modern human brain shape.

Science.gov (United States)

Neubauer, Simon; Hublin, Jean-Jacques; Gunz, Philipp

2018-01-01

Modern humans have large and globular brains that distinguish them from their extinct Homo relatives. The characteristic globularity develops during a prenatal and early postnatal period of rapid brain growth critical for neural wiring and cognitive development. However, it remains unknown when and how brain globularity evolved and how it relates to evolutionary brain size increase. On the basis of computed tomographic scans and geometric morphometric analyses, we analyzed endocranial casts of Homo sapiens fossils ( N = 20) from different time periods. Our data show that, 300,000 years ago, brain size in early H. sapiens already fell within the range of present-day humans. Brain shape, however, evolved gradually within the H. sapiens lineage, reaching present-day human variation between about 100,000 and 35,000 years ago. This process started only after other key features of craniofacial morphology appeared modern and paralleled the emergence of behavioral modernity as seen from the archeological record. Our findings are consistent with important genetic changes affecting early brain development within the H. sapiens lineage since the origin of the species and before the transition to the Later Stone Age and the Upper Paleolithic that mark full behavioral modernity.

The association between mid-facial morphology and climate in northeast Europe differs from that in north Asia: Implications for understanding the morphology of Late Pleistocene Homo sapiens.

Science.gov (United States)

Evteev, Andrej A; Movsesian, Alla A; Grosheva, Alexandra N

2017-06-01

The climate of northeastern Europe is likely to resemble in many ways Late Pleistocene periglacial conditions in Europe, but there have been relatively few studies exploring the association between climate and morphology in the mid-face of modern northeastern European populations. To fill this gap, we sampled 540 male skulls from 22 European and Near Eastern groups, including 314 skulls from 11 populations from northeastern Europe, to test for possible climate-morphology association at the continental scale. Our results found a moderate and highly significant association (R = 0.48, p = 0.0013, Mantel test) between sets of 23 mid-facial measurements and eight climatic variables. A partial least squares analysis revealed this association to be mostly driven by differences between groups from northeastern Europe and populations from the Mediterranean and the Caucasus. Matrices of between-group genetic distances based on Y-chromosome and mtDNA markers, as well as cranial non-metric and geographic distance matrices, were used to control for the possible influence of shared population history. Irrespective of which measure of neutral between-population distances is taken into account, the association between cranial variables and climate remains significant. The pattern of association between climate and morphology of the mid-face in western Eurasia was then compared to that in east and north Asia. Although differences between the two were found, there were also similarities that support existing functional interpretations of morphology for the bony parts of the upper airways. Last, in a preliminary analysis using a reduced set of measurements, mid-facial morphology of several Upper Paleolithic European Homo sapiens specimens was found to be more similar to groups from northern and northeastern Europe than to southern European populations. Thus, the population of northeastern Europe rather than east and north Asian groups should be used as a model when studying

The ESR dating of the Nanjing Homo erectus stratigraphy

International Nuclear Information System (INIS)

Chen Tiemei; Wu En; Yang Quan; Hu Yanqiu

1997-01-01

Five fossil tooth enamel samples collected from the stratum of the Nanjing Homo erectus were ESR dated. The average age is 355 +- 42 ka, based on the early uranium-uptake model. Additional uranium series measurement of fossil teeth confirms the appropriateness of the early uranium-uptake model for these ESR samples. Considering also the uranium-series ages of two calcite samples from the flow stone covering the fossil-containing stratum, an age value of 350 +- 50 ka for the Nanjing Homo erectus stratum is evaluated, which means that the Nanjing Homo erectus appeared in the late stage of Peking Man and also in the stage of human evolution earlier than Hexian Homo erectus

RNA Chimeras as a Gene Signature of Breast Cancer

Science.gov (United States)

2013-05-01

www.plosone.org 11 August 2012 | Volume 7 | Issue 8 | e41659 Human genes Human ACTB mRNA: >gi|168480144|ref|NM_001101.3| Homo sapiens actin, beta...TCCCCCTTTTTTGTCCCCCAACTTGAGATGTATGAAGGCTTTTGGTCTCCCTGGGAGTGGGTGGAGGCAGCCAGGGCTTACCTGTACACTGACTTGAGACCAGTTGAATAAA AGTGCACACCTTAAAAATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Human GAPDH mRNA: >gi|83641890|ref|NM_002046.4| Homo sapiens ...Homo sapiens hypoxanthine phosphoribosyltransferase 1 (HPRT1), mRNA

NCBI nr-aa BLAST: CBRC-TGUT-37-0212 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-37-0212 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-TNIG-22-0079 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-22-0079 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-MMUS-04-0078 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0078 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-DRER-23-0046 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-23-0046 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-TBEL-01-0493 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0493 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-OANA-01-1821 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-1821 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-XTRO-01-1288 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-1288 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-HSAP-01-0027 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-01-0027 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-LAFR-01-2848 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-2848 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-ETEL-01-1099 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-1099 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep

NCBI nr-aa BLAST: CBRC-RNOR-23-0096 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-23-0096 ref|NP_000862.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo... sapiens] sp|P50406|5HT6R_HUMAN 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin receptor 6) gb|AAA92622.1| 5-HT6 serotonin... receptor gb|AAR07900.1| 5-hydroxytryptamine/serotonin receptor 6 [Homo sapiens] gb|AAH7499...6.1| 5-hydroxytryptamine (serotonin) receptor 6 [Homo sapiens] gb|AAH74995.1| 5-hydroxytryptamine (seroton...in) receptor 6 [Homo sapiens] emb|CAI19020.1| 5-hydroxytryptamine (serotonin) recep