WorldWideScience

Sample records for dysprosium 159

  1. Synthesis and characterization of tetraphenylporphyrinate of dysprosium route dysprosium acetylacetonate

    International Nuclear Information System (INIS)

    Martinez M, V.

    1992-01-01

    Dysprosium bis (tetraphenylporphyrinate) and bis (dysprosium) Tris (tetraphenylporphyrinate) were synthesized from dysprosium tetraphenylporphyrinate prepared in situ, and characterized by IR, UV-vis, TGA, DTA, EPR and magnetic susceptibility measurements. The double decker compound was obtained by direct oxidation of the HDy(TPP) 2 intermediate. The existence of the radical anion, (TPP) - , in the double decker product was conformed by EPR spectrometry. Dysprosium monoporphyrinate was isolated and characterized by the same techniques. (Author)

  2. On polymorphism of dysprosium trichloride

    Energy Technology Data Exchange (ETDEWEB)

    Zakiryanova, Irina D.; Khokhlov, Vladimir A.; Salyulev, Alexander B.; Korzun, Iraida V. [RAS Ural Branch, Ekaterinburg (Russian Federation). Institute of High-Temperature Electrochemistry

    2015-07-01

    For the first time, the structure of crystalline DyCl{sub 3} over a wide temperature range from room temperature to melting point was studied by Raman spectroscopy. The phonon modes (cm{sup -1}) of dysprosium trichloride (monoclinic crystal lattice of AlCl{sub 3} type, Z = 4, CN = 6) at room temperature are 257 (A{sub 1g}), 201 (E{sub g}), 112 (E{sub g}), 88 (A{sub 1g}), and 63 (E{sub g}). The monoclinic structure of the crystalline DyCl{sub 3} C{sub 2h}{sup 3} symmetry was found to remain constant over the studied temperature range. No polymorphic transformation in the solid state was detected. Gravimetry, calorimetry, and mass spectrometry have been used in addition to support the conclusions made on the basis of Raman spectroscopic data.

  3. On polymorphism of dysprosium trichloride

    International Nuclear Information System (INIS)

    Zakiryanova, Irina D.; Khokhlov, Vladimir A.; Salyulev, Alexander B.; Korzun, Iraida V.

    2015-01-01

    For the first time, the structure of crystalline DyCl 3 over a wide temperature range from room temperature to melting point was studied by Raman spectroscopy. The phonon modes (cm -1 ) of dysprosium trichloride (monoclinic crystal lattice of AlCl 3 type, Z = 4, CN = 6) at room temperature are 257 (A 1g ), 201 (E g ), 112 (E g ), 88 (A 1g ), and 63 (E g ). The monoclinic structure of the crystalline DyCl 3 C 2h 3 symmetry was found to remain constant over the studied temperature range. No polymorphic transformation in the solid state was detected. Gravimetry, calorimetry, and mass spectrometry have been used in addition to support the conclusions made on the basis of Raman spectroscopic data.

  4. Can a dysprosium shortage threaten green energy technologies?

    International Nuclear Information System (INIS)

    Hoenderdaal, Sander; Tercero Espinoza, Luis; Marscheider-Weidemann, Frank; Graus, Wina

    2013-01-01

    Dysprosium, one of the various rare earth elements, is currently for more than 99% mined in China. As China is reducing its exports, new mining projects outside of China are needed to sustain supply and meet future demands. Dysprosium is mainly used in permanent magnets to retain the magnet's strength at elevated temperatures. Therefore, the use of dysprosium doped permanent magnets is preferred in electric vehicles and direct-drive wind turbines. Based on four scenarios it could be shown that dysprosium demand will probably outstrip supply in the short term (up to 2020). Although new mines are being developed, it takes several years for them to become productive. For the long term it is expected that enough dysprosium oxide is available in the earth crust (which is economically feasible to mine with current dysprosium prices) to fulfil the projected demand of dysprosium up to 2050. Recycling of dysprosium can further secure dysprosium supply in the long term by reducing primary dysprosium use by 35% in 2050. Electric vehicles are likely to play a dominant role in future increases in dysprosium demand. Even with the limited market share in 2011, electric vehicles already contribute to 20% of dysprosium use. -- Highlights: ► Dysprosium may hamper the implementation of electric cars and wind mills. ► In the short term (up to 2020) a deficit of dysprosium supply can be expected. ► In the long term (up to 2050) sufficient dysprosium is available. ► Electric vehicles are expected to dominate future dysprosium demand. ► China's dominance in dysprosium supply is likely to decrease by 2020.

  5. Resonance ionization spectroscopy in dysprosium

    Energy Technology Data Exchange (ETDEWEB)

    Studer, D., E-mail: dstuder@uni-mainz.de; Dyrauf, P.; Naubereit, P.; Heinke, R.; Wendt, K. [Johannes Gutenberg-Universität Mainz, Institut für Physik (Germany)

    2017-11-15

    We report on resonance ionization spectroscopy (RIS) of high-lying energy levels in dysprosium. We developed efficient excitation schemes and re-determined the first ionization potential (IP) via analysis of Rydberg convergences. For this purpose both two- and three-step excitation ladders were investigated. An overall ionization efficiency of 25(4) % could be demonstrated in the RISIKO mass separator of Mainz University, using a three-step resonance ionization scheme. Moreover, an extensive analysis of the even-parity 6sns- and 6snd-Rydberg-series convergences, measured via two-step excitation was performed. To account for strong perturbations in the observed s-series, the approach of multichannel quantum defect theory (MQDT) was applied. Considering all individual series limits we extracted an IP-value of 47901.76(5) cm{sup −1}, which agrees with the current literature value of 47901.7(6) cm{sup −1}, but is one order of magnitude more precise.

  6. Nature of the magnetic susceptibility of dysprosium. Paramagnetic susceptibility of dysprosium - yttrium alloys

    International Nuclear Information System (INIS)

    Demidov, V.G.; Levitin, R.Z.; Chistyakov, O.D.

    1976-01-01

    The paramagnetic susceptibility of single crystals of dysprosium-yttirum alloys is measured in the basal plane and along the hexagonal axis. It is shown that the susceptibility of the alloys obeys the Curie-Weiss law, the effective magnetic moments allong the different directions being the same and the paramagnetic Curie temperatures being different. The difference between the paramagnetic Curie temperatures in the basal plane and along the hexagonal axis is independent of the dysprosium concentration in the alloy. As a comparison with the theoretical models of magnetic anisotropy shows, this is an indication that the magnetic anisotropy of dysprosium - yttrium alloys is of a single-ion nature

  7. Semiconductor composition containing iron, dysprosium, and terbium

    Science.gov (United States)

    Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.

    2017-09-26

    An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.

  8. Dysprosium complexes with the tetraphenylporphyrin macrocyclic ligand

    International Nuclear Information System (INIS)

    Martinez M, V.; Padilla, J.; Ramirez, F.M.

    1992-04-01

    In this report, the results obtained on the synthesis, characterization and study of the chemical behavior of dysprosium complex with the acetylacetone chelating agent (Hacac) and the tetraphenylporphyrin macrocyclic ligand (H 2 TFP) are given. Based on the literature but according to our necessities and interest, the appropriate methodology settled down from the synthesis of prime matters until the obtaining and characterization of the products. The acetyl acetonate complex was obtained of mono hydrated dysprosium [Dy(acac) 3 . H 2 0] and trihydrated [Dy(acac) 3 .3 H 2 0], the mono tetra phenyl porphyrinate [Dy(TFP)(acac). 2 ac] the double sandwich of the dysprosium porphyrinate [Dy(TFP) 2 ] and the triple sandwich of the dysprosium porphyrinate [Dy(TFP) 3 . 2 TCB] (TCB = trichlorobenzene). Its were characterized by their melting points, solubility, IR, UV, TGA and DTA both first and besides the techniques already mentioned for NMR'H, RPE and Magnetic susceptibility the three last complexes. From the spectroscopic point of view, IR and RPE its suggested the existence of a complex of inverse mixed valence [Dy(TFP) 2- (TFP) 1- ] for the Dy(TFP) 2 as a result of the existence of the free radical (TFP' 1- and that it was not in none of the other porphyrin compounds. In the NMR'H spectra of the compounds were not observed signals in the region from 0 to 10 ppm that which shows that the dysprosium complexes in special those of the porphyrin type are highly paramagnetic and its could be used as displacement reagents, creators of images and contrast agents of great utility in these days in studies of NMR, technique today by today used in medical diagnoses. (Author)

  9. Heat capacity measurements on dysprosium titanate

    International Nuclear Information System (INIS)

    Kandan, R.; Prabhakara Reddy, B.; Panneerselvam, G.; Nagarajan, K.

    2014-01-01

    Dysprosium titanate is considered as a candidate material for use in the control rods of future nuclear reactors. The Dy 2 TiO 5 compound was prepared by solid-state synthesis and characterized by XRD technique. The high temperature enthalpy increments of dysprosium titanates have been measured for the first time by employing the method of inverse drop calorimetry in the temperature range 748-1645 K by using high temperature drop calorimeter. The calorimeter, the method of measurement and the procedure adopted for enthalpy increment measurements and analysis of the measured data to compute thermodynamic functions have been described elsewhere. The measured enthalpy increments were fitted to polynomial in temperature by using the least squares method. The fit equation in the temperature range from 298 to 1800 K is given

  10. High temperature oxidation kinetics of dysprosium particles

    Energy Technology Data Exchange (ETDEWEB)

    Jaques, Brian J.; Butt, Darryl P., E-mail: DarrylButt@BoiseState.edu

    2015-09-25

    Highlights: • The oxidation behavior of dysprosium particles was studied from 500 to 1000 °C. • Activation energy in initial region found as 8–25 kJ/mol, depending on atmosphere. • Activation energy in intermediate region found as 80–95 kJ/mol. • The oxide grows at the metal–oxide interface. • Generally, the formed oxide behaved as a p-type semiconductor. - Abstract: Rare earth elements have been recognized as critical materials for the advancement of many strategic and green technologies. Recently, the United States Department of Energy has invested many millions of dollars to enhance, protect, and forecast their production and management. The work presented here attempts to clarify the limited and contradictory literature on the oxidation behavior of the rare earth metal, dysprosium. Dysprosium particles were isothermally oxidized from 500 to 1000 °C in N{sub 2}–(2%, 20%, and 50%) O{sub 2} and Ar–20% O{sub 2} using simultaneous thermal analysis techniques. Two distinct oxidation regions were identified at each isothermal temperature in each oxidizing atmosphere. Initially, the oxidation kinetics are very fast until the reaction enters a slower, intermediate region of oxidation. The two regions are defined and the kinetics of each are assessed to show an apparent activation energy of 8–25 kJ/mol in the initial region and 80–95 kJ/mol in the intermediate oxidation reaction region. The effects of varying the oxygen partial pressure on the reaction rate constant are used to show that dysprosium oxide (Dy{sub 2}O{sub 3}) generally acts as a p-type semiconductor in both regions of oxidation (with an exception above 750 °C in the intermediate region)

  11. Can a dysprosium shortage threaten green energy technologies?

    NARCIS (Netherlands)

    Hoenderdaal, S.; Tercero Espinoza, L.; Marschneider-Weidemann, F.; Crijns - Graus, Wina|info:eu-repo/dai/nl/308005015

    2013-01-01

    Dysprosium, one of the various rare earth elements, is currently for more than 99% mined in China. As China is reducing its exports, new mining projects outside of China are needed to sustain supply and meet future demands. Dysprosium is mainly used in permanent magnets to retain the magnet's

  12. Ethanolamine derivatives of dysprosium and holmium

    International Nuclear Information System (INIS)

    Gharia, K.S.; Singh, M.; Mathur, S.; Sankhla, B.S.

    1981-01-01

    The preparation and properties of dysprosium and holmium derivatives of mono-, di- and tri-ethanolamine derivatives are described. Compounds of general formulae: Ln(OPrsup(i)) 2 (mea), Ln(OPrsup(i))(mea) 2 , Ln(mea) 3 , Ln(OPrsup(i))(dea), Ln 2 (dea) 3 , Ln(dea)(deaH) and Ln(tea) (where Ln = Dy or Ho and mea, dea and tea are the anions of respective ethanolamine) were obtained and characterized by elemental analysis and IR spectra. (author)

  13. Synthesis and characterization of tetraphenylporphyrinate of dysprosium route dysprosium acetylacetonate.; Sintesis y caracterizacion de un porfirinato de disprosio via acetilacetonato de disprosio.

    Energy Technology Data Exchange (ETDEWEB)

    Martinez M, V

    1993-12-31

    Dysprosium bis (tetraphenylporphyrinate) and bis (dysprosium) Tris (tetraphenylporphyrinate) were synthesized from dysprosium tetraphenylporphyrinate prepared in situ, and characterized by IR, UV-vis, TGA, DTA, EPR and magnetic susceptibility measurements. The double decker compound was obtained by direct oxidation of the HDy(TPP){sub 2} intermediate. The existence of the radical anion, (TPP){sup -} , in the double decker product was conformed by EPR spectrometry. Dysprosium monoporphyrinate was isolated and characterized by the same techniques. (Author).

  14. Method for producing dysprosium-iron-boron alloy powder

    International Nuclear Information System (INIS)

    Camp, F.E.; Wooden, S.A.

    1989-01-01

    A method for producing a dysprosium-iron alloy adapted for use in the manufacture of rare-earth element containing, iron-boron permanent magnets, the method including providing a particle mixture comprising dysprosium oxide, iron and calcium, compacting the particle mixture to produce a consolidated article, heating the article for a time at temperature to form a metallic compound comprising dysprosium and iron and to form calcium oxide, producing a particle mass of -35 mesh from the compact, washing the particle mass with water at a temperature no greater than 10 0 C to react to the calcium and to the calcium oxide therewith to form a calcium hydroxide, while preventing oxidation of the particle mass, and removing the calcium hydroxide from the particle mass

  15. Synthesis and thermal decomposition study of dysprosium trifluoroacetate

    DEFF Research Database (Denmark)

    Opata, Y. A.; Grivel, J.-C.

    2018-01-01

    A study of the thermal decomposition process of dysprosium trifluoroacetate hydrate under flowing argon is presented. Thermogravimetry, differential thermal analysis, evolved gas analysis and ex-situ x-ray diffraction techniques have been employed in the investigation. Three main stages were...

  16. Magnon contribution to electrical resistance of gadolinium-dysprosium alloy single crystals

    International Nuclear Information System (INIS)

    Nikitin, S.A.; Slobodchikov, S.S.; Solomkin, I.K.

    1978-01-01

    The magnon, phonon and interelectron collision contributions to the electric resistance of single crystals of gadolinium-dysprosium alloys were quantified. A relationship was found to exist between the electric resistance and the variation of the topology of the Fermi surface on melting of gadolinium with dysprosium. It was found that gadolinium-dysprosium alloys, which have no helicoidal magnetic structure in magnetically ordered state, feature a spin-spin helicoidal-type correlations in the paramagnetic field

  17. Compounds of divalent thulium, neodymium, and dysprosium

    International Nuclear Information System (INIS)

    Bochkarev, M.N.; Fedushkin, I.L.; Trifonov, A.A.; Fagin, A.A.; Kirillov, E.N.

    1998-01-01

    Full text: Judging on the Ln(II)/Ln(III) potentials Tm, Nd, and Dy are the first candidates after Sm, Eu, and Yb for the preparation of Ln(II) compounds. The first molecular Tm(II) derivatives, TmI 2 (DME) 3 (I), has been obtained recently by the reduction of TmI 3 with thulium metal in DME (1,2-dimethoxyethane). The tetrahydrofuran (THF) analogue, TmI 2 (THF) 5 , was synthesized similarly. In the case of TmBI 3 and TmCl 3 the same reaction does not occur. The compound I is inert toward naphthalene, anthracene, phenylacetylene, CpH, (Me 3 Si) 2 NH, 2,4,6-t-Bu 3 C 6 H 2 OH, Cp 2 V, Cp 2 Fe, or Cp 3 Er. The reactions of I with PhOH, Ph 3 COH, 3,6-t-Bu 2 C 6 H 2 (OH) 2 -1,2 (Cat), and calixarene (Cal) produce, Ph 3 COTmI 2 (DME) 2 , (Cat)TmI(DME) 2 , and (Cal)TmI, correspondingly. The attempts to use I for preparation of the other Tm(II) complexes failed. In all cases (reactions with C 10 H 8 Li, CpK, [1,3-(Me 3 Si) 2 C 5 H 3 ]MgCl, and [Cp'-SiMe 2 -Ind']K 2 ) the Tm(III) derivatives (respectively, (C 10 H 8 Tm) 2 C 10 H 8 , Cp 3 Tm, [1,3-(Me 3 Si) 2 C 5 H 3 ] 2 TmCl, and Cp'-SiMe 2 -Ind')TmI) were obtained. The new stable Tm(II) complex, PhOTmI(DME) 2 (II), has been synthesized by the reduction of I with potassium metal in DME. The product was isolated as the green crystals with μ eff 4.6 BM. Unlike TmI 3 , NdI 3 and DyI 3 can not be reduced by metallic neodymium, dysprosium or sodium in DME or THF. Re-investigation of the product formed in the reaction of NdCl 3 with a lack of Li and naphthalene which was claimed before as NdCl 2 (THF) 2 has shown that this is a mixture of Nd(III) naphthalene complexes of the type [(NdCl 2 (THF) 2 ]nC 10 H 8 (n = 4- 7) (III). Nevertheless the product may be used instead of NdCl 2 for the preparation of RNdCl 2 type complexes. The reactions of III with t-BuNCH=CHNBu-t (DAD), PhCH=CHCH=CHPh (DBD), and PhCH=CHPh afford (DAD)NdCl 2 (THF) 2 , (DBD)[NdCl 2 (THF) 2 ] 2 , and (PhCHCHPh)[NdCl 2 ] 2 (THF) 3 , respectively. The iodides of Nd

  18. Properties of Polydisperse Tin-doped Dysprosium and Indium Oxides

    Directory of Open Access Journals (Sweden)

    Malinovskaya Tatyana

    2017-01-01

    Full Text Available The results of investigations of the complex permittivity, diffuse-reflectance, and characteristics of crystal lattices of tin-doped indium and dysprosium oxides are presented. Using the methods of spectroscopy and X-ray diffraction analysis, it is shown that doping of indium oxide with tin results in a significant increase of the components of the indium oxide complex permittivity and an appearance of the plasma resonance in its diffuse-reflectance spectra. This indicates the appearance of charge carriers with the concentration of more than 1021 cm−3 in the materials. On the other hand, doping of the dysprosium oxide with the same amount of tin has no effect on its optical and electromagnetic properties.

  19. Charge transfer cross sections for dysprosium and cerium

    Energy Technology Data Exchange (ETDEWEB)

    Adachi, Hajime; Tamura, Koji; Okazaki, Tetsuji; Shibata, Takemasa [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-06-01

    Symmetric resonant charge transfer cross sections between singly ionized ions and the parent atoms were measured for dysprosium and cerium in the impact energy of 200-2000eV. The cross sections were determined from the ratio between the number of ions produced by charge transfer and those in primary ion beam. The primary ion beam was produced by a laser ion source in which their atoms were ionized by laser resonant photo-ionization. The slow ions produced by charge transfer and fast primary ions were detected with Faraday cups. The obtained cross sections were (1.82{+-}0.14) x 10{sup -14} cm{sup 2} for dysprosium and (0.88{+-}0.12) x 10{sup -14} cm{sup 2} for cerium in the above energy range. The difference of these values can mostly be explained by considering the electron configurations of these atoms and ions. (author)

  20. Charge transfer cross sections for dysprosium and cerium

    International Nuclear Information System (INIS)

    Adachi, Hajime; Tamura, Koji; Okazaki, Tetsuji; Shibata, Takemasa

    1998-06-01

    Symmetric resonant charge transfer cross sections between singly ionized ions and the parent atoms were measured for dysprosium and cerium in the impact energy of 200-2000eV. The cross sections were determined from the ratio between the number of ions produced by charge transfer and those in primary ion beam. The primary ion beam was produced by a laser ion source in which their atoms were ionized by laser resonant photo-ionization. The slow ions produced by charge transfer and fast primary ions were detected with Faraday cups. The obtained cross sections were (1.82±0.14) x 10 -14 cm 2 for dysprosium and (0.88±0.12) x 10 -14 cm 2 for cerium in the above energy range. The difference of these values can mostly be explained by considering the electron configurations of these atoms and ions. (author)

  1. Neutron capture measurements and resonance parameters of dysprosium

    Energy Technology Data Exchange (ETDEWEB)

    Shin, S.G.; Kye, Y.U.; Namkung, W.; Cho, M.H. [Pohang University of Science and Technology, Division of Advanced Nuclear Engineering, Pohang, Gyeongbuk (Korea, Republic of); Kang, Y.R.; Lee, M.W. [Dongnam Inst. of Radiological and Medical Sciences, Research Center, Busan (Korea, Republic of); Kim, G.N. [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Ro, T.I. [Dong-A University, Department of Physics, Busan (Korea, Republic of); Danon, Y.; Williams, D. [Rensselaer Polytechnic Institute, Department of Mechanical, Aerospace, and Nuclear Engineering, Troy, NY (United States); Leinweber, G.; Block, R.C.; Barry, D.P.; Rapp, M.J. [Naval Nuclear Laboratory, Knolls Atomic Power Laboratory, Schenectady, NY (United States)

    2017-10-15

    Neutron capture yields of dysprosium isotopes ({sup 161}Dy, {sup 162}Dy, {sup 163}Dy, and {sup 164}Dy) were measured using the time-of-flight method with a 16 segment sodium iodide multiplicity detector. The measurements were made at the 25m flight station at the Gaerttner LINAC Center at Rensselaer Polytechnic Institute. Resonance parameters were obtained using the multilevel R-matrix Bayesian code SAMMY. The neutron capture data for four enriched dysprosium isotopes and one natural dysprosium sample were sequentially fitted. New resonances not listed in ENDF/B-VII.1 were observed. There were 29 and 17 new resonances from {sup 161}Dy and {sup 163}Dy isotopes, respectively. Six resonances from {sup 161}Dy isotope, two resonances from {sup 163}Dy, and four resonances from {sup 164}Dy were not observed. The capture resonance integrals of each isotope were calculated with the resulting resonance parameters and those of ENDF/B-VII.1 in the energy region from 0.5 eV to 20 MeV and were compared to the capture resonance integrals with the resonance parameters from ENDF/B-VII.1. A resonance integral value of the natural dysprosium calculated with present resonance parameters was 1405 ± 3.5 barn. The value is ∝ 0.3% higher than that obtained with the ENDF/B-VII.1 parameters. The distributions of the present and ENDF/B-VII.1 neutron widths were compared to a Porter-Thomas distribution. Neutron strength functions for {sup 161}Dy and {sup 163}Dy were calculated with the present resonance parameters and both values were in between the values of ''Atlas of Neutron Resonances'' and ENDF/B-VII.1. The present radiation width distributions of {sup 161}Dy and {sup 163}Dy were fitted with the χ{sup 2} distribution by varying the degrees of freedom. (orig.)

  2. The development of dysprosium-165 hydroxide macroaggregates for radiation synovectomy

    International Nuclear Information System (INIS)

    McLaren, A.B.; Hetherington, E.L.R.; Maddalena, D.J.; Snowden, G.M.

    1988-06-01

    The development of a dysprosium-165 product, Dy-HMA, which is suitable for the radiation synovectomy of arthritic joints is described. Dysprosium-165 is a short-lived (t 1/2 = 139 min) beta-emitter produced by the neutron irradiation of natural dysprosium. Dy-HMA is a suspension of macroaggregated hydroxide particles in saline with the majority of particles in the 3-5 μm range. Studies in rabbits have demonstrated minimal leakage following the intra-articular injection of a knee joint. At 24 hours, the accumulation in the liver is about 0.003% of the injected dose and there is considerably less in other organs and tissue. The use of Dy-HMA has considerable advantages over the presently used yttrium-90 products. The undesired leakage to and subsequent irradiation of other organs is considerably reduced. The period of hospitalisation is reduced from four days to one and the production of 165 Dy in Australia will overcome the difficulties of supply 90 Y from overseas. 21 refs., 1 fig., 18 tabs

  3. Dosimetric properties of dysprosium doped lithium borate glass irradiated by 6 MV photons

    International Nuclear Information System (INIS)

    Ab Rasid, A.; Wagiran, H.; Hashim, S.; Ibrahim, Z.; Ali, H.

    2015-01-01

    Undoped and dysprosium doped lithium borate glass system with empirical formula (70–x) B 2 O 3 –30 Li 2 O–(x) Dy 2 O 3 (x=0.1, 0.3, 0.5, 0.7, 1.0 mol%) were prepared using the melt-quenching technique. The dosimetric measurements were performed by irradiating the samples to 6 MV photon beam using linear accelerator (LINAC) over a dose range of 0.5–5.0 Gy. The glass series of dysprosium doped lithium borate glass produced the best thermoluminescence (TL) glow curve with the highest intensity peak from sample with 1.0 mol% Dy 2 O 3 concentration. Minimum detectable dose was detected at 2.24 mGy, good linearity of regression coefficient, high reproducibility and high sensitivity compared to the undoped glass are from 1.0 mol% dysprosium doped lithium borate glass. The results indicated that the series of dysprosium doped lithium glasses have a great potential to be considered as a thermoluminescence dosimetry (TLD). - Highlights: • TL response of undoped and dysprosium doped lithium borate glass subjected to 6 MV photons irradiation at low dose range. • TL linear response of dysprosium doped lithium borate glass. • The sensitivity of dysprosium doped lithium borate glass is approximately 93 times higher than undoped glass

  4. 33 CFR 159.95 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety. 159.95 Section 159.95... SANITATION DEVICES Design, Construction, and Testing § 159.95 Safety. (a) Each device must— (1) Be free of... explosion or over pressurization as a result of an accumulation of gases; and (3) Meet all other safety...

  5. 33 CFR 159.69 - Motor ratings.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Motor ratings. 159.69 Section 159.69 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.69 Motor ratings. Motors must be rated...

  6. 33 CFR 159.307 - Untreated sewage.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Untreated sewage. 159.307 Section 159.307 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Operations § 159.307 Untreated sewage. No person shall discharge any untreated sewage from a cruise vessel...

  7. Elevated temperature study of Nd-Fe-B--based magnets with cobalt and dysprosium additions

    International Nuclear Information System (INIS)

    Gauder, D.R.; Froning, M.H.; White, R.J.; Ray, A.E.

    1988-01-01

    This paper discusses the elevated temperature performance of Nd-Fe-B magnets containing 0--15 wt. % cobalt substitutions for iron and 0--10 wt. % dysprosium substitutions for neodymium. Test samples were prepared using conventional powder metallurgy techniques. Elevated temperature hysteresis loop and open-circuit measurements were performed on the samples to investigate irreversible losses and long term aging losses at 150 0 C. Magnets with high amounts of both cobalt and dysprosium exhibited lower losses of coercivity and magnetization. Dysprosium had more influence on the elevated temperature performance of the material than did cobalt

  8. Study on the electrochemical of the metal deposition from ionic liquids for lithium, titanium and dysprosium

    International Nuclear Information System (INIS)

    Berger, Claudia A.

    2017-01-01

    The thesis was aimed to the characterization of electrochemically deposited film of lithium, titanium and dysprosium on Au(111) from different ionic liquids, finally dysprosium on neodymium-iron-boron magnate for industrial applications. The investigation of the deposits were performed using cyclic voltametry, in-situ scanning tunneling microscopy, electrochemical quartz microbalance, XPS and Auger electron spectroscopy. The sample preparation is described in detail. The deposition rate showed a significant temperature dependence.

  9. A terminal fluoride ligand generates axial magnetic anisotropy in dysprosium complexes

    Energy Technology Data Exchange (ETDEWEB)

    Norel, Lucie [Department of Chemistry, University of California, Berkeley, CA (United States); Univ Rennes, CNRS, ISCR (Institut des Sciences Chimiques de Rennes) - UMR 6226, Rennes (France); Darago, Lucy E.; Chakarawet, Khetpakorn; Gonzalez, Miguel I.; Olshansky, Jacob H.; Long, Jeffrey R. [Department of Chemistry, University of California, Berkeley, CA (United States); Le Guennic, Boris; Rigaut, Stephane [Univ Rennes, CNRS, ISCR (Institut des Sciences Chimiques de Rennes) - UMR 6226, Rennes (France)

    2018-02-12

    The first dysprosium complexes with a terminal fluoride ligand are obtained as air-stable compounds. The strong, highly electrostatic dysprosium-fluoride bond generates a large axial crystal-field splitting of the J=15/2 ground state, as evidenced by high-resolution luminescence spectroscopy and correlated with the single-molecule magnet behavior through experimental magnetic susceptibility data and ab initio calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  10. Terbium and dysprosium complexes luminescence at low temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Meshkova, S B; Kravchenko, T B; Kononenko, L.I.; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Fiziko-Khimicheskij Inst.

    1979-01-01

    The variation is studied of the luminescence intensity of terbium and dysprosium complexes used in the analysis as solutions are cooled down to the liquid nitrogen temperature. Three groups of methods have been studied: observation of fluorescence of aqueous solutions, precipitate and extract suspensions in organic solvents. The brightest luminescence and greatest increase in luminescence intensity are observed at freezing of complex solvents with 1,2-dioxybenzene-3,5-disulfonic acid (DBSA) and iminodiacetic acid (IDA) and DBSA+EDTA, as well as in the case of benzene extracting of complexes with phenanthroline and salicylic acid. Otherwise the intensity increases 2-14-fold and for the complex of terbium with acetoacetic ester 36-fold.

  11. Dysprosium (holmium) determination in the presence of erbium and dysprosium (holmium, erbium) determination in the presence of cerium

    International Nuclear Information System (INIS)

    Tolubara, A.I.; Kochubej, A.I.; Usatenko, Yu.I.

    1978-01-01

    Effect of salicylic acid upon complex formation in the systems REE - boronsulfoalizarinate, REE - oxine and REE - boronsulfoalizarinate - oxine is investigated. Comparison of optical characteristics of the above systems in the absence and in the presence of salicylic acid is carried out. It is established that in all the cases the effect of salicylic acid depends both on the nature of REE and the ratio of all the components of the system. Under certain conditions the given dependence is observed only for erbium complexes. Extraction-photometric methods of dysprosium and holmium determination in the presence of equal erbium amounts, as well as holmium and erbium determination in the presence of cerium equal amounts is developed

  12. Dysprosium (holmium) determination in the presence of erbium and dysprosium (holmium, erbium) determination in the presence of cerium

    Energy Technology Data Exchange (ETDEWEB)

    Tolubara, A I; Kochubei, A I; Usatenko, Yu I

    1978-01-01

    Effect of salicylic acid upon complex formation in the systems REE - boronsulfoalizarinate, REE - oxine and REE - boronsulfoalizarinate - oxine is investigated. Comparison of optical characteristics of the above systems in the absence and in the presence of salicylic acid is carried out. It is established that in all the cases the effect of salicylic acid depends both on the nature of REE and the ratio of all the components of the system. Under certain conditions the given dependence is observed only for erbium complexes. Extraction-photometric methods of dysprosium and holmium determination in the presence of equal erbium amounts, as well as holmium and erbium determination in the presence of cerium equal amounts is developed.

  13. 9 CFR 381.159 - Poultry rolls.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Poultry rolls. 381.159 Section 381.159... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Definitions and Standards of Identity or Composition § 381...

  14. 33 CFR 159.75 - Overcurrent protection.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Overcurrent protection. 159.75...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.75 Overcurrent protection. Overcurrent protection must be provided within the unit to protect subcomponents of the device if the...

  15. 49 CFR 173.159 - Batteries, wet.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Batteries, wet. 173.159 Section 173.159... Batteries, wet. (a) Electric storage batteries, containing electrolyte acid or alkaline corrosive battery fluid (wet batteries), may not be packed with other materials except as provided in paragraphs (g) and...

  16. 33 CFR 159.85 - Sewage removal.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sewage removal. 159.85 Section...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.85 Sewage removal. The device must be designed for efficient removal of nearly all of the liquid and solids in the sewage retention...

  17. 33 CFR 159.61 - Vents.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Vents. 159.61 Section 159.61 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION MARINE... to minimize clogging by either the contents of the tank or climatic conditions such as snow or ice. ...

  18. Isotopic shifts and configuration mixing in the dysprosium II spectrum

    International Nuclear Information System (INIS)

    Aufmuth, P.

    1977-01-01

    Using a photoelectric Fabry-Perot spectrometer with digital data acquisition, the isotopic shifts of all stable dysprosium isotopes (Z = 66, A = 156, 158, 160, 161, 162, 163, 164) have been measured in transitions from the groundstate configuration 4f 10 6s to the excited configurations 4f 9 5d6s, 4f 9 5d 2 , and 4f 10 6p of the spark spectrum. Mass and volume effects have been seperated; the results are compared with arc spectrum measurements. From the volume effect of a pure s-p transition the change of the mean electric quadratic nuclear radius delta 2 > has been calculated. In order to test fine structure calculations of the Dy II spectrum, the isotopic shifts of 29 lines of the isotopes 162 Dy and 164 Dy have been measured. Based on the sharing rule, the reported configuration mixing could be confirmed in principle; for one energy level (E = 22908 K) the asignement has been proved to be false, in the case of three other levels (E = 22467, 22672, and 28885 K) the asignement is doubtfull. For the ground state levels 4f 10 6s 6 I the influence of relativistic effects could be proved; these effects can be interpreted in the framework of a parametric representation of the isotopic shift. The order of magnitude of the crossed second order effects has been estimated. (orig.) [de

  19. Low Field Magnetic and Thermal Hysteresis in Antiferromagnetic Dysprosium

    Directory of Open Access Journals (Sweden)

    Iuliia Liubimova

    2017-06-01

    Full Text Available Magnetic and thermal hysteresis (difference in magnetic properties on cooling and heating have been studied in polycrystalline Dy (dysprosium between 80 and 250 K using measurements of the reversible Villari effect and alternating current (AC susceptibility. We argue that measurement of the reversible Villari effect in the antiferromagnetic phase is a more sensitive method to detect magnetic hysteresis than the registration of conventional B(H loops. We found that the Villari point, recently reported in the antiferromagnetic phase of Dy at 166 K, controls the essential features of magnetic hysteresis and AC susceptibility on heating from the ferromagnetic state: (i thermal hysteresis in AC susceptibility and in the reversible Villari effect disappears abruptly at the temperature of the Villari point; (ii the imaginary part of AC susceptibility is strongly frequency dependent, but only up to the temperature of the Villari point; (iii the imaginary part of the susceptibility drops sharply also at the Villari point. We attribute these effects observed at the Villari point to the disappearance of the residual ferromagnetic phase. The strong influence of the Villari point on several magnetic properties allows this temperature to be ranked almost as important as the Curie and Néel temperatures in Dy and likely also for other rare earth elements and their alloys.

  20. Kinetics of the nitridation of dysprosium during mechanochemical processing

    Energy Technology Data Exchange (ETDEWEB)

    Alanko, Gordon A.; Osterberg, Daniel D.; Jaques, Brian J. [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Hurley, Michael F. [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States); Butt, Darryl P., E-mail: darrylbutt@boisestate.edu [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States)

    2015-01-25

    Highlights: • DyN was mechanochemically synthesized by milling pure metal under nitrogen. • Temperature and pressure were monitored to investigate reaction progress. • The effects of metal adhered to media on the impact energetics was measured. • The reactive milling kinetics are described in terms of reactive surface formation. - Abstract: Dysprosium nitride was synthesized by the reactive milling of the rare earth metal under 400 kPa nitrogen gas in a planetary ball mill. The nitrogen consumption rate was calculated from in situ temperature and pressure measurements to find the reaction extent as a function of milling time at milling speeds from 350 to 650 rpm. The results are analyzed in terms of a fundamental milling dynamics model in which the input milling energy is the primary driving force for reaction and the rate limiting step of the nitridation kinetics is the formation of chemically active surfaces. The model differs from traditional gas–solid reactions which are often limited by diffusion of a species through a surface layer or by dissociation of the gas molecule. These results give fresh insight into reactive gas–solid milling kinetics.

  1. 19 CFR 159.33 - Proclaimed rate.

    Science.gov (United States)

    2010-04-01

    ... currency involved, such proclaimed rate shall be used unless it varies by 5 percent or more from the... (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.33 Proclaimed rate. If a rate of...

  2. Systems of pyridine, piperidine, piperazine, morpholine hydrochlorides-terbium (dysprosium) chloride-water

    International Nuclear Information System (INIS)

    Gajfutdinova, R.K.; Sharafutdinova, A.A.; Murinov, Yu.I.

    1988-01-01

    The isothermal cross section method at 25 and 50 deg C is applied to study pyridine hydrochloride-terbium chloride-water (1) piperidine hydrochloride-dysprosium chloride-water (2), piperazine dihydrochloride-dysprosium chloride-water (3) and morpholine hydrochloride-terbium chloride (4) systems. Solubility isotherma prove the formation of incongruently soluble compound of the TbCl 3 x6C 5 H 5 NxHCl composition systems (1). The individuality of the new solid phase is proved by the chemical and DTA methods. Systems (2-4) are of a simple eutonic type

  3. Exploration of dysprosium: the most critical element for Japan

    Science.gov (United States)

    Watanabe, Y.

    2012-04-01

    Dysprosium (Dy), one of the heavy rare earth elements, is used mainly as an additive for NdFeB permanent magnets which are installed in various modern industrial products such as voice coil motors in computers, factory automation machinery, hybrid and electric vehicles, home electronics, and wind turbine, to improve heat resistance of the magnets. Dy has been produced about 2,000t per year from the ores from ion adsorption type deposits in southern China. However, the produced amount of Dy was significantly reduced in 2011 in China due to reservation of heavy rare earth resources and protection of natural environment, resulting in soaring of Dy price in the world. In order to respond the increasing demand of Dy, unconventional supply sources are inevitably developed, in addition to heavy rare earth enriched ion adsorption type deposits outside China. Heavy rare earth elements including Dy are dominantly hosted in xenotime, fergusonite, zircon, eudialyte, keiviite, kainosite, iimoriite, etc. Concentration of xenotime is found in placer deposits in Malaysia and India, hydrothermal deposits associated with unconformity-type uranium mineralization (Athabasca basin in Canada, Western Australia), iron-oxide fluorite mineralization (South Africa) and Sn-bearing alkaline granite (Brazil). Zircon and fergusontie concentration is found as igneous and hydrothermal products in peralkaline syenite, alkaline granite and pegmatite (e.g., Nechalacho in Canada). Eudialyte concentration is found in some peralkaline syenite bodies in Greenland, Canada, Sweden and Russia. Among these sources, large Dy resources are estimated in the deposits hosted in peralkaline rocks (Nechalacho: 79,000t, Kvanefjeld: 49,000t, Norra Karr: 15,700t, etc.) compared to the present demand of Dy. Thus, Dy will be supplied from the deposits associated with peralkaline and alkaline deposits in future instead of ion adsorption type deposits in southern China.

  4. Dosimetric properties of dysprosium doped lithium borate glass irradiated by 6 MV photons

    Science.gov (United States)

    Ab Rasid, A.; Wagiran, H.; Hashim, S.; Ibrahim, Z.; Ali, H.

    2015-07-01

    Undoped and dysprosium doped lithium borate glass system with empirical formula (70-x) B2O3-30 Li2O-(x) Dy2O3 (x=0.1, 0.3, 0.5, 0.7, 1.0 mol%) were prepared using the melt-quenching technique. The dosimetric measurements were performed by irradiating the samples to 6 MV photon beam using linear accelerator (LINAC) over a dose range of 0.5-5.0 Gy. The glass series of dysprosium doped lithium borate glass produced the best thermoluminescence (TL) glow curve with the highest intensity peak from sample with 1.0 mol% Dy2O3 concentration. Minimum detectable dose was detected at 2.24 mGy, good linearity of regression coefficient, high reproducibility and high sensitivity compared to the undoped glass are from 1.0 mol% dysprosium doped lithium borate glass. The results indicated that the series of dysprosium doped lithium glasses have a great potential to be considered as a thermoluminescence dosimetry (TLD).

  5. In situ characterization of the nitridation of dysprosium during mechanochemical processing

    Energy Technology Data Exchange (ETDEWEB)

    Jaques, Brian J.; Osterberg, Daniel D.; Alanko, Gordon A.; Tamrakar, Sumit; Smith, Cole R.; Hurley, Michael F.; Butt, Darryl P., E-mail: DarrylButt@BoiseState.edu

    2015-01-15

    Highlights: • A nitridation reaction in a high energy planetary ball mill was monitored in situ. • Dysprosium mononitride was synthesized from Dy at low temperatures in short times. • Ideal gas law and in situ temperature and pressure used to assess reaction extent. • It is proposed that reaction rate is proportional to the creation of new surface. - Abstract: Processing of advanced nitride ceramics traditionally requires long durations at high temperatures and, in some cases, in hazardous atmospheres. In this study, dysprosium mononitride (DyN) was rapidly formed from elemental dysprosium in a closed system at ambient temperatures. An experimental procedure was developed to quantify the progress of the nitridation reaction during mechanochemical processing in a high energy planetary ball mill (HEBM) as a function of milling time and intensity using in situ temperature and pressure measurements, SEM, XRD, and particle size analysis. No intermediate phases were formed. It was found that the creation of fresh dysprosium surfaces dictates the rate of the nitridation reaction, which is a function of milling intensity and the number of milling media. These results show clearly that high purity nitrides can be synthesized with short processing times at low temperatures in a closed system requiring a relatively small processing footprint.

  6. A model for additive transport in metal halide lamps containing mercury and dysprosium tri-iodide

    NARCIS (Netherlands)

    Beks, M.L.; Haverlag, M.; Mullen, van der J.J.A.M.

    2008-01-01

    The distribution of additives in a metal halide lamp is examined through numerical modelling. A model for a lamp containing sodium iodide additives has been modified to study a discharge containing dysprosium tri-iodide salts. To study the complex chemistry the method of Gibbs minimization is used

  7. Neutronography of an intermediate phase in dysprosium near the Neel point

    Energy Technology Data Exchange (ETDEWEB)

    Bessergenev, V G; Gogava, V V; Kovalevskaya, Yu A; Mandzhavidze, A G; Fedorov, V M; Shilo, S I

    1985-11-25

    Neutronographical study of dysprosium magnetic structure near the point of magnetic disordering depending on thermal prehistory of the sample is carried out. Intermediate vortex phase transformed then into the helical one is shown to occur from the paramagnetic phase under cooling.

  8. Synthesis and X-ray structure of the dysprosium(III) complex derived ...

    African Journals Online (AJOL)

    Synthesis and X-ray structure of the dysprosium(III) complex derived from the ligand 5-chloro-1 ... Bulletin of the Chemical Society of Ethiopia ... synthesized and its crystal structure determined by single X-ray diffraction at room temperature.

  9. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    KAUST Repository

    Arratia-Quijada, Jenny

    2015-10-23

    A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  10. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    KAUST Repository

    Arratia-Quijada, Jenny; Sá nchez Jimé nez, Cecilia; Gurinov, Andrei; Pé rez Centeno, Armando; Ceja Andrade, Israel; Carbajal Arí zaga, Gregorio Guadalupe

    2015-01-01

    A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  11. Dysprosium complexes with the tetraphenylporphyrin macrocyclic ligand; Complejos de disprosio con el ligante macrociclico tetrafenilporfirina

    Energy Technology Data Exchange (ETDEWEB)

    Martinez M, V.; Padilla, J.; Ramirez, F.M

    1992-04-15

    In this report, the results obtained on the synthesis, characterization and study of the chemical behavior of dysprosium complex with the acetylacetone chelating agent (Hacac) and the tetraphenylporphyrin macrocyclic ligand (H{sub 2}TFP) are given. Based on the literature but according to our necessities and interest, the appropriate methodology settled down from the synthesis of prime matters until the obtaining and characterization of the products. The acetyl acetonate complex was obtained of mono hydrated dysprosium [Dy(acac){sub 3}. H{sub 2}0] and trihydrated [Dy(acac){sub 3} .3 H{sub 2}0], the mono tetra phenyl porphyrinate [Dy(TFP)(acac). 2 ac] the double sandwich of the dysprosium porphyrinate [Dy(TFP){sub 2}] and the triple sandwich of the dysprosium porphyrinate [Dy(TFP){sub 3}. 2 TCB] (TCB = trichlorobenzene). Its were characterized by their melting points, solubility, IR, UV, TGA and DTA both first and besides the techniques already mentioned for NMR'H, RPE and Magnetic susceptibility the three last complexes. From the spectroscopic point of view, IR and RPE its suggested the existence of a complex of inverse mixed valence [Dy(TFP){sup 2-} (TFP) {sup 1-}] for the Dy(TFP){sub 2} as a result of the existence of the free radical (TFP' {sup 1-} and that it was not in none of the other porphyrin compounds. In the NMR'H spectra of the compounds were not observed signals in the region from 0 to 10 ppm that which shows that the dysprosium complexes in special those of the porphyrin type are highly paramagnetic and its could be used as displacement reagents, creators of images and contrast agents of great utility in these days in studies of NMR, technique today by today used in medical diagnoses. (Author)

  12. Dysprosium complexes with the tetraphenylporphyrin macrocyclic ligand; Complejos de disprosio con el ligante macrociclico tetrafenilporfirina

    Energy Technology Data Exchange (ETDEWEB)

    Martinez M, V; Padilla, J; Ramirez, F M

    1992-04-15

    In this report, the results obtained on the synthesis, characterization and study of the chemical behavior of dysprosium complex with the acetylacetone chelating agent (Hacac) and the tetraphenylporphyrin macrocyclic ligand (H{sub 2}TFP) are given. Based on the literature but according to our necessities and interest, the appropriate methodology settled down from the synthesis of prime matters until the obtaining and characterization of the products. The acetyl acetonate complex was obtained of mono hydrated dysprosium [Dy(acac){sub 3}. H{sub 2}0] and trihydrated [Dy(acac){sub 3} .3 H{sub 2}0], the mono tetra phenyl porphyrinate [Dy(TFP)(acac). 2 ac] the double sandwich of the dysprosium porphyrinate [Dy(TFP){sub 2}] and the triple sandwich of the dysprosium porphyrinate [Dy(TFP){sub 3}. 2 TCB] (TCB = trichlorobenzene). Its were characterized by their melting points, solubility, IR, UV, TGA and DTA both first and besides the techniques already mentioned for NMR'H, RPE and Magnetic susceptibility the three last complexes. From the spectroscopic point of view, IR and RPE its suggested the existence of a complex of inverse mixed valence [Dy(TFP){sup 2-} (TFP) {sup 1-}] for the Dy(TFP){sub 2} as a result of the existence of the free radical (TFP' {sup 1-} and that it was not in none of the other porphyrin compounds. In the NMR'H spectra of the compounds were not observed signals in the region from 0 to 10 ppm that which shows that the dysprosium complexes in special those of the porphyrin type are highly paramagnetic and its could be used as displacement reagents, creators of images and contrast agents of great utility in these days in studies of NMR, technique today by today used in medical diagnoses. (Author)

  13. Dysprosium, the balance problem, and wind power technology

    International Nuclear Information System (INIS)

    Elshkaki, Ayman; Graedel, T.E.

    2014-01-01

    Highlights: • We investigate the impacts of the increasing market share of wind power on the demand and supply of REE. • The analysis is carried out using a dynamic material flow and stock model and three scenarios for Dy supply. • The supply of Dy from all deposits will likely lead to an oversupply of the total REEs, Nd, La, Ce and Y. • The supply of Dy from critical REE or Dy rich deposits will likely lead to an oversupply of Ce and Y only. • Large quantities of thorium will be co-produced as a result of Dy demand that needs to be managed carefully. - Abstract: Wind power technology is one of the cleanest electricity generation technologies that are expected to have a substantial share in the future electricity mix. Nonetheless, the expected increase in the market share of wind technology has led to an increasing concern of the availability, production capacity and geographical concentration of the metals required for the technology, especially the rear earth elements (REE) neodymium (Nd) and the far less abundant dysprosium (Dy), and the impacts associated with their production. Moreover, Nd and Dy are coproduced with other rare earth metals mainly from iron, titanium, zirconium, and thorium deposits. Consequently, an increase in the demand for Nd and Dy in wind power technology and in their traditional applications may lead to an increase in the production of the host metals and other companion REE, with possible implications on their supply and demand. In this regard, we have used a dynamic material flow and stock model to study the impacts of the increasing demand for Nd and Dy on the supply and demand of the host metals and other companion REE. In one scenario, when the supply of Dy is covered by all current and expected producing deposits, the increase in the demand for Dy leads to an oversupply of 255 Gg of total REE and an oversupply of the coproduced REE Nd, La, Ce and Y. In the second and third scenarios, however, when the supply of Dy is

  14. Extension of the energy range of the experimental activation cross-sections data of longer-lived products of proton induced nuclear reactions on dysprosium up to 65MeV.

    Science.gov (United States)

    Tárkányi, F; Ditrói, F; Takács, S; Hermanne, A; Ignatyuk, A V

    2015-04-01

    Activation cross-sections data of longer-lived products of proton induced nuclear reactions on dysprosium were extended up to 65MeV by using stacked foil irradiation and gamma spectrometry experimental methods. Experimental cross-sections data for the formation of the radionuclides (159)Dy, (157)Dy, (155)Dy, (161)Tb, (160)Tb, (156)Tb, (155)Tb, (154m2)Tb, (154m1)Tb, (154g)Tb, (153)Tb, (152)Tb and (151)Tb are reported in the 36-65MeV energy range, and compared with an old dataset from 1964. The experimental data were also compared with the results of cross section calculations of the ALICE and EMPIRE nuclear model codes and of the TALYS nuclear reaction model code as listed in the latest on-line libraries TENDL 2013. Copyright © 2015. Published by Elsevier Ltd.

  15. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    Energy Technology Data Exchange (ETDEWEB)

    Arratia-Quijada, Jenny [Departamento de Ciencias de la Salud, Centro Universitario Tonalá, Universidad de Guadalajara, Av. Nuevo Periférico No. 555, C.P. 48525, Tonalá, Jalisco (Mexico); Sánchez Jiménez, Cecilia [Departamento de Química, Universidad de Guadalajara, Boulevard Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico); Gurinov, Andrey [Research Resources Center for Magnetic Resonance, St. Petersburg State University, Universitetskiy pr. 26, 198504 St. Petersburg (Russian Federation); NMR Core Lab, King Abdullah University of Science and Technology, Thuwal 23955-6900 (Saudi Arabia); Pérez Centeno, Armando; Ceja Andrade, Israel [Departamento de Física, Universidad de Guadalajara, Boulevard Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico); Carbajal Arízaga, Gregorio Guadalupe, E-mail: gregoriocarbajal@yahoo.com.mx [Departamento de Química, Universidad de Guadalajara, Boulevard Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico)

    2016-01-15

    Graphical abstract: - Highlights: • LDH structure including dysprosium was prepared by co-precipitation. • LDH was capable to produce contrast in the T1 mode of MRI. • LDH were intercalated with folate, ibuprofen and gallate ions. - Abstract: A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  16. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    International Nuclear Information System (INIS)

    Arratia-Quijada, Jenny; Sánchez Jiménez, Cecilia; Gurinov, Andrey; Pérez Centeno, Armando; Ceja Andrade, Israel; Carbajal Arízaga, Gregorio Guadalupe

    2016-01-01

    Graphical abstract: - Highlights: • LDH structure including dysprosium was prepared by co-precipitation. • LDH was capable to produce contrast in the T1 mode of MRI. • LDH were intercalated with folate, ibuprofen and gallate ions. - Abstract: A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  17. Dysprosium-Catalyzed Growth of Single-Walled Carbon Nanotube Arrays on Substrates

    Directory of Open Access Journals (Sweden)

    Qian Yong

    2009-01-01

    Full Text Available Abstract In this letter, we report that dysprosium is an effective catalyst for single-walled carbon nanotubes (SWNTs growth via a chemical vapor deposition (CVD process for the first time. Horizontally superlong well-oriented SWNT arrays on SiO2/Si wafer can be fabricated by EtOH-CVD under suitable conditions. The structure and properties are characterized by scanning electron microscopy, transition electron microscopy, Raman spectroscopy and atomic force microscopy. The results show that the SWNTs from dysprosium have better structural uniformity and better conductivity with fewer defects. This rare earth metal provides not only an alternative catalyst for SWNTs growth, but also a possible method to generate high percentage of superlong semiconducting SWNT arrays for various applications of nanoelectronic device.

  18. Sandwich-type tetrakis(phthalocyaninato) dysprosium-cadmium quadruple-decker SMM.

    Science.gov (United States)

    Wang, Hailong; Qian, Kang; Wang, Kang; Bian, Yongzhong; Jiang, Jianzhuang; Gao, Song

    2011-09-14

    Homoleptic tetrakis[2,3,9,10,16,17,23,24-octa(butyloxy)phthalocyaninato] dysprosium-cadmium quadruple-decker complex 1 was isolated in relatively good yield of 43% from a simple one-pot reaction. This compound represents the first sandwich-type tetrakis(phthalocyaninato) rare earth-cadmium quadruple-decker SMM that has been structurally characterized. This journal is © The Royal Society of Chemistry 2011

  19. {Delta}I = 2 energy staggering in normal deformed dysprosium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Riley, M.A.; Brown, T.B.; Archer, D.E. [Florida State Univ., Tallahassee, FL (United States)] [and others

    1996-12-31

    Very high spin states (I{ge}50{Dirac_h}) have been observed in {sup 155,156,157}Dy. The long regular band sequences, free from sharp backbending effects, observed in these dysprosium nuclei offer the possibility of investigating the occurence of any {Delta}I = 2 staggering in normal deformed nuclei. Employing the same analysis techniques as used in superdeformed nuclei, certain bands do indeed demonstrate an apparent staggering and this is discussed.

  20. Analysis of the x-ray spectrum emitted by laser-produced plasma of dysprosium

    International Nuclear Information System (INIS)

    Marcus, Gilad; Louzon, Einat; Henis, Zohar; Maman, Shlomo; Mandelbaum, Pinchas

    2007-01-01

    A detailed analysis of the x-ray spectrum (5-10.2 A ring ) emitted by laser-produced plasma of dysprosium (Dy) is given using ab initio calculations with the HULLAC relativistic code and isoelectronic trends. Resonance 3d-4p, 3d-nf (n=4 to 7), 3p-4s, and 3p-4d transitions of Ni I-like Dy XXXIX and neighboring ion satellite transitions (from Dy XXXIV to Dy XL) are identified

  1. Phosphor Dysprosium-Doped Layered Double Hydroxides Exchanged with Different Organic Functional Groups

    Directory of Open Access Journals (Sweden)

    David Ricardo Martínez Vargas

    2013-01-01

    Full Text Available The layers of a Zn/Al layered double hydroxide (LDH were doped with Dy3+ cations. Among some compositions, the Zn2+ : Al3+ : Dy3+ molar ratio equal to 30 : 9 : 1 presented a single crystalline phase. Organic anions with carboxylic, amino, sulfate, or phosphate functional groups were intercalated as single layers between LDH layers as confirmed by X-ray diffraction and infrared spectroscopy. Photoluminescence spectra of the nitrate intercalated LDH showed a wide emission band with strong intensity in the yellow region (around 574 nm, originated due to symmetry distortion of the octahedral coordination in dysprosium centers. Moreover, a broad red band emission was also detected apparently due to the presence of zinc oxide. The distorted symmetry of the dysprosium coordination environment, also confirmed by X-ray photoelectron spectroscopy analysis, was modified after the intercalation with phenyl phosphonate (PP, aspartate (Asp, adipate (Adip, and serinate (Ser anions; the emission as measured from PL spectra of these LDH was more intense in the blue region (ca. 486 nm, thus indicating an increase in symmetry of dysprosium octahedrons. The red emission band from zinc oxide kept the same intensity after intercalation of dodecyl sulfate (DDS. An additional emission of unknown origin at λ = 767 nm was present in all LDHs.

  2. Synovectomy of the rheumatoid knee using intra-articular injection of dysprosium-165-ferric hydroxide macroaggregates

    International Nuclear Information System (INIS)

    Sledge, C.B.; Zuckerman, J.D.; Shortkroff, S.; Zalutsky, M.R.; Venkatesan, P.; Snyder, M.A.; Barrett, W.P.

    1987-01-01

    One hundred and eleven patients who had seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with intra-articular injection of 270 millicuries of dysprosium-165 bound to ferric hydroxide macroaggregates. A two-year follow-up was available for fifty-nine of the treated knees. Thirty-nine had a good result; nine, a fair result; and eleven, a poor result. Of the twenty-five knees that had Stage-I radiographic changes, nineteen had a good result. Of the thirty-four knees that had Stage-II radiographic changes, twenty showed a good result. Systemic spread of the radioactivity from the injected joint was minimum. The mean whole-body dose was calculated to be 0.3 rad and that to the liver twenty-four hours after injection, 3.2 rads. The results indicated that dysprosium-165-ferric hydroxide macroaggregate is an effective agent for performing radiation synovectomy, particularly in knees that have Stage-I radiographic changes. Because of the minimum rate of systemic spread of the dysprosium-165, it offers a definite advantage over agents that previously have been used

  3. Development and mastering of production of dysprosium hafnate as absorbing material for control rods of promising thermal neutron reactors

    International Nuclear Information System (INIS)

    Zakharov, A.V.; Risovany, V.D.; Muraleva, E.M.; Sokolov, V.F.

    2011-01-01

    The main advantages of dysprosium hafnate as an absorbing material for LWR control rods are the following: -) unlimited radiation resistance; - two absorbing components, Dy and Hf, increasing physical efficiency of the material compared to Dy 2 O 3 -TiO 2 and alloy 80% Ag - 15% In - 5% Cd; -) variability of physical efficiency by changing a composition, but maintaining other performance characteristics of the material; -) high process-ability due to the absence of phase transients and single-phase structure (solid solution); -) production of high density pellets. Lab-scale mastering of dysprosium hafnate pellets production showed a possibility of material synthesis using a solid-phase method, as well as of dysprosium hafnate pellets production by cold pressing and subsequent sintering. Within a whole range of examined compositions (23 mol% - 75 mol% Dy 2 O 3 ), a single-phase material with a highly radiation resistant fluorite-like structure was produced. Experiments on cold pressing and sintering of pellets confirmed a possibility of producing high quality dysprosium hafnate pellets from synthesized powder. A pilot batch of dysprosium hafnate pellets with standard sizes was produced. The standard sizes corresponded to the absorbing elements of the WWER-1000 control rods and met the main requirements to the absorbing element columns. The pilot batch size was approximately 6 kg. Acceptance testing of the pilot batch of dysprosium hafnate pellets was conducted, fulfillment of the requirements of technical conditions was checked and preirradiation properties of the pellets were examined. High quality of the produced pellets was confirmed, thus, demonstrating a real possibility of producing large batches of the dysprosium hafnate pellets. The next step is the production of test absorbing elements and cluster assemblies for the WWER-1000 control rods with their further installation for pilot operation at one of the Russian nuclear power plants

  4. 159Ho levels excited by 159 Er EC/β+ decay

    International Nuclear Information System (INIS)

    Kallinnikov, V.G.; Ibraheem, Y.S.; Vaganov, Yu.A.; Stegailov, V.I.; Sereeter, Zh.; Chaloun, P.

    2004-01-01

    Full text: The present study of the EC/β + decay of 159 Er to the levels in 159 Ho was completed at the ISOL complex of YASNAPP-2 at JINR, Dubna. Single γ-ray and γ- γ-coincidence spectra were recorded with HPGe-detectors. Conversion electron spectra were measured by using magnetic spectrometer 'mini-orange' with Si(Li) detector. Results of γ-ray and ICE measurements previously reported by Boutet [1] and in our laboratory [2] have been investigated very accurately. It was shown, that a number of week γ-transitions does not belong to the isotope 159 Er. The special attention was given to high-energy part of a γ-spectrum where in ref. [3] 50 γ -transitions were attributed to the decay of 159 Er with E γ ≥1838.5 keV. We shall point out, that some of them were attributed to this nuclide unreasonably, as their energies E γ exceed the energy of β-decay of 159 Er (2768.5 keV). The most of transitions which have been listed in [3] according to our analysis belong to impurities. In addition to the results [1,2] multipolarities of several γ-transitions with E γ >500 keV were determined, that allowed to establish quantum characteristics of separate levels in 159 Ho. The existence of transition with admixture of E0-component indicates that β-vibrational states in daughter nucleus are excited. We observed this E0-component in the γ- transition (939.5 keV) in the case of 159 Er decay to the levels in 159 Ho. As in the case of 161 Er decay, it was not possible for us to find out three-quasiparticle states in 159 Ho, predicted by superfluid model at excitation energies E γ ≥ 1.5 MeV by observation of the fast au- β- transitions. This work was supported by RFBR (grant No. 03-02-17395)

  5. Molecular Cloud Structures and Massive Star Formation in N159

    Science.gov (United States)

    Nayak, O.; Meixner, M.; Fukui, Y.; Tachihara, K.; Onishi, T.; Saigo, K.; Tokuda, K.; Harada, R.

    2018-02-01

    The N159 star-forming region is one of the most massive giant molecular clouds (GMCs) in the Large Magellanic Cloud (LMC). We show the 12CO, 13CO, CS molecular gas lines observed with ALMA in N159 west (N159W) and N159 east (N159E). We relate the structure of the gas clumps to the properties of 24 massive young stellar objects (YSOs) that include 10 newly identified YSOs based on our search. We use dendrogram analysis to identify properties of the molecular clumps, such as flux, mass, linewidth, size, and virial parameter. We relate the YSO properties to the molecular gas properties. We find that the CS gas clumps have a steeper size–linewidth relation than the 12CO or 13CO gas clumps. This larger slope could potentially occur if the CS gas is tracing shocks. The virial parameters of the 13CO gas clumps in N159W and N159E are low (<1). The threshold for massive star formation in N159W is 501 M ⊙ pc‑2, and the threshold for massive star formation in N159E is 794 M ⊙ pc‑2. We find that 13CO is more photodissociated in N159E than N159W. The most massive YSO in N159E has cleared out a molecular gas hole in its vicinity. All the massive YSO candidates in N159E have a more evolved spectral energy distribution type in comparison to the YSO candidates in N159W. These differences lead us to conclude that the giant molecular cloud complex in N159E is more evolved than the giant molecular cloud complex in N159W.

  6. 36 CFR 406.152-406.159 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.152-406.159 Section 406.152-406.159 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.152-406.159 [Reserved] ...

  7. 19 CFR 159.38 - Rates for estimated duties.

    Science.gov (United States)

    2010-04-01

    ... TREASURY (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.38 Rates for estimated duties. For purposes of calculating estimated duties, the port director shall use the rate or rates... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rates for estimated duties. 159.38 Section 159.38...

  8. 19 CFR 159.31 - Rates to be used.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.31 Rates to be used. Except as otherwise specified in this subpart, no rate or rates of exchange shall be used to convert foreign currency... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rates to be used. 159.31 Section 159.31 Customs...

  9. 19 CFR 159.3 - Rounding of fractions.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rounding of fractions. 159.3 Section 159.3 Customs... (CONTINUED) LIQUIDATION OF DUTIES General Provisions § 159.3 Rounding of fractions. (a) Value. In the... cents or more, the lower fractions shall be dropped, and if it is necessary to take up as whole dollars...

  10. 28 CFR 39.152-39.159 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.152-39.159 Section 39.152-39.159 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.152-39.159 [Reserved] ...

  11. 45 CFR 2490.152-2490.159 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.152-2490.159 Section 2490.152-2490.159 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.152-2490.159 [Reserved] ...

  12. 49 CFR 28.152-28.159 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.152-28.159 Section 28.152-28.159 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.152-28.159 [Reserved] ...

  13. Systematic study on surface and magnetostructural changes in Mn-substituted dysprosium ferrite by hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Rekha, G. [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Tholkappiyan, R. [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Department of Physics, College of Science, UAE University, Al-Ain 15551 (United Arab Emirates); Vishista, K., E-mail: raovishista@gmail.com [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Hamed, Fathalla [Department of Physics, College of Science, UAE University, Al-Ain 15551 (United Arab Emirates)

    2016-11-01

    Highlights: • Garnet type Dy{sub 3}Fe{sub 5-x}Mn{sub x}O{sub 12} (x = 0–0.06) nanoparticles of 88.4–86.8 nm were synthesized by hydrothermal method. • The Dy, Mn, Fe and O elements in the ferrites were confirmed from XPS. • The multiple oxidation states of Fe and Mn ions, bonding energy and cationic distributions of the samples were examined by XPS. • The magnetic property shows ferromagnetic behavior from VSM technique. • The results from these studies are correlated with respect to Mn dopant. - Abstract: Dysprosium iron garnets are of scientific importance because of the wide range of magnetic properties that can be obtained in substituting dysprosium by a rare earth metal. In the present work, the effect of Mn substitution on magnetostructural changes in dysprosium ferrite nanoparticles is studied. Highly crystalline pure and Mn doped dysprosium ferrite nanoparticles were synthesized by hydrothermal method. The samples were calcined at 1100 °C for 2 h in air atmosphere which is followed by characterization using XRD, FT-IR analysis, SEM, XPS and VSM. The average crystallite size of synthesized samples were calculated by X-ray diffraction falls in the range of 88.4–86.8 nm and was found to be in cubic garnet structure. For further investigation of the structure and corresponding changes in the tetrahedral and octahedral stretching vibrational bonds, FT-IR was used. The synthesized samples consist of multiple oxidation (Fe{sup 3+} and Fe{sup 2+}) states for Fe ions and (Mn{sup 3+} and Mn{sup 2+}) Mn ions analyzed in three ways of Fe 2p and Mn 2p spectra from the XPS analysis. With respect to Mn dopant in Dy{sub 3}Fe{sub 5}O{sub 12}, the cationic distributions of elements were discussed from high resolution XPS spectra by peak position and shift, area, width. To find out the porous/void surface morphology of the sample, scanning electron microscopy was used. From XPS analysis, the presence of elements (Dy, Mn, Fe and O) and their composition in the

  14. Synthesis, structural characterization and in vitro testing of dysprosium containing silica particles as potential MRI contrast enhancing agents

    Energy Technology Data Exchange (ETDEWEB)

    Chiriac, L.B.; Trandafir, D.L. [Faculty of Physics & National Magnetic Resonance Center, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Interdisciplinary Research Institute on Bio-Nano-Sciences & Faculty of Physics, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Turcu, R.V.F. [Faculty of Physics & National Magnetic Resonance Center, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Todea, M. [Interdisciplinary Research Institute on Bio-Nano-Sciences & Faculty of Physics, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Simon, S., E-mail: simons@phys.ubbcluj.ro [Faculty of Physics & National Magnetic Resonance Center, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Interdisciplinary Research Institute on Bio-Nano-Sciences & Faculty of Physics, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania)

    2016-11-01

    Highlights: • Dysprosium containing silica microparticles obtained by freeze and spray drying. • Higher structural units interconnection achieved in freeze vs. spray dried samples. • Dy occurance on the outermost layer of the microparticles evidenced by XPS. • Enhanced MRI contrast observed for freeze dried samples with 5% mol Dy{sub 2}O{sub 3}. - Abstract: The work is focused on synthesis and structural characterization of novel dysprosium-doped silica particles which could be considered as MRI contrast agents. Sol-gel derived silica rich particles obtained via freeze-drying and spray-drying processing methods were structurally characterized by XRD, {sup 29}Si MAS-NMR and XPS methods. The occurrence of dysprosium on the outermost layer of dysprosium containing silica particles was investigated by XPS analysis. The MRI contrast agent characteristics have been tested using RARE-T{sub 1} and RARE-T{sub 2} protocols. The contrast of MRI images delivered by the investigated samples was correlated with their local structure. Dysprosium disposal on microparticles with surface structure characterised by decreased connectivity of the silicate network units favours dark T{sub 2}-weighted MRI contrast properties.

  15. Synthesis, structural characterization and in vitro testing of dysprosium containing silica particles as potential MRI contrast enhancing agents

    International Nuclear Information System (INIS)

    Chiriac, L.B.; Trandafir, D.L.; Turcu, R.V.F.; Todea, M.; Simon, S.

    2016-01-01

    Highlights: • Dysprosium containing silica microparticles obtained by freeze and spray drying. • Higher structural units interconnection achieved in freeze vs. spray dried samples. • Dy occurance on the outermost layer of the microparticles evidenced by XPS. • Enhanced MRI contrast observed for freeze dried samples with 5% mol Dy_2O_3. - Abstract: The work is focused on synthesis and structural characterization of novel dysprosium-doped silica particles which could be considered as MRI contrast agents. Sol-gel derived silica rich particles obtained via freeze-drying and spray-drying processing methods were structurally characterized by XRD, "2"9Si MAS-NMR and XPS methods. The occurrence of dysprosium on the outermost layer of dysprosium containing silica particles was investigated by XPS analysis. The MRI contrast agent characteristics have been tested using RARE-T_1 and RARE-T_2 protocols. The contrast of MRI images delivered by the investigated samples was correlated with their local structure. Dysprosium disposal on microparticles with surface structure characterised by decreased connectivity of the silicate network units favours dark T_2-weighted MRI contrast properties.

  16. Levels in 159Ho as populated from decay of 159Er

    International Nuclear Information System (INIS)

    Boutet, J.

    1977-06-01

    The level scheme of the odd proton nucleus 159 Ho has been investigated using Ge(Li) and Si(Li) detectors. Results of γ-ray singles, conversion electron spectra and coincidence experiments are reported. Assignments are made for several energy levels

  17. Synthesis, characterization and sup 23 Na NMR shift studies of a novel dysprosium(III) crown ether texaphyrin

    Energy Technology Data Exchange (ETDEWEB)

    Sessler, J.L.; Mody, T.D. (Texas Univ., Austin, TX (United States). Dept. of Chemistry); Ramasamy, R.; Sherry, A.D. (Texas Univ., Dallas, TX (United States))

    1992-05-01

    The synthesis and characterization of a novel dysprosium(III) crown-ether texaphyrin (Dy(BCTxp)){sup 2+} is reported. This complex was designed to serve as a ditopic chelate for both dysprosium(III) and sodium cations. {sup 23}Sodium NMR spectroscopic studies indicates that titration of Na{sup +} with increasing concentrations of (Dy(BCTxp)){sup 2+} results in a shift toward higher frequency and gives a net hyperfine shift of 0.86 ppm. Sodium complexation is taking place into the crown subunit in (Dy(BCTxp)){sup 2+} and the degree of complexation is not reduced substantially by the positive charge on the dysprosium(III) portion of this binucleating system.

  18. Enzymatic function of loop movement in enolase: preparation and some properties of H159N, H159A, H159F, and N207A enolases.

    Science.gov (United States)

    Brewer, John M; Glover, Claiborne V C; Holland, Michael J; Lebioda, Lukasz

    2003-05-01

    The hypothesis that His159 in yeast enolase moves on a polypeptide loop to protonate the phosphoryl of 2-phosphoglycerate to initiate its conversion to phosphoenolpyruvate was tested by preparing H159N, H159A, and H159F enolases. These have 0.07%-0.25% of the native activity under standard assay conditions and the pH dependence of maximum velocities of H159A and H159N mutants is markedly altered. Activation by Mg2+ is biphasic, with the smaller Mg2+ activation constant closer to that of the "catalytic" Mg2+ binding site of native enolase and the larger in the mM range in which native enolase is inhibited. A third Mg2+ may bind to the phosphoryl, functionally replacing proton donation by His159. N207A enolase lacks an intersubunit interaction that stabilizes the closed loop(s) conformation when 2-phosphoglycerate binds. It has 21% of the native activity, also exhibits biphasic Mg2+ activation, and its reaction with the aldehyde analogue of the substrate is more strongly inhibited than is its normal enzymatic reaction. Polypeptide loop(s) closure may keep a proton from His159 interacting with the substrate phosphoryl oxygen long enough to stabilize a carbanion intermediate.

  19. Dysprosium disilicide nanostructures on silicon(001) studied by scanning tunneling microscopy and transmission electron microscopy

    International Nuclear Information System (INIS)

    Ye Gangfeng; Nogami, Jun; Crimp, Martin A.

    2006-01-01

    The microstructure of self-assembled dysprosium silicide nanostructures on silicon(001) has been studied by scanning tunneling microscopy and transmission electron microscopy. The studies focused on nanostructures that involve multiple atomic layers of the silicide. Cross-sectional high resolution transmission electron microscopy images and fast Fourier transform analysis showed that both hexagonal and orthorhombic/tetragonal silicide phases were present. Both the magnitude and the anisotropy of lattice mismatch between the silicide and the substrate play roles in the morphology and epitaxial growth of the nanostructures formed

  20. Major conformations of the ligand skeleton of a tetranuclear dysprosium (3) tartrate complex

    International Nuclear Information System (INIS)

    Chevela, V.V.; Semenov, V.Eh.; Bezryadin, S.G.; Savitskaya, T.V.; Kolesar, I.R.; Matveev, S.N.; Shamov, G.A.

    1999-01-01

    By the molecular mechanics method (MIND program, stoichiometry was studied and basic conformations of ligand frame of dysprosium (3) tetranuclear complex bis-(d-tartrato) bis-(l-tartrato)tetradysprosiate (3) - anion Dy 4 (d-L) 2 (l-L) 2 4- (1) (d-H 4 L = d-tartaric acid, l-H 4 L = l - tartaric acid) were revealed. It is shown that theoretically calculated mP τ constants for so-called compact conformations of 1, where tartratoligands are in gosh conformation, agree with experimentally obtained constant of paramagnetic birefringence (mP e ) of complex 1 [ru

  1. Incinerator carryover tests with dysprosium as a stand-in for plutonium

    International Nuclear Information System (INIS)

    Hooker, R.L.

    1981-11-01

    A full-scale (5 kg/h) incinerator is being tested with nonradioactive feed materials which simulate SRP-generator combustible transuranic wastes. The incinerator is two-stage and is designed to provide relatively quiescent conditions in the primary chamber where the ash is formed. This feature should minimize entrainment of Pu-bearing particles into the off-gas system. A series of runs have been completed in which incinerator feed was spiked with dysprosium to simulate Pu. Carryover of Dy into the off-gas system was found to be low (about 1/4%). 4 figures, 3 tables

  2. Incorporation of dysprosium ions into PbTiO3 ferroelectric ceramic system

    Directory of Open Access Journals (Sweden)

    A. Peláiz-Barranco

    2015-03-01

    Full Text Available A structural analysis concerning the incorporation of dysprosium into A- and/or B-sites of the lead titanate is shown. The two "boundary" refinements are presented, i.e., Dy2+ substitutes for Pb2+ (Dy3+ substitutes for Ti4+ and Dy3+ substitutes for Pb2+ (Dy3+ substitutes for Ti4+. The results offer quantitative information about the incorporation into both crystallographic sites. The increase of Dy3+ fraction into B-site provides the increase of the Ti4+ atomic displacement along the [001] direction and the tetragonal distortion.

  3. Job burnout in 159 anesthesiology trainees

    Directory of Open Access Journals (Sweden)

    Yesim Cokay Abut

    2012-01-01

    Full Text Available Background: Anesthesiology may be stressful and most anesthesiologists develop mechanisms for coping. However, inexperienced trainee anesthesiologists seem to be vulnerable. We studied stress perception and job burnout in trainee anesthesiologists. Methods: Responses to perceived stress scale (PSS and Maslach Burnout Inventory (MBI were evaluated in 159 trainee anesthesiologists. Results: In our results, when perceived stress was increased, emotional exhaustion and depersonalization increased but personal accomplishment decreased, as expected. Perceived stress was very high in the early years of training. There was a negative correlation between age and emotional exhaustion and depersonalization, but positive correlation with personal accomplishment. Female anesthesiologists had higher personal accomplishment, but lower depersonalization points than male anesthesiologists in our study. There was no statistical association between marital status, PSS, and MBI; ≥2 children group had a significant high personal accomplishment but low depersonalization and emotional exhaustion scores. Line regression analysis showed a statistically significant relationship between PSS and emotional exhaustion and between age and depersonalization. Conclusions: Social factors such as gender and number of children affect the work life of our trainees.

  4. Dosimetric properties of dysprosium doped calcium magnesium borate glass subjected to Co-60 gamma ray

    Energy Technology Data Exchange (ETDEWEB)

    Omar, R. S., E-mail: ratnasuffhiyanni@gmail.com; Wagiran, H., E-mail: husin@utm.my; Saeed, M. A. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, 81310 Johor Bahru (Malaysia)

    2016-01-22

    Thermoluminescence (TL) dosimetric properties of dysprosium doped calcium magnesium borate (CMB:Dy) glass are presented. This study is deemed to understand the application of calcium as the modifier in magnesium borate glass with the presence of dysprosium as the activator to be performed as TL dosimeter (TLD). The study provides fundamental knowledge of a glass system that may lead to perform new TL glass dosimetry application in future research. Calcium magnesium borate glass systems of (70-y) B{sub 2}O{sub 3} − 20 CaO – 10 MgO-(y) Dy{sub 2}O{sub 3} with 0.05  mol % ≤ y ≤ 0.7  mol % of dyprosium were prepared by melt-quenching technique. The amorphous structure and TL properties of the prepared samples were determined using powder X-ray diffraction (XRD) and TL reader; model Harshaw 4500 respectively. The samples were irradiated to Co-60 gamma source at a dose of 50 Gy. Dosimetric properties such as annealing procedure, time temperature profile (TTP) setting, optimization of Dy{sub 2}O{sub 3} concentration of 0.5 mol % were determined for thermoluminescence dosimeter (TLD) reader used.

  5. Treatment of rheumatoid synovitis of the knee with intraarticular injection of dysprosium 165-ferric hydroxide macroaggregates

    International Nuclear Information System (INIS)

    Sledge, C.B.; Zuckerman, J.D.; Zalutsky, M.R.

    1986-01-01

    One hundred eight knees of 93 patients with seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with an intraarticular injection of 270 mCi of dysprosium 165 bound to ferric hydroxide macroaggregate. Leakage of radioactivity from the injected joint was minimal. Mean leakage to the venous blood 3 hours after injection was 0.11% of the injected dose; this corresponds to a mean whole body dose of 0.2 rads. Mean leakage to the liver 24 hours after injection was 0.64% of the injected dose; this corresponds to a mean liver dose of 3.2 rads. In 7 additional patients examined, there was negligible or near negligible activity found in the draining inguinal lymph nodes. One-year followup was possible for 74 knees (63 patients). Sixty-one percent of the knees had good results, 23% had fair results, and 16% had poor results. There was a direct correlation between the radiographic stage and response to treatment. In knees with stage I radiographic changes, 72% showed good results; 93% showed improvement. In knees with stage II changes, 59% showed good results; 81% showed improvement. These preliminary results indicate that dysprosium 165-ferric hydroxide macroaggregate is an effective agent for radiation synovectomy. The low leakage rates observed offer a definite advantage over agents previously used

  6. Dual responsive dysprosium-doped hydroxyapatite particles and toxicity reduction after functionalization with folic and glucuronic acids

    Energy Technology Data Exchange (ETDEWEB)

    Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P. [Departamento de Química, Universidad de Guadalajara, Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico); Gurinov, Andrey [Research Resources Center for Magnetic Resonance, Saint Petersburg State University, Universitetskij pr. 26, 198504 St. Petersburg (Russian Federation); Ortiz, Genaro Gabriel [Laboratorio Desarrollo-Envejecimiento, Enfermedades Neurodegenerativas, Centro de Investigación Biomédica de Occidente (CIBO), Instituto Mexicano de Seguro Social (IMSS), Guadalajara, Jalisco (Mexico); Carbajal Arízaga, Gregorio Guadalupe, E-mail: gregoriocarbajal@yahoo.com.mx [Departamento de Química, Universidad de Guadalajara, Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico)

    2015-03-01

    The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488 nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. - Highlights: • Hydroxyapatite functionalized with glucuronic acid reduced oxidative stress in rats. • Functionalization with folic acid reduced oxidative stress in rats. • Dysprosium doping does not affect the crystalline structure of hydroxyapatite. • Dysprosium doped particles are visible in fluorescent microscope. • Dysprosium doped particles act as MRI contrast agents.

  7. Kinetic stability of the dysprosium(3) complex with tetraazaporphine in acetic acid-water and acetic acid-methanol mixtures

    International Nuclear Information System (INIS)

    Khelevina, O.G.; Vojnov, A.A.

    1999-01-01

    Water-soluble dysprosium tetraazaporphine with acetylacetonate-ion as extraligand is synthesized for the first time. Its kinetic stability in acetic acid solutions is investigated. It is shown that the complex is dissociated with formation of free tetraazaporphine. Kinetic parameters of dissociation reaction are determined [ru

  8. Dual responsive dysprosium-doped hydroxyapatite particles and toxicity reduction after functionalization with folic and glucuronic acids

    International Nuclear Information System (INIS)

    Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P.; Gurinov, Andrey; Ortiz, Genaro Gabriel; Carbajal Arízaga, Gregorio Guadalupe

    2015-01-01

    The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488 nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. - Highlights: • Hydroxyapatite functionalized with glucuronic acid reduced oxidative stress in rats. • Functionalization with folic acid reduced oxidative stress in rats. • Dysprosium doping does not affect the crystalline structure of hydroxyapatite. • Dysprosium doped particles are visible in fluorescent microscope. • Dysprosium doped particles act as MRI contrast agents

  9. Study of the decay scheme of 159Tm

    International Nuclear Information System (INIS)

    Aguer, Pierre; Bastin, Genevieve; Chin Fan Liang; Libert, Jean; Paris, Pierre; Peghaire, Alain

    1975-01-01

    The energy levels of 159 Er have been investigated from the decay of 159 Tm (T(1/2)=9mn). Samples were obtained by (p,xn) reaction and on-line separation through Isocele facility. A level scheme is proposed with 24 levels between 0 and 1.3MeV [fr

  10. 42 CFR 423.159 - Electronic prescription drug program.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Electronic prescription drug program. 423.159 Section 423.159 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost Control and Quality...

  11. 40 CFR 159.188 - Failure of performance information.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Failure of performance information. 159.188 Section 159.188 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... submitted concerning substantiation of any incident of a pest having developed resistance to any pesticide...

  12. 40 CFR 159.195 - Reporting of other information.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Reporting of other information. 159.195 Section 159.195 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE... reported to the Agency. (4) Use of a pesticide promotes or creates secondary pest infestations. (5) Any...

  13. 33 CFR 159.317 - Sampling and reporting.

    Science.gov (United States)

    2010-07-01

    ... Section 159.317 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Operations § 159.317 Sampling and reporting. (a) The owner, operator, master or other person in charge of a... protocols, including chain of custody; (2) Laboratory analytical information including methods used...

  14. 12 CFR 410.152-410.159 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.152-410.159 Section 410.152-410.159 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  15. 29 CFR 1915.159 - Personal fall arrest systems (PFAS).

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Personal fall arrest systems (PFAS). 1915.159 Section 1915... Protective Equipment (PPE) § 1915.159 Personal fall arrest systems (PFAS). The criteria of this section apply to PFAS and their use. Effective January 1, 1998, body belts and non-locking snaphooks are not...

  16. 29 CFR 1910.159 - Automatic sprinkler systems.

    Science.gov (United States)

    2010-07-01

    ... supply is out of service, except for systems of 20 or fewer sprinklers. (5) Hose connections for fire fighting use. The employer may attach hose connections for fire fighting use to wet pipe sprinkler systems... 29 Labor 5 2010-07-01 2010-07-01 false Automatic sprinkler systems. 1910.159 Section 1910.159...

  17. 33 CFR 159.121 - Sewage processing test.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sewage processing test. 159.121...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.121 Sewage processing test. (a) The device must process human sewage in the manner for which it is designed when tested in accordance...

  18. 29 CFR 4.159 - General minimum wage.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true General minimum wage. 4.159 Section 4.159 Labor Office of... General minimum wage. The Act, in section 2(b)(1), provides generally that no contractor or subcontractor... a contract less than the minimum wage specified under section 6(a)(1) of the Fair Labor Standards...

  19. Watt-level dysprosium fiber laser at 315 μm with 73% slope efficiency

    Science.gov (United States)

    Woodward, R. I.; Majewski, M. R.; Bharathan, G.; Hudson, D. D.; Fuerbach, A.; Jackson, S. D.

    2018-04-01

    Rare-earth-doped fiber lasers are emerging as promising high-power mid-infrared sources for the 2.6-3.0 {\\mu}m and 3.3-3.8 {\\mu}m regions based on erbium and holmium ions. The intermediate wavelength range, however, remains vastly underserved, despite prospects for important manufacturing and defense applications. Here, we demonstrate the potential of dysprosium-doped fiber to solve this problem, with a simple in-band pumped grating-stabilized linear cavity generating up to 1.06 W at 3.15 {\\mu}m. A slope efficiency of 73% with respect to launched power (77% relative to absorbed power) is achieved: the highest value for any mid-infrared fiber laser to date, to the best of our knowledge. Opportunities for further power and efficiency scaling are also discussed.

  20. Proton NMR relaxivity of blood samples in the presence of some gadolinium and dysprosium compounds

    International Nuclear Information System (INIS)

    Coroiu, I.; Darabont, Al.; Bogdan, M.

    1999-01-01

    The use of some new compounds in MRI tissue and blood characterisation based on nuclear spin relaxation time measurements cannot be sustained until the molecular sources of these variations are understood. Tissues and blood are complex molecular systems with complex NMR properties. A better comprehension of the molecular basis of relaxation offers the possibility to predict the changes expected for a given pathology. The purpose of this contribution is to evidence the different relaxation characteristics of some gadolinium and dysprosium compounds in the presence and absence of the blood and to give a possible explanation about the molecular processes that cause occurrence of changes. Some gadolinium and dysprosium compounds such as: Gd-CIT (gadolinium citrate), Dy-DTPA (DTPA-diethylenetriamine pentaacetic acid), iron oxide - gadolinium oxide (or dysprosium oxide)- dextran complexes were prepared. The longitudinal T 1 -1 and transverse T 2 -1 'relaxation rates' measurements have been carried out as a function of molar concentrations. All measurements have been made at room temperature (about 25 deg.C) and the proton Larmor frequency ν o = 90 MHz. The pulsed NMR spectrometer utilised was a commercial Bruker SXP4/100 spectrometer. Transverse relaxation rate measurements have been made using the Carr-Purcell method, while longitudinal relaxation rate measurements using the inversion recovery pulse sequence, 180 angle-τ-90 angle. The accuracy was about 2-3% for the longitudinal relaxation rates and about 5-7% for the transverse relaxation rates. R 1 and R 2 relaxivities, in mM -1 s -1 were determined from the least square determination of the slopes of plots 1/T 1,2 versus compound molar concentration, using at least five independent measurements at several concentrations between 0 and 2 mM. Increased R 2 relaxivity observed for dysprosium compounds in the blood presence can be explained by PRE effect. The largest gain in R 2 relaxivity seems to imply a noncovalent

  1. Investigation on rare earth magnets recycling by organophosphoric extractant encapsulated polymeric beads for separation of dysprosium

    International Nuclear Information System (INIS)

    Yadav, Kartikey K.; Singh, D.K.; Kain, V.

    2017-01-01

    Rare earth elements (REEs) are a basic requirement of the electronics and new industries including green technology. In the present work an organophosphoric extractant encapsulating polyethersulfone (PES) beads has been developed and employed for dysprosium (Dy) separation from aqueous stream. Polyethersulfonic beads encapsulating PC88A were prepared by phase inversion method. During the synthesis of the beads, preparatory parameters were also optimized to obtain best suited beads which were subsequently characterized for their encapsulation capacity and micro structural investigation. The results obtained in the present investigation suggested that PES/PVAJPC88A composite beads could be used for separation of rare earths from aqueous medium obtained from the solubilisation of magnetic scrap materials

  2. Design and validation of a photon insensitive multidetector neutron spectrometer based on Dysprosium activation foils

    International Nuclear Information System (INIS)

    Gómez-Ros, J.M.; Bedogni, R.; Palermo, I.; Esposito, A.; Delgado, A.; Angelone, M.; Pillon, M.

    2011-01-01

    This communication describes a photon insensitive passive neutron spectrometer consisting of Dysprosium (Dy) activation foils located along three perpendicular axes within a single moderating polyethylene sphere. The Monte Carlo code MCNPX 2.6 was used to optimize the spatial arrangement of the detectors and to derive the spectrometer response matrix. Nearly isotropic response in terms of neutron fluence for energies up to 20 MeV was obtained by combining the readings of the detectors located at the same radius value. The spectrometer was calibrated using a previously characterized 14 MeV neutron beam produced in the ENEA Frascati Neutron Generator (FNG). The overall uncertainty of the spectrometer response matrix at 14 MeV, assessed on the basis of this experiment, was ±3%.

  3. Influence of modifiers on the separation of dysprosium from neodymium using organophosphorus acid derivates

    Energy Technology Data Exchange (ETDEWEB)

    Elwert, Tobias; Schwarz, Sabrina; Goldmann, Daniel [TU Clausthal, Clausthal-Zellerfeld (Germany). Lehrstuhl fuer Rohstoffaufbereitung und Recycling

    2016-01-15

    The aim of this study was to investigate the applicability of three organophosphorus acid derivates (D2EHPA, EHEHPA and Cyanex 572) for the separation of terbium and dysprosium from praseodymium and neodymium from NdFeB magnets in chloride solution. A special focus was put on the effect of phase modifiers. The investigations revealed that all extractants show in general a similar extraction behavior but the extraction is shifted to higher pH values in the order D2EHPA < EHEHPA < Cyanex 572. Therefore, and due to higher realizable loadings, EHEHPA and Cyanex 572 are more suitable for the investigated separation problem than D2EHPA. Whereas EHEHPA requires 1-decanol as phase modifier, Cyanex 572 can be employed without modifier addition.

  4. Automated spectrofluorimetric determinations of terbium and dysprosium in rare earth mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Lyle, S.J.; Za' tar, N. (Kent Univ., Canterbury (UK))

    1983-12-01

    Several methods involving the use of water-soluble binary and ternary complexes have been proposed for the spectrofluorimetric determination based on terbium(III) emission at 545 nm. These are terbium(III) with (A) ethylenediamine-N,N'-bis(o-hydroxyphenylacetic acid), (B) o-hydroxyphenyliminodiacetic acid, (C) EDTA + 5-sulphosalicylic acid, (D) EDTA + 1,2-dihydroxybenzene-3,5-disulphonic acid disodium salt (Tiron), and (E) iminodiacetic acid (IDA) + Tiron. Two of the reagent mixtures (D and E) can also be used for the fluorimetric determination of dysprosium(III) at 582 nm. A comparison has been made of these methods in order to select the most satisfactory procedure with respect to selectivity, sensitivity and suitability for adaption to automatic operation. Results are given and discussed.

  5. Spectrographic determination of dysprosium in doped crystals of calcium sulfate used for dosimetric material

    International Nuclear Information System (INIS)

    Grigoletto, T.; Lordello, A.R.

    1984-01-01

    A spectrographic method is described for the quantitative determination of dysprosium in doped crystals of calcium sulphate. The consequences of the changes in some parameters of the excitation conditions, such as arc current, electrode type and total or partial burning of sample, in the analytical results are discussed. Matrix effects are investigated. Variations in the intensity of the spectral lines are verified by recording the spectrum in distinct photographic plates. The role of internal standard in analytical reproducibility and in counterbalance of the variations in the arc current and in the weight of sample is studied. Accuracy is estimated by comparative analysis of two calcium sulphate samples by X-Ray Fluorescence, Neutron Activation and Inductive Coupled Plasma Emission Spectroscopy. (M.A.C.) [pt

  6. Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

    International Nuclear Information System (INIS)

    Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

    2008-01-01

    A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

  7. A model for additive transport in metal halide lamps containing mercury and dysprosium tri-iodide

    International Nuclear Information System (INIS)

    Beks, M L; Haverlag, M; Mullen, J J A M van der

    2008-01-01

    The distribution of additives in a metal halide lamp is examined through numerical modelling. A model for a lamp containing sodium iodide additives has been modified to study a discharge containing dysprosium tri-iodide salts. To study the complex chemistry the method of Gibbs minimization is used to decide which species have to be taken into account and to fill lookup tables with the chemical composition at different combinations of elemental abundance, lamp pressure and temperature. The results from the model with dysprosium additives were compared with earlier results from the lamp containing sodium additives and a simulation of a pure mercury lamp. It was found that radial segregation creates the conditions required for axial segregation. Radial segregation occurs due to the unequal diffusion of atoms and molecules. Under the right conditions convection currents in the lamp can cause axial demixing. These conditions depend on the ratio of axial convection and radial diffusion as expressed by the Peclet number. At a Peclet number of unity axial segregation is most pronounced. At low Peclet numbers radial segregation is at its worst, while axial segregation is not present. At large Peclet numbers the discharge becomes homogeneously mixed. The degree of axial segregation at a Peclet number of unity depends on the temperature at which the additive under consideration fully dissociates. If the molecules dissociate very close to the walls no molecules are transported by the convective currents in the lamp, and hence axial segregation is limited. If they dissociate further away from the walls in the area where the downward convective currents are strongest, more axial segregation is observed

  8. Electrochemical behaviour of dysprosium in the eutectic LiCl-KCl at W and Al electrodes

    International Nuclear Information System (INIS)

    Castrillejo, Y.; Bermejo, M.R.; Barrado, A.I.; Pardo, R.; Barrado, E.; Martinez, A.M.

    2005-01-01

    The electrochemical behaviour of DyCl 3 was studied in the eutectic LiCl-KCl at different temperatures. The cathodic reaction can be written:Dy(III)+3e-bar Dy(0)which can be divided in two very close cathodic steps:Dy(III)+1e-bar Dy(II)andDy(II)+2e-bar Dy(0)Transient electrochemical techniques, such as cyclic voltammetry, chronopotentiometry, and chronoamperometry were used in order to study the reaction mechanism and the transport parameters of electroactive species at a tungsten electrode. The results showed that in the eutectic LiCl-KCl, electrocrystallization of dysprosium seems to be the controlling electrochemical step. Chronoamperometric studies indicated instantaneous nucleation of dysprosium with three dimensional growth of the nuclei whatever the applied overpotential.Mass transport towards the electrode is a simple diffusion process, and the diffusion coefficient of the electroactive species, i.e. Dy(III), has been calculated. The validity of the Arrhenius law was also verified by plotting the variation of the logarithm of the diffusion coefficient versus 1/T.In addition, the electrode reactions of the LiCl-KCl-DyCl 3 solutions at an Al wire were also investigated by cyclic voltammetry and open circuit chronopotentiometry. The redox potential of the Dy(III)/Dy couple at the Al electrode was observed at more positive potentials values than those at the inert electrode. This potential shift was thermodynamically analyzed by a lowering of activity of Dy in the metal phase due to the formation of intermetallic compounds

  9. Dysprosium lithium borate glass mircrospheres for radiation synovectomy: The in vitro and in vivo performance evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Zhao Di; Yu Jing [Institute of Bioengineering and Information Technology Materials, Center for Advanced Materials and Nano-Biomedicine, Tongji University, Shanghai, 200092 (China); Huang Wenhai, E-mail: whhuang@tongji.edu.cn [Institute of Bioengineering and Information Technology Materials, Center for Advanced Materials and Nano-Biomedicine, Tongji University, Shanghai, 200092 (China); Zhou Nai; Wang Deping [Institute of Bioengineering and Information Technology Materials, Center for Advanced Materials and Nano-Biomedicine, Tongji University, Shanghai, 200092 (China); Yin Wei [Institute of Isotope Research, Sinitic Academy of Atomic Energy, Beijing 102413 (China); Chen Yaqing [The Sixth People' s Hospital, Shanghai 200233 (China)

    2010-08-30

    The radioactive dysprosium lithium borate glass (DyLB) microspheres with different glass compositions were prepared for radiation synovectomy. The biodegradability and biocompatibility of these DyLB microspheres were evaluated in vitro and in vivo. The DyLB microspheres studied in this work were partially biodegradable in a simulated body fluid (SBF), with the final weight loss of the microspheres in the range of 24.6% and 55.0% (wt.%) after 8 days of immersion. The ICP results revealed that the dissolution of lithium significantly decreased from 100% to 53.7% with increasing content of Dy{sub 2}O{sub 3} in the microspheres from 18% to 22% (wt.%, from S-1 to S-3). However, for all of the three samples, nearly all of the dysprosium (> 99.997%, wt.%) remained in the microspheres, in the form of insoluble phosphates and carbonates, which was proved by the SEM and EDX analyses. The degradation of DyLB microspheres in SBF gradually decreased with immersion time and eventually reached equilibrium after 7 days of immersion. Compared to the other two samples, the S-3 sample with the lowest Dy{sup 3+} dissolution (about 0.002%) was considered more secure for clinical application. Furthermore, the S-3 DyLB microspheres exhibited good biocompatibility, since neither tissue damage nor inflammation was observed, after they were implanted in the liver of rat for two weeks. After neutron activation, the radionuclide purity of radioactive S-3 DyLB microspheres was 99.999%, which were suitable for radiation synovectomy.

  10. Photoluminescence study on amino functionalized dysprosium oxide-zinc oxide composite bifunctional nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Joseph, Aswathy; Praveen, G.L; Abha, K.; Lekha, G.M [Department of Chemistry, University of Kerala, Kariavattom, Kerala 695581 (India); George, Sony, E-mail: emailtosony@gmail.com [Department of Chemistry, University of Kerala, Kariavattom, Kerala 695581 (India)

    2012-08-15

    An organic dispersion of 9-15 nm size stable dysprosium oxide incorporated zinc oxide nanocomposites exhibiting luminescence in the visible region has been synthesised by a wet chemical precipitation technique at room temperature. Tetraethoxysilane TEOS [(C{sub 2}H{sub 5}O){sub 4}Si], (3-aminopropyl) trimethoxysilane (APTS) and a 1:1 mixture of TEOS-APTS have been used as capping agents to control the particle size as well as to achieve uniform dispersion of composite nanoparticles in methanol medium. X-ray diffractometer (XRD) analysis reveals the formation phase of amino-functionalised colloidal dysprosium oxide incorporated ZnO composite nanoparticles to be of zincite structure. The Transmission Electron Microscopy (TEM) images show that the particles are spheroids in shape, having average crystalline sizes ranging from 9 to 15 nm. The photoluminescence (PL) observed in these composites has been attributed to the presence of near band edge excitonic emission and existence of defect centres. The time correlated single photon counting studies of the composite nanoparticles exhibited three decay pathways. The enhanced PL emission intensity of solid state fluorescence spectra of samples is attributed to the absence of vibrational relaxation process. - Highlights: Black-Right-Pointing-Pointer Nano-composites are synthesised using a one step wet chemical precipitation method. Black-Right-Pointing-Pointer A significant fluorescence life time of 8.25 ns is obtained for the nano-composite. Black-Right-Pointing-Pointer Nano-composite particles exhibited pale yellow fluorescence rather than blue. Black-Right-Pointing-Pointer Vibrational cascade free enhanced fluorescence is obtained for the dry sample.

  11. 33 CFR 159.131 - Safety: Incinerating device.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.131 Safety.... Unitized incineration devices must completely burn to a dry, inert ash, a simultaneous defecation and...

  12. 40 CFR 159.156 - How information must be submitted.

    Science.gov (United States)

    2010-07-01

    ... to the Office of Pesticide Programs' Document Processing Desk at the appropriate address as set forth... registration number, date of transmittal to EPA, the type of study or incident being reported under §§ 159.165...

  13. Simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides by second order derivative spectrophotometry

    International Nuclear Information System (INIS)

    Anbu, M.; Prasada Rao, T.; Iyer, C. S. P.; Damodaran, A. D.

    1996-01-01

    High purity individual rare earth oxides are increasingly used as major components in lasers (Y 2 O 3 ), phosphors (YVO 3 , Eu 2 O 3 ), magnetic bubble memory films (Gd 2 O 3 ) and refractive-index lenses and fibre optics (La 2 O 3 ). The determination of individual lanthanides in high purity rare earth oxides is a more important and difficult task. This paper reports the utilization of higher order derivative spectrophotometry for the simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides. The developed procedure is simple, reliable and allows the determination of 0.001 to 0.2% of dysprosium, holmium and erbium in several rare earth. (author). 9 refs, 2 figs, 2 tabs

  14. Mixed (phthalocyaninato)(Schiff-base) di-dysprosium sandwich complexes. Effect of magnetic coupling on the SMM behavior.

    Science.gov (United States)

    Wang, Hailong; Liu, Chenxi; Liu, Tao; Zeng, Suyuan; Cao, Wei; Ma, Qi; Duan, Chunying; Dou, Jianmin; Jiang, Jianzhuang

    2013-11-21

    Reaction between Schiff-base ligand and half-sandwich complex M(Pc)(acac) led to the isolation of new sandwich-type mixed (phthalocyaninato)(Schiff-base) di-lanthanide compounds M2(Pc)2(L)H2O (M = Dy, Gd) (1, 2) [H2Pc = metal free phthalocyanine, Hacac = acetylacetone, H2L = N,N'-bis(3-methyloxysalicylidene)benzene-1,2-diamine] with the triple-decker molecular structure clearly revealed by single crystal X-ray diffraction analysis. For the comparative studies, sandwich triple-decker analogues with pure Schiff-base ligand M2(L)3H2O (M = Dy, Gd) (3, 4) were also prepared. Dynamic magnetic measurement result reveals the single-molecule magnet (SMM) nature of the di-dysprosium derivative 1, while the static magnetic investigation over both pure and the diamagnetic diluted samples of this compound discloses the interionic ferromagnetic coupling between the two dysprosium ions, which in turn effectively suppresses the QTM and enhances the energy barrier of this SMM. Nevertheless, comparative studies over the static magnetic properties of the di-dysprosium triple-decker complexes 1 and 3 indicate the stronger magnetic coupling between the two lanthanide ions in mixed (phthalocyaninato)(Schiff-base) species than in the pure Schiff-base triple-decker analogue, suggesting the special coordination sphere around the dysprosium ions in the former compound over the latter one on the more intense inter-ionic ferromagnetic coupling. As a very small step towards understanding the structure-property relationship, the present result will be surely helpful for the design and synthesis of the multinuclear lanthanide-based SMMs with good properties.

  15. Evaluating United States and world consumption of neodymium, dysprosium, terbium, and praseodymium in final products

    Science.gov (United States)

    Hart, Matthew

    This paper develops scenarios of future rare-earth-magnet metal (neodymium, dysprosium, terbium, and praseodymium) consumption in the permanent magnets used in wind turbines and hybrid electric vehicles. The scenarios start with naive base-case scenarios for growth in wind-turbine and hybrid-electric-vehicle sales over the period 2011 to 2020, using historical data for each good. These naive scenarios assume that future growth follows time trends in historical data and does not depend on any exogenous variable. Specifically, growth of each technological market follows historical time trends, and the amount of rare earths used per unit of technology remains fixed. The chosen reference year is 2010. Implied consumptions of the rare earth magnet metals are calculated from these scenarios. Assumptions are made for the material composition of permanent magnets, the market share of permanent-magnet wind turbines and vehicles, and magnet weight per unit of technology. Different scenarios estimate how changes in factors like the material composition of magnets, growth of the economy, and the price of a substitute could affect future consumption. Each scenario presents a different method for reducing rare earth consumption and could be interpreted as potential policy choices. In 2010, the consumption (metric tons, rare-earth-oxide equivalent) of each rare-earth-magnet metal was as follows. Total neodymium consumption in the world for both technologies was 995 tons; dysprosium consumption was 133 tons; terbium consumption was 50 tons; praseodymium consumption was zero tons. The base scenario for wind turbines shows there could be strong, exponential growth in the global wind turbine market. New U.S. sales of hybrid vehicles would decline (in line with the current economic recession) while non-U.S. sales increase through 2020. There would be an overall increase in the total amount of magnetic rare earths consumed in the world. Total consumption of each rare earth in the short

  16. Fusion cross sections measurement for 6Li + 159Tb

    International Nuclear Information System (INIS)

    Pradhan, M.K.; Mukherjee, A.; Kshetri, R.; Roy, Subinit; Basu, P.; Goswami, A.; Saha Sarkar, M.; Ray, M.; Parkar, V.; Santra, S.; Kailas, S.; Palit, R.

    2009-01-01

    In order to investigate the effect of projectile breakup threshold energy on fusion in mass region around A∼170, we have carried out a systematic investigation of the fusion (both CF and ICF) cross sections for the systems 11 B, 10 B + 159 Tb and 7 Li + 159 Tb at energies near and close to the barrier where 11 B was considered to be a strongly bound nucleus. The nucleus 10 B has a α-separation energy of 4.5 MeV. The measurements show that the extent of suppression of CF cross sections is correlated with the α-separation energies of the projectiles. As a further continuation of this work, we have recently carried out fusion excitation function measurement for the system 6 Li + 159 Tb (Coulomb barrier 27 MeV) at energies near and close to the barrier

  17. Spectrographic determination of dysprosium dopant in calcium sulphate used as dosimetric material

    International Nuclear Information System (INIS)

    Grigoletto, T.

    1982-01-01

    A spectrographic method is described for the quantitative determination of dysprosium in doped crystals of calcium sulphate. The consequences of the changes in some parameters of the excitation conditions, such as arc current, electrode type and total or partial burning of sample, in the analytical results are discussed. Matrix effects are investigated by comparison among analytical curves obtained from three different methods of standard preparations. Variations in the intensity of the spectral lines are verificated by recording the spectrum in distinct photographic plates (SA-1). The role of internal standard in analytical reproducibility and in counterbalance of the variations in the arc current and in the weight of sample are studied. The great similarity in excitation behavior of many of the rare earths is used to provide a high degree of internal standardization. Precision studies show a standard deviation of about + - 2,4 percent by use of lanthanum as an internal standard. Accuracy is estimate by comparative analysis of two calcium sulphate samples by X-Rays Fluorescence, Neutron Activation and Inductive Coupled Plasma (ICP) Emission Spectroscopy. (Author) [pt

  18. Combustion of gadolinium and dysprosium chelates as a cellular integrity marker in MR imaging

    International Nuclear Information System (INIS)

    Ericsson, A.; Bach-Gansmo, T.; Niklasson, F.; Hemmingsson, A.

    1995-01-01

    A combination of gadolinium (Gd) and dysprosium (Dy) chelates was investigated as a potential marker of cell-membrane integrity by means of a double-contrast effect in MR imaging. Blood samples with varying hematocrit (Hct) levels containing intact or lysed cells were used as model systems. With intact cells, the agents were assumed to be distributed solely extracellularly and the highest Hct studied (69%) was assumed to mimic the ratio of extracellular to intracellular water in tissue. The combined effect on image intensity of Gd (in a concentration corresponding to 0.2 mmol/kg b.w. in humans) and Dy (0.6 mmol/kg b.w.) applied simultaneously was a marked difference in signal intensity between samples with intact and lysed cells in both the T1- and T2-weighted spin-echo images with a corresponding increase in the contrast-to-noise ratio. This was the result of a T1 reduction caused by Gd with a negligible Dy susceptibility effect in areas with lysed cells. On the other hand, the Dy susceptibility effect (i.e. reduced apparent T2) dominated in areas with intact cells. Thus, the combination of Gd and Dy may serve as a marker of cell-membrane integrity in MR examinations. (orig.)

  19. Isolation of {sup 163}Ho from dysprosium target material by HPLC for neutrino mass measurements

    Energy Technology Data Exchange (ETDEWEB)

    Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.; Engle, Jonathan W.; Pollington, Anthony D.; Kunde, Gerd J.; Rabin, Michael W.; Birnbaum, Eva R. [Los Alamos National Laboratory, Los Alamos, NM (United States). Chemistry Div.; Barnhart, Todd E.; Nickles, Robert J. [Univ. Wisconsinn, Madison, WI (United States). Dept. of Medical Physics

    2015-07-01

    The rare earth isotope {sup 163}Ho is of interest for neutrino mass measurements. This report describes the isolation of {sup 163}Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, {sup 163}Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm{sup -3} α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized by MC-ICP-MS to determine the {sup 163}Ho/{sup 165}Ho ratio, {sup 163}Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4 x 10{sup 5} for Dy. The isolated Ho fraction contained 24.8 ± 1.3 ng of {sup 163}Ho corresponding to holmium recovery of 72 ± 3%.

  20. Nuclear statistics of dysprosium resonance parameters in the energy range 10 - 1000 eV

    International Nuclear Information System (INIS)

    Shin, S. G.; Kye, Y. U.; Cho, M. H.; Kim, G. N.; Namkung, W.; Lee, M. W.; Kang, Y. R.; Roe, T. I.

    2016-01-01

    A resonance parameter analysis is often performed in the Resolved Resonance Region (RRR) in order to estimate the average level spacing, distribution of the reduced widths and so on. Neutron Capture experiments on dysprosium isotopes were performed at the electron linear accelerator (LINAC) facility of the Rensselear Polytechnic Institute (RPI) in the neutron energy region from 10 eV to 1 keV. The following nuclear statistics of the resonance parameters will be discussed in this paper. The D 0 for 161 Dy and 163 Dy were judged to be constant up to 120.6 and 163.9 eV, respectively. It was assumed that the D 0 of 162 Dy and 164 Dy is constant up to 1000 eV because they have few resonances. The results were compared with the values from Reference 11 as shown in Figure 1. Statistical distributions of reduced neutron were investigated for the three isotopes in the region from 0 to 1000 eV; 161 Dy, 162 Dy, and 163 Dy, but not for 164 Dy because of a few number of resonances. The reduced neutron widths Γ n 0 were divided by the unweighted average reduced neutron width < Γ n 0 > for each isotope. A cumulative distribution of these unitless ratios is compared with the integral of the Porter-Thomas distribution (χ 2 distribution with one degree of freedom). The results agree reasonably with the Porter Thomas distributions.

  1. Self-organized dysprosium-directed alginate hydrogels and its chemical features

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Qianmin [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Gao, Jinwei [Institute for Advanced Materials, Academy of Advanced Optoelectronics, South China Normal University, Guangzhou 510006 (China); Peng, Huojun [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangzhou Key Laboratory of Materials for Energy Conversion and Storage, Guangzhou 510006 (China)

    2016-09-15

    Rational use of self-organized materials may contribute in developing new structures and devices in practical technology. Synthetic metallo-supramolecular gels are generally designed with transitional metal-directed process. However, the assembly of both lanthanide and sodium alginate in macromolecular systems would find a new way of utilizing its physical properties. The stimuli-responsive molecule (alginate) could firmly form stable hydrogels upon the encapsulation of dysprosium ions. In addition, the immobilization of YVO{sub 4}: Eu{sup 3+} nanoparticle in the soft matrix has been achieved and it has never been explored in the fabrication of phosphor-incorporated luminescent alginate gels. The key feature of the present soft matter is that its red emission could be switched off in the presence of sodium ascorbate and the results may have a tremendous impact on the extension of photophysical application based on soft nanoscale devices. - Highlights: • Dy{sup 3+} can be used for the gelation of the dissolved alginate. • Lanthanide hydrogels could exhibit red emissions under excitations. • Luminescence could be switched “off” in the presence of sodium ascorbate.

  2. Optical properties of zinc borotellurite glass doped with trivalent dysprosium ion

    Science.gov (United States)

    Ami Hazlin, M. N.; Halimah, M. K.; Muhammad, F. D.; Faznny, M. F.

    2017-04-01

    The zinc borotellurite doped with dysprosium oxide glass samples with chemical formula {[(TeO2) 0 . 7(B2O3) 0 . 3 ] 0 . 7(ZnO) 0 . 3 } 1 - x(Dy2O3)x (where x=0.01, 0.02, 0.03, 0.04 and 0.05 M fraction) were prepared by using conventional melt quenching technique. The structural and optical properties of the proposed glass systems were characterized by using X-ray diffraction (XRD) spectroscopy, Fourier Transform Infrared (FTIR) spectroscopy, and UV-VIS spectroscopy. The amorphous nature of the glass systems is confirmed by using XRD technique. The infrared spectra of the glass systems indicate three obvious absorption bands which are assigned to BO3 and TeO4 vibrational groups. Based on the absorption spectra obtained, the direct and indirect optical band gaps, as well as the Urbach energy were calculated. It is observed that both the direct and indirect optical band gaps increase with the concentration of Dy3+ ions. On the other hand, the Urbach energy is observed to decrease as the concentration of Dy3+ ions increases.

  3. The liquid membrane for extraction of Yttrium and Dysprosium from Acid Nitric

    International Nuclear Information System (INIS)

    Johny, W.S.; Raldi-Artono-Koestoer; Kris-Tri-Basuki; Sudibyo

    1996-01-01

    The determination of surfactant in liquid membrane has been done. The surfactant is span-80 (sorbitol-monooleate), the liquid membrane phase was the organic phase (O), the internal liquid phase (W) with ratio O/W = 1, and surfactant. The organic phase using D 2 EHPA in the kerosene and the internal liquid phase using aqua des or acid nitric. The determination of surfactant with variation of span-80 (0,25 - 2%) in the liquid membrane volume. The speed of stirrer was 3500 rpm in 20 minute. The ratio of liquid membrane phase form and external phase (aqua des or acid nitric) was 1, the speed of stirrer was 350 rpm in 10 minute (permeation process). The liquid phase and the liquid membrane phase was separated and then determinated the volume of liquid membrane, the result of percentage of span-80 was 0,25 % volume. The extraction of yttrium and dysprosium in 2 M HNO 3 was Kd y = 2.945 and Kd D y = 0.019

  4. 19 CFR 159.36 - Multiple certified rates.

    Science.gov (United States)

    2010-04-01

    ... multiple rates have been certified for a foreign currency, the rate to be used for Customs purposes shall... TREASURY (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.36 Multiple certified rates... rates of exchange (e.g., official and free) for a foreign currency: (a) Rates to be published. When the...

  5. 19 CFR 159.35 - Certified daily rate.

    Science.gov (United States)

    2010-04-01

    ... TREASURY (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.35 Certified daily rate. The daily buying rate of foreign currency which is determined by the Federal Reserve Bank of New York and certified to the Secretary of the Treasury in accordance with 31 U.S.C. 5151(e) shall be used for...

  6. 27 CFR 24.159 - Release of collateral security.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Release of collateral... § 24.159 Release of collateral security. Collateral security pledged and deposited will be released only in accordance with the provisions of 31 CFR part 225. The collateral security will not be released...

  7. 40 CFR 159.179 - Metabolites, degradates, contaminants, and impurities.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Metabolites, degradates, contaminants.../Benefit Information § 159.179 Metabolites, degradates, contaminants, and impurities. (a) Metabolites and... degradation of less than 10 percent in a 30-day period. (b) Contaminants and impurities. The presence in any...

  8. checkCIF/PLATON report Datablock: zufz159

    Indian Academy of Sciences (India)

    THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW PROCEDURE. FOR PUBLICATION, IT SHOULD NOT REPLACE THE EXPERTISE OF AN EXPERIENCED. CRYSTALLOGRAPHIC REFEREE. No syntax errors found. CIF dictionary Interpreting this report. Datablock: zufz159. Bond precision:.

  9. 14 CFR 61.159 - Aeronautical experience: Airplane category rating.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aeronautical experience: Airplane category... Transport Pilots § 61.159 Aeronautical experience: Airplane category rating. (a) Except as provided in... certificate with an airplane category and class rating must have at least 1,500 hours of total time as a pilot...

  10. Custom Coordination Environments for Lanthanoids: Tripodal Ligands Achieve Near-Perfect Octahedral Coordination for Two Dysprosium-Based Molecular Nanomagnets.

    Science.gov (United States)

    Lim, Kwang Soo; Baldoví, José J; Jiang, ShangDa; Koo, Bong Ho; Kang, Dong Won; Lee, Woo Ram; Koh, Eui Kwan; Gaita-Ariño, Alejandro; Coronado, Eugenio; Slota, Michael; Bogani, Lapo; Hong, Chang Seop

    2017-05-01

    Controlling the coordination sphere of lanthanoid complexes is a challenging critical step toward controlling their relaxation properties. Here we present the synthesis of hexacoordinated dysprosium single-molecule magnets, where tripodal ligands achieve a near-perfect octahedral coordination. We perform a complete experimental and theoretical investigation of their magnetic properties, including a full single-crystal magnetic anisotropy analysis. The combination of electrostatic and crystal-field computational tools (SIMPRE and CONDON codes) allows us to explain the static behavior of these systems in detail.

  11. Experimental and theoretical approach on the optical properties of zinc borotellurite glass doped with dysprosium oxide

    Science.gov (United States)

    Halimah, M. K.; Ami Hazlin, M. N.; Muhammad, F. D.

    2018-04-01

    A series of glass samples with chemical formula {[(TeO2)0.7(B2O3)0.3]0.7(ZnO)0.3}1 - x(Dy2O3)x where x = 0.01, 0.02, 0.03, 0.04 and 0.05 M fraction were synthesized through conventional melt-quenching method. The most common way to fabricate a glass material is by fusion of two or more component oxides followed by their quenching. This technique is known as melt-quenching technique. Kaur et al. (2016) [1] highlighted that the melt-quenching method able to enhance the mechanical properties like hardness and flexural strength of the material. The nature of the glass systems is proven to be amorphous based on the XRD pattern. The FTIR spectra of the glass systems confirm the existence of five bands which are assigned for the BO4, BO3, TeO4 and TeO3 vibrational groups. The density of the glass systems is increased with the addition of Dy2O3 while the molar volume is found to be inversely proportional to the density of the proposed glass. The optical properties of the glasses are determined through the absorption spectra obtained from the UV-VIS spectrophotometer. From the absorption spectra, the indirect and direct optical band gaps and the Urbach energy are found to be inversely proportional to each other. As the molar fraction of the Dy2O3 increased, the optical band gaps are observed to increase as opposed to the Urbach energy. For this glass system, the values of refractive index, electronic polarizability, oxide ion polarizability and the optical basicity are found to decrease as the addition of the dysprosium oxide is increased. From the emission spectra, two intense blue and yellow emission bands are observed, which correspond to the 4F9/2 → 6H15/2 and 4F9/2 → 6H13/2 transitions of Dy3 + ions respectively. The CIE chromaticity coordinates of the zinc borotellurite glass systems are found to be located in the white light region. Generation of white light The generation of the white light can be achieved by using two emission bands which comprise of the yellow

  12. Textured dysprosium and gadolinium poles for high-field, short-period hybrid undulators

    International Nuclear Information System (INIS)

    Murokh, Alex; Solovyov, Vyacheslav; Agustsson, Ron; O'Shea, Finn H.; Chubar, Oleg; Chen, Yung; Grandsaert, Thomas

    2014-01-01

    We discuss the feasibility of enhancement of the gap field in a short-period hybrid undulator by using pole inserts with the saturation inductance B s , over that of iron, 2 T. Dysprosium metal, with the saturation inductance of 3.4 T below 90 K, and Gadolinium with B s =2.7 T, appear as good candidates as the optimized pole material. However, due to the high magnetic anisotropy of Dy, such a high level of magnetization can only be realized when the external field lies in the basal plane. This implies that the pole has to be single-crystalline or highly textured. Considering that growing large, >10mm, Dy single crystals is difficult, we propose secondary recrystallization as a method to induce the required texture in thin Dy and Gd foils. The textured foils can be stacked to produce pole inserts of the desired geometry and orientation. Results of small-scale processing and magnetic measurements of thin (20–60 μ) foils provide evidence that the required texture quality can be achieved by a relatively simple sequence of heat-treatments and cold rolling. The advantage of textured Dy and Gd poles is demonstrated in a several period test undulator. -- Highlights: • Textured rare-earth materials for use as undulator pole materials. • We measure the development of texture in Dy and Gd. • We compare the rare-earth materials with high saturation steel in undulators. • Thin sheets of Dy and Gd materials perform similar to single crystals

  13. Clinical analysis on 159 cases of mechanical ocular trauma

    OpenAIRE

    Zi-Yao Liu; Ya-Zhi Fan; Yu-Ping Zheng; Jian-Ming Wang

    2013-01-01

    AIM: To provide the basis of security guidance and decreasing the incidence through a general investigation of the mechanical ocular trauma among all the common causes, occasions where getting hurt as well as the characteristics of the high-risk group, and by further analysis and monitoring of the clinical cases and follow-up visit, study the related key factors of influencing the prognosis statistically. METHODS: The data of the 159 cases with mechanical ocular trauma were recorded.RESULTS: ...

  14. Electrocatalytic approach for the efficiency increase of electrolytic hydrogen production: Proof-of-concept using platinum-dysprosium alloys

    International Nuclear Information System (INIS)

    Santos, D.M.F.; Šljukić, B.; Sequeira, C.A.C.; Macciò, D.; Saccone, A.; Figueiredo, J.L.

    2013-01-01

    Development of electrocatalytic materials for the hydrogen evolution reaction (HER) is attempted with the aim of reducing the water electrolysis overpotential and increasing its efficiency. Using linear scan voltammetry measurements of the hydrogen discharge enables evaluation of the electrocatalytic activity for the HER of platinum–dysprosium (Pt–Dy) intermetallic alloy electrodes of different compositions. Understanding of materials electrocatalytic performance is based on determination of several crucial kinetic parameters, including the Tafel coefficients, b, charge transfer coefficients, α, exchange current densities, j 0 , and activation energies, E a . Influence of temperature on HER is investigated by performing studies at temperatures ranging from 25 °C to 85 °C. The effect of the Dy amount in the efficiency of the HER on the Pt–Dy alloys is analysed. Results demonstrate that Dy can substantially increase the electrocatalytic activity of the Pt alloys, in comparison to the single Pt electrode. Efforts are made to correlate the microstructure of the alloys with their performance towards the HER. - Highlights: ► Development of electrocatalysts to increase efficiency of electrolytic hydrogen production. ► Synthesis and evaluation of composition and morphology of platinum–dysprosium (Pt–Dy) alloys. ► Hydrogen evolution reaction on Pt–Dy alloys electrodes studied using linear scan voltammetry in alkaline medium. ► Pt–Dy alloy with equiatomic composition enhances kinetics of hydrogen discharge compared to single Pt

  15. The application of x-ray spectrometry to isotopic-source activation analysis of dysprosium and holmium

    International Nuclear Information System (INIS)

    Pillay, A.E.; Mboweni, R.C.M.

    1990-01-01

    A novel aspect of activation analysis is described for the determination of dysprosium and holmium at low concentrations. The method involves the measurement of K x-rays from radionuclides produced by thermal neutron activation using a 1 mg 252 Cf source. The basis for elemental selection depends largely on the demand for analysis and on the existence of favourable nuclear properties for the production of a practicable x-ray yield. A full appraisal of the analytical potential of the method is presented with particular emphasis on its application to geological matrices. The sensitivity was optimised by employing a detector that was particularly effective at photon energies below 150 keV. Analytical conditions are demonstrated for the elements of interest over a wide range of concentrations in small powdered samples. The investigation formed the basis of a feasibility study to establish if the application could be developed for the routine off-line determination of dysprosium and holmium using an isotopic-neutron source. (author)

  16. Reduction of titanocene dichloride with dysprosium: access to a stable titanocene(ii) equivalent for phosphite-free Takeda carbonyl olefination.

    Science.gov (United States)

    Bousrez, G; Déchamps, I; Vasse, J-L; Jaroschik, F

    2015-05-28

    The reduction of titanocene dichloride with dysprosium yields a new titanocene(ii) equivalent without the need for further stabilising ligands. This reagent can be employed in combination with dithioacetals for the olefination of different carbonyl groups and allows for a simplified all-in-one procedure.

  17. Acute dysprosium toxicity to Daphnia pulex and Hyalella azteca and development of the biotic ligand approach

    Energy Technology Data Exchange (ETDEWEB)

    Vukov, Oliver, E-mail: vuko3930@mylaurier.ca [Biology Department, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); Smith, D. Scott [Chemistry Department, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); McGeer, James C. [Biology Department, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada)

    2016-01-15

    The toxicological understanding of rare earth elements (REEs) in the aquatic environment is very limited but of increasing concern. The objective of this research is to compare the toxicological effect of the REE dysprosium to the freshwater invertebrates Daphnia pulex and Hyalella azteca and in the more sensitive organism, understand the toxicity modifying influence of Ca, Na, Mg, pH and dissolved organic matter (DOM). Standard methods (Environment Canada) were followed for testing and culture in media of intermediate hardness (60 mg CaCO{sub 3} mg/L) at pH 7.8 with Ca at 0.5, Na 0.5, Mg 0.125 (mM) and 23 °C. Acute toxicity tests were done with <24 h old neonates for 48 h in the case of D. pulex and with 2–9 days old offspring for 96 h tests with Hyalella. The potential protective effect of cationic competition was tested with Ca (0.5–2.0 mM), Na (0.5–2.0 mM) and Mg (0.125–0.5 mM). The effect of pH (6.5–8.0) and Suwannee River DOM complexation (at dissolved organic carbon (DOC) concentrations of 9 and 13 mg C/L) were evaluated. Dissolved Dy concentrations were lower than total (unfiltered) indicating precipitation, particularly at higher concentrations. Acute toxicity of Dy to H. azteca and D. pulex revealed Hyalella to be 1.4 times more sensitive than Daphnia. Additions of Ca and Na but not Mg provided significant protection against Dy toxicity to Hyalella. Similarly, low pH was associated with reduction in toxicity. Exposures which were pH buffered with and without MOPS were significantly different and indicated that MOPS enhanced Dy toxicity. DOM also mitigated Dy toxicity. Biotic ligand based parameters (Log K values) were calculated based on free ion relationships as determined by geochemical equilibrium modeling software (WHAM ver. 7.02). The log K value for Dy{sup 3+} toxicity to Hyalella was 7.75 while the protective influence of Ca and Na were 3.95 and 4.10, respectively. This study contributes data towards the development of site specific

  18. Synthesis and characterization of phosphors based on calcium and magnesium silicates doped with europium and dysprosium

    International Nuclear Information System (INIS)

    Misso, Agatha Matos

    2016-01-01

    Ca and Mg silicates based phosphors were prepared by sol-gel method combined with the molten salts process. The gel of silica was obtained from Na 2 SiO 3 solution by using europium, dysprosium, calcium and magnesium chloride solutions. Therefore, those chlorides were homogeneously dispersed into the gel. The obtained gel was dried and heat treated to 900° C for 1h to allow the fusion of the present salts. Then it was water washed until negative test for Cl - , and dried. The reduction of the europium to Eu 2+ was performed under atmosphere of 5% of H 2 and 95% of Ar to 900° C for 3h, to reach CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors. Diopside was identified as main crystalline phase and quartz, as secondary phase from XRD (X-ray diffraction) patterns. SEM (scanning electron microscopy) micrographs, of the samples showed needles, spheres, leaves and rods of particles and agglomerates. Thermal analysis (TGA-DTGA) curves revealed that the crystallization temperature of CaMgSi 2 O 6 :Eu 2+ lies around 765° C. Photoluminescence spectroscopy of the phosphors was studied based on interconfigurational 4f N → 4f N-1 5d transition of Eu 2+ ion. The spectra of excitation showed 4f N → 4f N-1 5d transition of Eu 2+ ion broad band, related to the ligand to metal charge transfer transition (LMCT) O 2- (2p) → Eu 3+ in the 250 nm region, when the emission is monitored at 583,5 nm. It also presents the 4f ↔ 4f transitions of Eu 3+ ion bands, showing the 7 F 0 → 5 L 6 transition at 393 nm. From emission spectra with excitation monitored at 393 nm, it can be observed fine peaks between 570 and 750 nm which are characteristics of 5 D 0 → 7 F J (J = 0 - 5) transition of Eu 3+ ion, indicating that the Eu 3+ ion occupies a site with center of inversion. Finally, the obtained results indicate that the developed method is suitable to synthesize CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors, as it has been proposed. (author)

  19. Luminescence properties of dysprosium doped calcium magnesium silicate phosphor by solid state reaction method

    Energy Technology Data Exchange (ETDEWEB)

    Sahu, Ishwar Prasad, E-mail: ishwarprasad1986@gmail.com [School of Studies in Physics & Astrophysics, Pt. Ravishankar Shukla University, Raipur, C.G. 492010 (India); Chandrakar, Priya; Baghel, R.N.; Bisen, D.P.; Brahme, Nameeta [School of Studies in Physics & Astrophysics, Pt. Ravishankar Shukla University, Raipur, C.G. 492010 (India); Tamrakar, Raunak Kumar [Department of Applied Physics, Bhilai Institute of Technology, Durg, C.G. 491001 (India)

    2015-11-15

    Dysprosium doped calcium magnesium silicate (CaMgSi{sub 2}O{sub 6}:Dy{sup 3+}) white light emitting phosphor was synthesized by solid state reaction process. The crystal structure of sintered phosphor was monoclinic structure with space group C2/c. Chemical composition of the sintered CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor was confirmed by EDX. The prepared CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor was excited from 352 nm and their corresponding emission spectra were recorded at blue (470 nm), yellow (570 nm) and red (675 nm) line due to the {sup 4}F{sub 9/2} → {sup 6}H{sub 15/2}, {sup 4}F{sub 9/2} → {sup 6}H{sub 13/2}, {sup 4}F{sub 9/2} → {sup 6}H{sub 11/2} transitions of Dy{sup 3+} ions. The combination of these three emissions constituted as white light confirmed by the Commission Internationale de L'Eclairage (CIE) chromatic coordinate diagram. The possible mechanism of the white light emitting long lasting CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor was also investigated. Investigation on afterglow property show that phosphor held fast and slow decay process. The peak of mechanoluminescence (ML) intensity increases linearly with increasing impact velocity of the moving piston. Thus the present investigation indicates that the local piezoelectricity-induced electron bombardment model is responsible to produce ML in prepared CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor. - Highlights: • The crystal structure of CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor is consistent with standard monoclinic structure. • CIE coordinates of CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor is suitable as white light emitting phosphor. • The local piezoelectricity-induced electron bombardment model is responsible to produce ML in CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor.

  20. An ICP AES method for determination of dysprosium and terbium in high purity yttrium oxide

    International Nuclear Information System (INIS)

    Rupawate, V.H.; Hareendran, K.N.; Roy, S.B.

    2011-01-01

    High purity yttrium finds interesting application in astronavigation, luminescence, nuclear energy and metallurgical industries. Most of these applications require yttrium oxide of highest purity. Consequently there is a need for production of high purity yttrium oxide. Separation and purification of yttrium from other rare earths is a challenging task due to their close chemical properties. Liquid-liquid extraction and ion exchange have been widely used in the production of yttrium oxide of highest purity. Determination of impurities, especially other rare earths, in ppm level is required for process development and chemical characterization of the high purity Y 2 O 3 . Many methods have been described in literature. However since the advent of ICP AES much work in this area has been carried out by this technique. This paper describes the work done for determination of dysprosium (Dy) and terbium (Tb) in yttrium oxide using a high resolution sequential ICP AES. Emission spectra of rare earth elements are very complex and due to this complexity it is important to select spectral interference free analyte lines for determination of rare earths in rare earth matrix. For the determination of Dy and Tb in Y 2 O 3 , sensitive lines of Dy and Tb are selected from the instrument wavelength table and spectral interference free emission lines for the determination is selected by scanning around the selected wavelengths using 5 g/L Y solution and 5 mg/L standard solutions of Dy and Tb prepared in 4% nitric acid. It is found 353.170 nm line of Dy and 350.917 nm line Tb is suitable for quantitative determination. The signal to background ratio increases with increase in matrix concentration, i.e. from 1 to 5 mg/L. The optimum forward power is determined and it is found to be 1100W for Dy and 1000W for Tb. The instrument is calibrated using matrix matched standards containing 5g/L of Y matrix. Samples are dissolved in nitric acid and Y concentration is maintained at 5g/L. Two

  1. Acute dysprosium toxicity to Daphnia pulex and Hyalella azteca and development of the biotic ligand approach

    International Nuclear Information System (INIS)

    Vukov, Oliver; Smith, D. Scott; McGeer, James C.

    2016-01-01

    The toxicological understanding of rare earth elements (REEs) in the aquatic environment is very limited but of increasing concern. The objective of this research is to compare the toxicological effect of the REE dysprosium to the freshwater invertebrates Daphnia pulex and Hyalella azteca and in the more sensitive organism, understand the toxicity modifying influence of Ca, Na, Mg, pH and dissolved organic matter (DOM). Standard methods (Environment Canada) were followed for testing and culture in media of intermediate hardness (60 mg CaCO 3 mg/L) at pH 7.8 with Ca at 0.5, Na 0.5, Mg 0.125 (mM) and 23 °C. Acute toxicity tests were done with <24 h old neonates for 48 h in the case of D. pulex and with 2–9 days old offspring for 96 h tests with Hyalella. The potential protective effect of cationic competition was tested with Ca (0.5–2.0 mM), Na (0.5–2.0 mM) and Mg (0.125–0.5 mM). The effect of pH (6.5–8.0) and Suwannee River DOM complexation (at dissolved organic carbon (DOC) concentrations of 9 and 13 mg C/L) were evaluated. Dissolved Dy concentrations were lower than total (unfiltered) indicating precipitation, particularly at higher concentrations. Acute toxicity of Dy to H. azteca and D. pulex revealed Hyalella to be 1.4 times more sensitive than Daphnia. Additions of Ca and Na but not Mg provided significant protection against Dy toxicity to Hyalella. Similarly, low pH was associated with reduction in toxicity. Exposures which were pH buffered with and without MOPS were significantly different and indicated that MOPS enhanced Dy toxicity. DOM also mitigated Dy toxicity. Biotic ligand based parameters (Log K values) were calculated based on free ion relationships as determined by geochemical equilibrium modeling software (WHAM ver. 7.02). The log K value for Dy 3+ toxicity to Hyalella was 7.75 while the protective influence of Ca and Na were 3.95 and 4.10, respectively. This study contributes data towards the development of site specific water quality

  2. 78 FR 13396 - 90th Meeting: RTCA Special Committee 159, Global Positioning Systems (GPS)

    Science.gov (United States)

    2013-02-27

    ... 159, Global Positioning Systems (GPS) AGENCY: Federal Aviation Administration (FAA), U.S. Department... 159, Global Positioning Systems (GPS) SUMMARY: The FAA is issuing this notice to advise the public of the eighty-ninth meeting of the RTCA Special Committee 159, Global Positioning Systems (GPS). DATES...

  3. 78 FR 57672 - 91st Meeting: RTCA Special Committee 159, Global Positioning Systems (GPS)

    Science.gov (United States)

    2013-09-19

    ... 159, Global Positioning Systems (GPS) AGENCY: Federal Aviation Administration (FAA), U.S. Department... 159, Global Positioning Systems (GPS). SUMMARY: The FAA is issuing this notice to advise the public of the ninety-first meeting of the RTCA Special Committee 159, Global Positioning Systems (GPS) DATES...

  4. 33 CFR 159.315 - Sewage and graywater discharge record book.

    Science.gov (United States)

    2010-07-01

    ... record book. 159.315 Section 159.315 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... by Cruise Vessel Operations § 159.315 Sewage and graywater discharge record book. (a) While operating... and Graywater Discharge Record Book with the vessel's name and official number listed on the front...

  5. Structural investigation of an extracellular polysaccharide produced by the cariogenic bacterium Streptococcus mutans strain UA159

    NARCIS (Netherlands)

    Li, Bo; Dobruchowska, Justyna M.; Hoogenkamp, Michel A.; Gerwig, Gerrit J.

    2012-01-01

    The structure of an extracellular polysaccharide EPS159 produced from sucrose by Streptococcus mutans UA159 was investigated through the main oligosaccharides obtained from partial acid hydrolysis, monosaccharide/methylation analysis, and 1D/2D H-1 NMR spectroscopy. The results showed that EPS159

  6. 33 CFR 159.309 - Limitations on discharge of treated sewage or graywater.

    Science.gov (United States)

    2010-07-01

    ... treated sewage or graywater. 159.309 Section 159.309 Navigation and Navigable Waters COAST GUARD... Certain Alaskan Waters by Cruise Vessel Operations § 159.309 Limitations on discharge of treated sewage or graywater. (a) No person shall discharge treated sewage or graywater from a cruise vessel into the...

  7. Dual responsive dysprosium-doped hydroxyapatite particles and toxicity reduction after functionalization with folic and glucuronic acids.

    Science.gov (United States)

    Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P; Gurinov, Andrey; Ortiz, Genaro Gabriel; Carbajal Arízaga, Gregorio Guadalupe

    2015-03-01

    The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Magnetic anisotropy of dysprosium(III) in a low-symmetry environment: a theoretical and experimental investigation.

    Science.gov (United States)

    Bernot, Kevin; Luzon, Javier; Bogani, Lapo; Etienne, Mael; Sangregorio, Claudio; Shanmugam, Muralidharan; Caneschi, Andrea; Sessoli, Roberta; Gatteschi, Dante

    2009-04-22

    A mixed theoretical and experimental approach was used to determine the local magnetic anisotropy of the dysprosium(III) ion in a low-symmetry environment. The susceptibility tensor of the monomeric species having the formula [Dy(hfac)(3)(NIT-C(6)H(4)-OEt)(2)], which contains nitronyl nitroxide (NIT-R) radicals, was determined at various temperatures through angle-resolved magnetometry. These results are in agreement with ab initio calculations performed using the complete active space self-consistent field (CASSCF) method, validating the predictive power of this theoretical approach for complex systems containing rare-earth ions, even in low-symmetry environments. Susceptibility measurements performed with the applied field along the easy axis eventually permitted a detailed analysis of the temperature and field dependence of the magnetization, providing evidence that the Dy ion transmits an antiferromagnetic interaction between radicals but that the Dy-radical interaction is ferromagnetic.

  9. Watt-level dysprosium fiber laser at 3.15  μm with 73% slope efficiency.

    Science.gov (United States)

    Woodward, R I; Majewski, M R; Bharathan, G; Hudson, D D; Fuerbach, A; Jackson, S D

    2018-04-01

    Rare-earth-doped fiber lasers are emerging as promising high-power mid-infrared sources for the 2.6-3.0 μm and 3.3-3.8 μm regions based on erbium and holmium ions. The intermediate wavelength range, however, remains vastly underserved, despite prospects for important manufacturing and defense applications. Here, we demonstrate the potential of dysprosium-doped fiber to solve this problem, with a simple in-band pumped grating-stabilized linear cavity generating up to 1.06 W at 3.15 μm. A slope efficiency of 73% with respect to launched power (77% relative to absorbed power) is achieved-the highest value for any mid-infrared fiber laser to date, to the best of our knowledge. Opportunities for further power and efficiency scaling are also discussed.

  10. Clinical analysis on 159 cases of mechanical ocular trauma

    Directory of Open Access Journals (Sweden)

    Zi-Yao Liu

    2013-08-01

    Full Text Available AIM: To provide the basis of security guidance and decreasing the incidence through a general investigation of the mechanical ocular trauma among all the common causes, occasions where getting hurt as well as the characteristics of the high-risk group, and by further analysis and monitoring of the clinical cases and follow-up visit, study the related key factors of influencing the prognosis statistically. METHODS: The data of the 159 cases with mechanical ocular trauma were recorded.RESULTS: We obtained the 159 subjects' ages, genders as well as mechanical ocular trauma characteristic data, such as ocular distributions, the seasons of the injuries occurring, the causes and the occasions of the injuries, the high-risks group and so on. The factors affecting the visual prognosis,univariate analysis showed that the difference between urban and rural areas was a related influencing factor while the consulting hours and the ages of the patients were irrelevant. In the multivariate Logistic regression model of complications that affected the visual prognosis, there were four main factors leading to poor eyesight: endophthalmitis, retinal detachment, luxation or subluxation of the lens, prolapse of vitreous. In the multivariate Logistic regression model of the visual prognosis of mechanical eye injury, there were three factors of concern that corresponded to poor eyesight: the ages less than 10, zonation Ⅲ, grade of injury more than 3. CONCLUSION: The epidemiologic features of the mechanical ocular trauma in our hospital correspond to the reports from other areas. Appropriate medical care can improve the visual prognosis. Factors such as zonation Ⅲ, ages less than 10, grade of injury more than 3, endophthalmitis with the eye injury, prolapse of vitreous, luxation or subluxation of the lens and so on, indicate poor visual prognosis.

  11. On-line complexation/cloud point preconcentration for the sensitive determination of dysprosium in urine by flow injection inductively coupled plasma-optical emission spectrometry

    International Nuclear Information System (INIS)

    Ortega, Claudia; Cerutti, Soledad; Silva, Maria F.; Olsina, Roberto A.; Martinez, Luis D.

    2003-01-01

    An on-line dysprosium preconcentration and determination system based on the hyphenation of cloud point extraction (CPE) to flow injection analysis (FIA) associated with ICP-OES was studied. For the preconcentration of dysprosium, a Dy(III)-2-(5-bromo-2-pyridylazo)-5-diethylaminophenol complex was formed on-line at pH 9.22 in the presence of nonionic micelles of PONPE-7.5. The micellar system containing the complex was thermostated at 30 C in order to promote phase separation, and the surfactant-rich phase was retained in a microcolumn packed with cotton at pH 9.2. The surfactant-rich phase was eluted with 4 mol L -1 nitric acid at a flow rate of 1.5 mL min -1 , directly in the nebulizer of the plasma. An enhancement factor of 50 was obtained for the preconcentration of 50 mL of sample solution. The detection limit value for the preconcentration of 50 mL of aqueous solution of Dy was 0.03 μg L -1 . The precision for 10 replicate determinations at the 2.0 μg L -1 Dy level was 2.2% relative standard deviation (RSD), calculated from the peak heights obtained. The calibration graph using the preconcentration system for dysprosium was linear with a correlation coefficient of 0.9994 at levels near the detection limits up to at least 100 μg L -1 . The method was successfully applied to the determination of dysprosium in urine. (orig.)

  12. Graphite furnace atomic absorption spectrometry with a tantalum boat for the determination of yttrium, samarium, and dysprosium in a mish metal

    International Nuclear Information System (INIS)

    Daidoji, Hidehiro; Tamura, Shohei

    1982-01-01

    The determination of yttrium, samarium, and dysprodium by means of graphite-furnace atomic absorption spectrometry (AAS) was studied by a tantalum boat inserted into a graphite tube atomizer. These elements could not be determined by the use of a commercial graphite tube, In the atomization from a tantalum boat, better analytical sensitivities and negligible memory effects for these rare earths are obtained. The analytical sensitivities of yttrium, samarium, and dysprodium with the tantalum boat were 0.60 ng, 0.86 ng, and 0.17 ng respectively. This method was applied for the determination of yttrium, samarium, and dysprosium in a mish metal. The measurements were performed with slightly acidified solutions (0.01 mol dm 3 HCI or HNO 3 ). The sensitivities and the precisions for these elements decreased with increasing acid concentration. An enhancement in the sensitivities of yttrium and dysprosium upon the addition of a large excess of lanthanum, neodymium, and praseodymium salts were observed. The yttrium, samarium, and dysprosium in a mish metal were determined with both analytical curves of standard solutions containing an excess of lanthanum, cerium, and neodymium ions and of the standard addition. The precisions for this work were in the 3 - 9.3% range. (author)

  13. 75 FR 2581 - Eighty-First Meeting: RTCA Special Committee 159: Global Positioning System (GPS)

    Science.gov (United States)

    2010-01-15

    ... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held February 2-5, 2010, from 9 a.m. to 4:30 p.m. (unless stated...

  14. 76 FR 27744 - Eighty-Fifth Meeting: RTCA Special Committee 159: Global Positioning System (GPS)

    Science.gov (United States)

    2011-05-12

    ... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held May 26, 2011, from 9 a.m. to 11:45 a.m. ADDRESSES: The...

  15. 76 FR 67019 - Eighty-Seventh: RTCA Special Committee 159: Global Positioning System (GPS)

    Science.gov (United States)

    2011-10-28

    ... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), U.S... System (GPS). SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 159: Global Positioning System (GPS) 87th meeting. DATES: The meeting will be held November 14-18...

  16. 76 FR 33022 - Eighty-Sixth Meeting: RTCA Special Committee 159: Global Positioning System (GPS)

    Science.gov (United States)

    2011-06-07

    ... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held June 13-17, 2011, from 9 a.m. to 4:30 p.m. ADDRESSES: The...

  17. 77 FR 12106 - 88th Meeting: RTCA Special Committee 159, Global Positioning System (GPS)

    Science.gov (United States)

    2012-02-28

    ... 159, Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 159, Global Positioning System (GPS). SUMMARY: The..., Global Positioning System (GPS). DATES: The meeting will be held March 13-16, 2012, from 9 a.m.-4:30 p.m...

  18. 46 CFR 159.005-11 - Approval inspection or test report: Contents.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Approval inspection or test report: Contents. 159.005-11 Section 159.005-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... representation is also punishable as a crime under 18 U.S.C. 1001. ...

  19. 46 CFR 159.005-15 - Approval of equipment or material: Suspensions, withdrawals, and terminations.

    Science.gov (United States)

    2010-10-01

    ..., withdrawals, and terminations. 159.005-15 Section 159.005-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF..., withdrawals, and terminations. (a) The Commandant suspends an approval issued under this subchapter in...

  20. 46 CFR 159.007-11 - Production inspections and tests: Yearly report.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Production inspections and tests: Yearly report. 159.007-11 Section 159.007-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND MATERIALS Production...

  1. 46 CFR 159.010-7 - Recognized independent laboratory: Memorandum of Understanding.

    Science.gov (United States)

    2010-10-01

    ... independent laboratory and the Coast Guard; (7) An agreement to conduct comparison testing with other... for conducting comparison tests with other recognized laboratories. (d) Copies of MOUs signed by the... Understanding. 159.010-7 Section 159.010-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED...

  2. 46 CFR 159.005-7 - Preapproval review: Coast Guard action.

    Science.gov (United States)

    2010-10-01

    ... Section 159.005-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... may be conducted. (2) If the Commandant determines from the application for approval that the... under § 159.005-13 can be taken. (c) An item of equipment or material that does not meet all of the...

  3. 46 CFR 159.007-5 - Production inspections and tests: Application for acceptance.

    Science.gov (United States)

    2010-10-01

    ... acceptance. 159.007-5 Section 159.007-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND MATERIALS...) Is accepted by the Commandant for approval inspections and tests of the equipment or material under...

  4. 46 CFR 159.007-3 - Production inspections and tests: Independent laboratory's procedures.

    Science.gov (United States)

    2010-10-01

    ...'s procedures. 159.007-3 Section 159.007-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND... meets the inspection and test procedures of the laboratory; and (3) Are accepted by the Commandant under...

  5. 7 CFR 1717.159 - Applications for RUS approvals of mergers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Applications for RUS approvals of mergers. 1717.159... ELECTRIC LOANS Mergers and Consolidations of Electric Borrowers § 1717.159 Applications for RUS approvals of mergers. If a proposed merger requires RUS approval according to RUS regulations and/or the loan...

  6. Chloroplast Preproteins Bind to the Dimer Interface of the Toc159 Receptor during Import1[OPEN

    Science.gov (United States)

    Chen, Lih-Jen; Yeh, Yi-Hung; Hsiao, Chwan-Deng

    2017-01-01

    Most chloroplast proteins are synthesized in the cytosol as higher molecular weight preproteins and imported via the translocons in the outer (TOC) and inner (TIC) envelope membranes of chloroplasts. Toc159 functions as a primary receptor and directly binds preproteins through its dimeric GTPase domain. As a first step toward a molecular understanding of how Toc159 mediates preprotein import, we mapped the preprotein-binding regions on the Toc159 GTPase domain (Toc159G) of pea (Pisum sativum) using cleavage by bound preproteins conjugated with the artificial protease FeBABE and cysteine-cysteine cross-linking. Our results show that residues at the dimer interface and the switch II region of Toc159G are in close proximity to preproteins. The mature portion of preproteins was observed preferentially at the dimer interface, whereas the transit peptide was found at both regions equally. Chloroplasts from transgenic plants expressing engineered Toc159 with a cysteine placed at the dimer interface showed increased cross-linking to bound preproteins. Our data suggest that, during preprotein import, the Toc159G dimer disengages and the dimer interface contacts translocating preproteins, which is consistent with a model in which conformational changes induced by dimer-monomer conversion in Toc159 play a direct role in facilitating preprotein import. PMID:28250068

  7. 49 CFR 173.159a - Exceptions for non-spillable batteries.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Exceptions for non-spillable batteries. 173.159a... Class 1 and Class 7 § 173.159a Exceptions for non-spillable batteries. (a) Exceptions for hazardous...-spillable batteries offered for transportation or transported in accordance with this section are subject to...

  8. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    International Nuclear Information System (INIS)

    Bedogni, R.; Gómez-Ros, J.M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-01-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  9. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Science.gov (United States)

    Bedogni, R.; Gómez-Ros, J. M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-08-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  10. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Gomez-Ros, J.M. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Perez, L. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Angelone, M. [ENEA C.R. Frascati, C.P. 65, 00044 Frascati (Italy); Tana, L. [A.O. Universitaria Pisana-Ospedale S. Chiara, Via Bonanno Pisano, Pisa (Italy)

    2012-08-21

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  11. Fusion of 6Li with 159Tb at near-barrier energies

    International Nuclear Information System (INIS)

    Pradhan, M. K.; Mukherjee, A.; Basu, P.; Goswami, A.; Kshetri, R.; Roy, Subinit; Chowdhury, P. Roy; Sarkar, M. Saha; Palit, R.; Parkar, V. V.; Santra, S.; Ray, M.

    2011-01-01

    Complete and incomplete fusion cross sections for 6 Li + 159 Tb have been measured at energies around the Coulomb barrier by the γ-ray method. The measurements show that the complete fusion cross sections at above-barrier energies are suppressed by ∼34% compared to coupled-channel calculations. A comparison of the complete fusion cross sections at above-barrier energies with the existing data for 11,10 B + 159 Tb and 7 Li + 159 Tb shows that the extent of suppression is correlated with the α separation energies of the projectiles. It has been argued that the Dy isotopes produced in the reaction 6 Li + 159 Tb at below-barrier energies are primarily due to the d transfer to unbound states of 159 Tb, while both transfer and incomplete fusion processes contribute at above-barrier energies.

  12. Sol-gel synthesis and crystallization kinetics of dysprosium-titanate Dy2Ti2O7 for photonic applications

    Czech Academy of Sciences Publication Activity Database

    Mrázek, Jan; Potel, M.; Buršík, Jiří; Mráček, A.; Kallistová, Anna; Jonášová, Šárka; Boháček, Jan; Kašík, Ivan

    2015-01-01

    Roč. 168, November (2015), s. 159-167 ISSN 0254-0584 Institutional support: RVO:67985882 ; RVO:68081723 ; RVO:67985831 Keywords : Ceramics * Inorganic compounds * Optical materials Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; JG - Metallurgy (UFM-A); CB - Analytical Chemistry, Separation (GLU-S) Impact factor: 2.101, year: 2015

  13. Oxide perovskites with tetravalent dysprosium and compounds of the type Ba/sub 3/RE/sub 4/O/sub 9/ (RE = Rare Earth Element)

    Energy Technology Data Exchange (ETDEWEB)

    Brauer, G; Kristen, H [Freiburg Univ. (Germany, F.R.)

    1980-03-01

    In analogy to our investigations concerning tetravalent Nd in oxide perovskites, we also tried to stabilize dysprosium(IV) by incorporation in host-lattices with the perovskite structure. As host-lattices we used BaCeO/sub 3/, BaTbO/sub 3/, and SrTbO/sub 3/. Only in Ba(Ce, Dy)O/sub 3/ we could trace Dy(IV) with certainty. Among the prepared mixed oxides, also the phase Ba/sub 3/Dy/sub 4/O/sub 9/ occured. The lattice parameters of several phases of this latter type were redetermined.

  14. Effect of solvents on relation of intensities of bands of luminescence spectra of terbium and dysprosium ions in solutions of their complexes with acetoacetic ester

    International Nuclear Information System (INIS)

    Kononenko, L.I.; Bel'tyukova, S.V.; Meshkova, S.B.; Kravchenko, T.B.; Poluehktov, N.S.

    1978-01-01

    An investigation is made of the effect of different solvents on the ratio of the intensity of luminescence spectrum bands of terbium and dysprosium ions, corresponding and not corresponding to ''supersensitive'' transitions in complex compounds with acetoacetic ether. A dependence is established between these values and the dielectric constant of the solvent, and also parallels in their changes, which indicate the similar manifestation of the effect of solvents in both elements. A correlation is observed between ratios of the intensity of luminescence spectrum bands and values of forces of neodymium complex absorption band oscillators in different solvents

  15. Optical amplifier operating at 1.3 microns useful for telecommunications and based on dysprosium-doped metal chloride host materials

    Energy Technology Data Exchange (ETDEWEB)

    Page, R.H.; Schaffers, K.I.; Payne, S.A.; Krupke, W.F.; Beach, R.J.

    1997-12-02

    Dysprosium-doped metal chloride materials offer laser properties advantageous for use as optical amplifiers in the 1.3 {micro}m telecommunications fiber optic network. The upper laser level is characterized by a millisecond lifetime, the host material possesses a moderately low refractive index, and the gain peak occurs near 1.31 {micro}m. Related halide materials, including bromides and iodides, are also useful. The Dy{sup 3+}-doped metal chlorides can be pumped with laser diodes and yield 1.3 {micro}m signal gain levels significantly beyond those currently available. 9 figs.

  16. Optical amplifier operating at 1.3 microns useful for telecommunications and based on dysprosium-doped metal chloride host materials

    Energy Technology Data Exchange (ETDEWEB)

    Page, Ralph H. (San Ramon, CA); Schaffers, Kathleen I. (Pleasanton, CA); Payne, Stephen A. (Castro Valley, CA); Krupke, William F. (Pleasanton, CA); Beach, Raymond J. (Livermore, CA)

    1997-01-01

    Dysprosium-doped metal chloride materials offer laser properties advantageous for use as optical amplifiers in the 1.3 .mu.m telecommunications fiber optic network. The upper laser level is characterized by a millisecond lifetime, the host material possesses a moderately low refractive index, and the gain peak occurs near 1.31 .mu.m. Related halide materials, including bromides and iodides, are also useful. The Dy.sup.3+ -doped metal chlorides can be pumped with laser diodes and yield 1.3 .mu.m signal gain levels significantly beyond those currently available.

  17. Determination of Diclofenac on a Dysprosium Nanowire- Modified Carbon Paste Electrode Accomplished in a Flow Injection System by Advanced Filtering

    Directory of Open Access Journals (Sweden)

    Ali Akbar Moosavi-Movahedi

    2009-09-01

    Full Text Available A new detection technique called Fast Fourier Transform Square-Wave Voltammetry (FFT SWV is based on measurements of electrode admittance as a function of potential. The response of the detector (microelectrode, which is generated by a redox processes, is fast, which makes the method suitable for most applications involving flowing electrolytes. The carbon paste electrode was modified by nanostructures to improve sensitivity. Synthesized dysprosium nanowires provide a more effective nanotube-like surface [1-4] so they are good candidates for use as a modifier for electrochemical reactions. The redox properties of diclofenac were used for its determination in human serum and urine samples. The support electrolyte that provided a more defined and intense peak current for diclofenac determination was a 0.05 mol L−1 acetate buffer pH = 4.0. The drug presented an irreversible oxidation peak at 850 mV vs. Ag/AgCl on a modified nanowire carbon paste electrode which produced high current and reduced the oxidation potential by about 100 mV. Furthermore, the signal-to-noise ratio was significantly increased by application of a discrete Fast Fourier Transform (FFT method, background subtraction and two-dimensional integration of the electrode response over a selected potential range and time window. To obtain the much sensivity the effective parameters such as frequency, amplitude and pH was optimized. As a result, CDL of 2.0 × 10−9 M and an LOQ of 5.0 × 10−9 M were found for the determination for diclofenac. A good recovery was obtained for assay spiked urine samples and a good quantification of diclofenac was achieved in a commercial formulation.

  18. Neutron resonance spins of 159Tb from experiments with polarized neutrons and polarized nuclei

    International Nuclear Information System (INIS)

    Alfimenkov, V.P.; Ivanenko, A.I.; Lason', L.; Mareev, Yu.D.; Ovchinnikov, O.N.; Pikel'ner, L.B.; Sharapov, Eh.I.

    1976-01-01

    Spins of 27 neutron resonances of 159 Tb with energies up to 114 eV have been measured using polarized neutrons and nuclei beams in the modernized time-of-flight spectrometer of the IBR-30 pulse reator. The direct measurements of the terbium resonances spins performed using polarized neutrons reaffirm the conclusion that there are no unstationary effects in the behaviour of 159 Tb neutron resonances in the energy range

  19. On the annealing behaviour of dysprosium ion implanted nickel: a combined study using Rutherford backscattering, transmission electron microscopy, and total current spectroscopy

    International Nuclear Information System (INIS)

    Chadderton, L.T.; Johnson, E.

    1977-01-01

    Despite continuing improvements in applications of the analytical method of Rutherford backscattering (RBS) to solid state physics it is recognized that more complete information can be obtained if other techniques - for example transmission electron microscopy (TEM) - are employed simultaneously. Experiments are described in which a combined RBS and TEM study of the annealing of nickel, rendered amorphous by implantation of 20 keV dysprosium ions is supplemented with a completely new technique - total current spectroscopy (TCS). In TCS low energy electrons (0-15 eV) are used to probe the damaged nickel. Observations have been made during annealing of both the reappearance of the bulk band structure of the metal and of a 'surface peak' which is highly sensitive to the recovery process. Changes in the height of the surface peak reveal three sharp annealing stages, the first two being preceded by reverse annealing which correlates well with RBS and TEM results. The first annealing stage - following the amorphous to crystalline transition - may be associated with electronic effects in the vicinity of the Curie point. Changes in the position of the surface peak allow one to trace the diffusion of dysprosium to the surface. Quantum mechanical resonances at the damage/crystal interface have also been followed throughout annealing. The initially amorphous layer (approximately 2.2nm) increases in thickness slightly during recovery. (Auth.)

  20. DC-159a Shows Inhibitory Activity against DNA Gyrases of Mycobacterium leprae.

    Science.gov (United States)

    Yamaguchi, Tomoyuki; Yokoyama, Kazumasa; Nakajima, Chie; Suzuki, Yasuhiko

    2016-09-01

    Fluoroquinolones are a class of antibacterial agents used for leprosy treatment. Some new fluoroquinolones have been attracting interest due to their remarkable potency that is reportedly better than that of ofloxacin, the fluoroquinolone currently recommended for treatment of leprosy. For example, DC-159a, a recently developed 8-methoxy fluoroquinolone, has been found to be highly potent against various bacterial species. Nonetheless, the efficacy of DC-159a against Mycobacterium leprae is yet to be examined. To gather data that can support highly effective fluoroquinolones as candidates for new remedies for leprosy treatment, we conducted in vitro assays to assess and compare the inhibitory activities of DC-159a and two fluoroquinolones that are already known to be more effective against M. leprae than ofloxacin. The fluoroquinolone-inhibited DNA supercoiling assay using recombinant DNA gyrases of wild type and ofloxacin-resistant M. leprae revealed that inhibitory activities of DC-159a and sitafloxacin were at most 9.8- and 11.9-fold higher than moxifloxacin. Also the fluoroquinolone-mediated cleavage assay showed that potencies of those drugs were at most 13.5- and 9.8-fold higher than moxifloxacin. In addition, these two drugs retained their inhibitory activities even against DNA gyrases of ofloxacin-resistant M. leprae. The results indicated that DC-159a and sitafloxacin are more effective against wild type and mutant M. leprae DNA gyrases than moxifloxacin, suggesting that these antibacterial drugs can be good candidates that may supersede current fluoroquinolone remedies. DC-159a in particular is very promising because it is classified in a subgroup of fluoroquinolones that is known to be less likely to cause adverse effects. Our results implied that DC-159a is well worth further investigation to ascertain its in vivo effectiveness and clinical safety for humans.

  1. Four new dysprosium and neodymium octamolybdate hydrates: assembly of RE2(Mo8O27) sheets and topotactic transformations.

    Science.gov (United States)

    Kuang, Xiaojun; Evans, Ivana R

    2010-07-05

    Four new Dy and Nd hydrated octamolybdate materials have been prepared: [Dy(2)(H(2)O)(12)](Mo(8)O(27)) x 8 H(2)O, [Dy(2)(H(2)O)(6)](Mo(8)O(27)), [Nd(2)(H(2)O)(12)](Mo(8)O(27)) x 6 H(2)O, and [Nd(2)(H(2)O)(6)]Mo(8)O(27) x 3 H(2)O. They adopt one known and three new structure types, which we have determined ab initio from powder X-ray diffraction data. The four compounds contain the same basic structural building block, in the form of RE(2)Mo(8)O(27) (RE = Dy, Nd) chains, which are arranged differently for the two rare earths in the fully hydrated precursor materials. [Dy(2)(H(2)O)(12)](Mo(8)O(27)) x 8 H(2)O comprises isolated Dy(2)Mo(8)O(27) chains assembled in a zigzag manner along the a axis with interspersed crystallized water molecules, which differs from the parallel arrangements of isolated Nd(2)Mo(8)O(27) chains in [Nd(2)(H(2)O)(12)](Mo(8)O(27)) x 6 H(2)O. Partial dehydration of the two precursors leads to new phases [Dy(2)(H(2)O)(6)](Mo(8)O(27)) and [Nd(2)(H(2)O)(6)]Mo(8)O(27) x 3 H(2)O, respectively, prior to complete dehydration, which leads to initially amorphous and eventually crystalline rare-earth molybdenum mixed metal oxides. Both initial transformations occur topotactically. Partial dehydration of the Dy phase condenses the assembly of the Dy(2)Mo(8)O(27) chains principally along the a axis, leading to a 3-dimensional (3D) framework, with each Dy bridging two (Mo(8)O(27))(6-) sheets in the product. The partial dehydration of the Nd precursor condenses the assembly of Nd(2)Mo(8)O(27) chains along the [110] axis, leading to a 3D framework where each Nd bridges three (Mo(8)O(27))(6-) units. Both new dysprosium octamolybdates adopt noncentrosymmetric polar structures in space group P2(1) and are second harmonic generation (SHG) active.

  2. Microstructure and thermal properties of dysprosium and thulium co-doped barium titanate ceramics for high performance multilayer ceramic capacitors

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jinseong; Kim, Dowan; Noh, Taimin [School of Materials Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of); Ahn, Byungmin [Department of Chemical Engineering and Materials Science, University of Southern California, Los Angeles, CA 90089-0241 (United States); Lee, Heesoo, E-mail: heesoo@pusan.ac.kr [School of Materials Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of)

    2011-09-15

    Highlights: > Dy/Tm co-doping method in BaTiO{sub 3} was suggested to improve electrical properties and temperature stability simultaneously. > We examined these properties in terms of microstructural analysis and substitution rate. > Increase of Dy{sub 2}O{sub 3} addition enhanced dielectric constant. > Increase of Tm{sub 2}O{sub 3} addition enhanced temperature stability. > Improved electrical properties and temperature stability through Dy/Tm co-doping were deduced from formation of electrons and core-shell structure. - Abstract: The co-doping characteristics on microstructure and thermal properties of barium titanate (BaTiO{sub 3}) were investigated to elucidate formation of core-shell structure by dysprosium (Dy) and thulium (Tm) addition in the BaTiO{sub 3}-Dy{sub 2}O{sub 3}-Tm{sub 2}O{sub 3} system. The dielectrics co-doped with 0.7 mol% Dy{sub 2}O{sub 3} and 0.3 mol% Tm{sub 2}O{sub 3} had the dielectric constant up to 2200 as a function of temperature, which was 30% higher than that of specimen containing only Tm{sub 2}O{sub 3} at the room temperature. It could be explained by the fact that the increase of Dy{sub 2}O{sub 3} addition contributed to the improvement of dielectric constant. On the other hand, the rapid diffusion rate of Dy{sup 3+} ions in BaTiO{sub 3} showed an adverse effect on temperature stability caused by destruction of core-shell. As the compensation for shell expansion in BaTiO{sub 3}, the reinforcement of the core-shell structure through the addition of Tm{sub 2}O{sub 3} was confirmed by TEM-EDS analysis and attributed the temperature coefficient of capacitance (TCC) in a reliability condition (-55 deg. C to 125 deg. C, {Delta}C = {+-}15% or less). The enhanced electrical properties and temperature stability could be deduced from the generation of electrons and the formation core-shell structure in co-doped BaTiO{sub 3} system respectively.

  3. The H159A mutant of yeast enolase 1 has significant activity.

    Science.gov (United States)

    Brewer, J M; Holland, M J; Lebioda, L

    2000-10-05

    The function of His159 in the enolase mechanism is disputed. Recently, Vinarov and Nowak (Biochemistry (1999) 38, 12138-12149) prepared the H159A mutant of yeast enolase 1 and expressed this in Escherichia coli. They reported minimal (ca. 0.01% of the native value) activity, though the protein appeared to be correctly folded, according to its CD spectrum, tryptophan fluorescence, and binding of metal ion and substrate. We prepared H159A enolase using a multicopy plasmid and expressed the enzyme in yeast. Our preparations of H159A enolase have 0.2-0.4% of the native activity under standard assay conditions and are further activated by Mg(2+) concentrations above 1 mM to 1-1.5% of the native activity. Native enolase 1 (and enolase 2) are inhibited by such Mg(2+) concentrations. It is possible that His159 is necessary for correct folding of the enzyme and that expression in E. coli leads to largely misfolded protein. Copyright 2000 Academic Press.

  4. Modifications at the A-domain of the chloroplast import receptor Toc159.

    Science.gov (United States)

    Agne, Birgit; Kessler, Felix

    2010-11-01

    Two families of GTPases, the Toc34 and Toc159 GTPase families, take on the task of preprotein recognition at the translocon at the outer membrane of chloroplasts (TOC translocon). The major Toc159 family members have highly acidic N-terminal domains (A-domains) that are non-essential and so far have escaped functional characterization. But recently, interest in the role of the A-domain has strongly increased. The new data of three independent studies provide evidence that the Toc159 A-domain I) participates in preprotein selectivity, II) has typical features of intrinsically unfolded proteins and III) is highly phosphorylated and possibly released from the rest of the protein by a proteolytic event. This hints to a complex regulation of A-domain function that is important for the maintenance of the preprotein selectivity at the TOC translocons.

  5. Combined therapy of the Walker-256 carcinosarcoma with X-rays and ICRF-159

    International Nuclear Information System (INIS)

    Schaphaus, A.

    1974-01-01

    The radiosensitivity of the Walker-256 carcinosarcoma of the rat under the influence of the tumour-inhibiting bisdioxopiperazine ICRF-159 was studied in collectives of 11-16 animals with tumours. In the combined radio- and chemotherapy, the animals received a daily i.p. injection of 30 mg/kg K.G. of the bisdioxopiperazine ICRF-159 in 1.0 ml NaCl solution containing carboxyl methyl cellulose. The tumour inhibition was determined by multidimensional measurements of the increase in tumour size with the aid of a slide gange. The combined therapy had a better inhibiting effect on tumour growth than radiotherapy alone. (orig./AK) [de

  6. Single-molecule magnet behavior in an octanuclear dysprosium(iii) aggregate inherited from helical triangular Dy3 SMM-building blocks.

    Science.gov (United States)

    Zhang, Li; Zhang, Peng; Zhao, Lang; Wu, Jianfeng; Guo, Mei; Tang, Jinkui

    2016-06-28

    An unprecedented octanuclear dysprosium(iii) cluster with the formula [Dy8L6(μ3-OH)4(μ2-CH3O)2(CH3OH)6(H2O)2]·6H2O·10CH3OH·2CH3CN () based on a nonlinearly tritopic aroylhydrazone ligand H3L has been isolated, realizing the successful linking of pairwise interesting triangular Dy3 SMMs. It is noteworthy that two enantiomers (Λ and Δ configurations) individually behaving as a coordination-induced chirality presented in the Dy3 helicate are connected in the meso Dy8 cluster. Remarkably, alternating-current magnetic susceptibility measurements revealed that the Dy8 cluster shows typical SMM behavior inherited from its Dy3 helical precursor. It is one of the rare polynuclear Lnn SMMs (n > 7) under zero dc field.

  7. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  8. Synthesis and X-ray diffraction studies of dysprosium-calcium ferrites Dy1-xCaxFeO3-y (0≤x≤2/3)

    International Nuclear Information System (INIS)

    Li, J.; Song, D.; Su, Z.; Wang, T.M.

    1997-01-01

    Samples of dysprosium-calcium ferrites Dy 1-x Ca x FeO 3-y with x ranging from 0 to 2/3 were novelly prepared in air by solid state reaction and characterized by X-ray powder diffraction. These samples are single-phased orthorhombic perovskite-type compounds belonging to the space group D 2h 16 -Pbnm. The lattice constants of the Dy 1-x Ca x FeO 3-y samples have been refined by Cohen's least-squares method. The initial substitution of Ca for Dy leads to a decrease of the lattice constants. Further substitution of Ca for Dy has hardly any influence on the lattice dimensions. (orig.)

  9. TamiR159 directed wheat TaGAMYB cleavage and its involvement in anther development and heat response.

    Directory of Open Access Journals (Sweden)

    Yu Wang

    Full Text Available In Arabidopsis and rice, miR159-regulated GAMYB-like family transcription factors function in flower development and gibberellin (GA signaling in cereal aleurone cells. In this study, the involvement of miR159 in the regulation of its putative target TaGAMYB and its relationship to wheat development were investigated. First, we demonstrated that cleavage of TaGAMYB1 and TaGAMYB2 was directed by miR159 using 5'-RACE and a transient expression system. Second, we overexpressed TamiR159, TaGAMYB1 and mTaGAMYB1 (impaired in the miR159 binding site in transgenic rice, revealing that the accumulation in rice of mature miR159 derived from the precursor of wheat resulted in delayed heading time and male sterility. In addition, the number of tillers and primary branches in rice overexpressing mTaGAMYB1 increased relative to the wild type. Our previous study reported that TamiR159 was downregulated after two hours of heat stress treatment in wheat (Triticum aestivum L.. Most notably, the TamiR159 overexpression rice lines were more sensitive to heat stress relative to the wild type, indicating that the downregulation of TamiR159 in wheat after heat stress might participate in a heat stress-related signaling pathway, in turn contributing to heat stress tolerance.

  10. Soft X-ray excess in the cluster of galaxies Sérsic 159-03

    NARCIS (Netherlands)

    de Plaa, J.; Kaastra, J.S.; Méndez, R.M.; Tamura, T.; Bleeker, J.A.M.; Peterson, J.; Paerels, F.B.S.; Bonamente, M.; Lieu, R.

    2004-01-01

    We present the results from a new 120 ks XMM-Newton observation of Sérsic 159-03. A previous XMM-Newton observation of this cluster shows the presence of a soft X-ray excess in the outer parts of the cluster, which is possibly connected to the interaction between the cluster and the gas from the

  11. Alpha-production channels in 6Li+159Tb at energies around the Coulomb barrier

    International Nuclear Information System (INIS)

    Pradhan, M.K.; Mukherjee, A.; Roy, S.; Basu, P.; Goswami, A.; Saha Sarkar, M.; Kshetri, R.; Roy Chowdhury, R.; Ray, M.; Santra, S.; Kailas, S.; Parkar, V.V.; Palit, R.

    2010-01-01

    In order to investigate what are the dominant processes that might contribute to the inclusive α-particle channels, very recently measurements have been performed by the characteristic γ-ray method for the system 6 Li+ 159 Tb at energies below and above the Coulomb barrier (V B = 26.9 MeV)

  12. 49 CFR 1.59a - Redelegations by the Assistant Secretary for Administration.

    Science.gov (United States)

    2010-10-01

    ... DELEGATION OF POWERS AND DUTIES Delegations § 1.59a Redelegations by the Assistant Secretary for...-delegate and authorize successive re-delegations. (b) The Assistant Secretary for Administration has... employees under the Federal Wage System, except as delegated to the Commandant of the Coast Guard at § 1.46...

  13. MASSIVE STAR FORMATION IN THE LMC. I. N159 AND N160 COMPLEXES

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Michael S.; Jones, Terry J.; Gehrz, Robert D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy 116 Church St SE, University of Minnesota, Minneapolis, MN 55455 (United States); Helton, L. Andrew [USRA–SOFIA Science Center, NASA Ames Research Center, Moffett Field, CA 94035 (United States)

    2017-01-10

    We present images and spectral energy distributions (SEDs) of massive young stellar objects (YSOs) in three star-forming H ii regions of the Large Magellanic Cloud: N159A, N159 Papillon, and N160. We use photometry from SOFIA/FORCAST at 25.3–37.1 μ m to constrain model fits to the SEDs and determine luminosities, ages, and dust content of the embedded YSOs and their local environments. By placing these sources on mid-infrared color–magnitude and color–color diagrams, we analyze their dust properties and consider their evolutionary status. Since each object in the FORCAST images has an obvious bright near-infrared counterpart in Spitzer Space Telescope images, we do not find any evidence for new, very cool, previously undiscovered Class 0 YSOs. Additionally, based on its mid-infrared colors and model parameters, N159A is younger than N160 and the Papillon. The nature of the first extragalactic protostars in N159, P1, and P2, is also discussed.

  14. 46 CFR 159.005-5 - Preapproval review: Contents of application.

    Science.gov (United States)

    2010-10-01

    ... under paragraph (a)(2) of this section contains confidential commercial information that could cause... considered privileged and confidential under exemption (b)(4) of the Freedom of Information Act (5 U.S.C. 552... Section 159.005-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT...

  15. 46 CFR 159.010-5 - Independent laboratory: Application for acceptance.

    Science.gov (United States)

    2010-10-01

    ... organization or in a company or corporation that controls the organization. [CGD 93-055, 61 FR 13928, Mar. 28....010-5 Section 159.010-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... organization or the chief officer's representative, that an official representative of the Coast Guard is...

  16. 46 CFR 159.010-11 - Changes in the laboratory's qualifications.

    Science.gov (United States)

    2010-10-01

    ... Section 159.010-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... Commandant in writing of each change within 30 days after the change has occurred. (b) If any change in the... laboratory shall notify the Commandant in writing within 30 days after the change occurs. The Commandant may...

  17. 46 CFR 159.010-19 - Termination of acceptance or recognition: Procedure.

    Science.gov (United States)

    2010-10-01

    ... termination is under consideration. The laboratory may submit written comments to the Commandant within 21... of the laboratory and may direct the holder of the certificate of approval to cease claiming that the....010-19 Section 159.010-19 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT...

  18. 46 CFR 159.010-17 - Termination of acceptance or recognition of an independent laboratory.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND... comply with § 159.010-11; (g) Contracts or transfers the performance or supervision of required..., or in the opinion of the Commandant is unable to, carry out its responsibilities under an MOU...

  19. Oleanolic acid and ursolic acid inhibit peptidoglycan biosynthesis in Streptococcus mutans UA159

    Directory of Open Access Journals (Sweden)

    Soon-Nang Park

    2015-06-01

    Full Text Available In this study, we revealed that OA and UA significantly inhibited the expression of most genes related to peptidoglycan biosynthesis in S. mutans UA159. To the best of our knowledge, this is the first report to introduce the antimicrobial mechanism of OA and UA against S. mutans.

  20. Functional effects of the DCM mutant Gly159Asp troponin C in skinned muscle fibres

    DEFF Research Database (Denmark)

    Preston, Laura C; Lipscomb, Simon; Robinson, Paul

    2006-01-01

    We recently reported a dilated cardiomyopathy (DCM) causing mutation in a novel disease gene, TNNC1, which encodes cardiac troponin C (TnC). We have determined how this mutation, Gly159Asp, affects contractile regulation when incorporated into muscle fibres. Endogenous troponin in rabbit skinned...

  1. 47 CFR 25.159 - Limits on pending applications and unbuilt satellite systems.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Limits on pending applications and unbuilt... § 25.159 Limits on pending applications and unbuilt satellite systems. (a) Applicants with a total of... band, or a combination of pending GSO-like applications and licensed-but-unbuilt GSO-like space...

  2. 78 FR 54168 - Special Local Regulation, Cumberland River, Mile 157.0 to 159.0; Ashland City, TN

    Science.gov (United States)

    2013-09-03

    ... Local Regulation, Cumberland River, Mile 157.0 to 159.0; Ashland City, TN AGENCY: Coast Guard, DHS... Special local regulation; Cumberland River, Miles 157.0 to 159.0, Ashland City, TN. (a) Location. The... regulation for the waters of the Cumberland River beginning at mile marker 157.0 and ending at mile marker...

  3. 46 CFR 159.007-7 - Application for acceptance for production inspections and tests: Coast Guard action.

    Science.gov (United States)

    2010-10-01

    ... and tests: Coast Guard action. 159.007-7 Section 159.007-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL....007-7 Application for acceptance for production inspections and tests: Coast Guard action. (a) From...

  4. Cloning and characterization of pre-miR159a and pre-miR1123 from ...

    African Journals Online (AJOL)

    Although many miRNA genes are conserved across the plant species, the same gene family varies significantly in size and genomic organization in different species. ... Sequence identity matrix suggests 43-82% variation in precursor of Tae AL pre-miR159a (Tae Agra local pre-miR159a) across the species. On the other ...

  5. 76 FR 65211 - 159th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2011-10-20

    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 159th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 159th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

  6. 42 CFR 84.159 - Man tests for gases and vapors; supplied-air respirators; general performance requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Man tests for gases and vapors; supplied-air respirators; general performance requirements. 84.159 Section 84.159 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES...

  7. SPECTROSCOPIC STUDY OF THE N159/N160 COMPLEX IN THE LARGE MAGELLANIC CLOUD

    International Nuclear Information System (INIS)

    Farina, Cecilia; Bosch, Guillermo L.; Morrell, Nidia I.; Barba, Rodolfo H.; Walborn, Nolan R.

    2009-01-01

    We present a spectroscopic study of the N159/N160 massive star-forming region south of 30 Doradus in the Large Magellanic Cloud, classifying a total of 189 stars in the field of the complex. Most of them belong to O and early B spectral classes; we have also found some uncommon and very interesting spectra, including members of the Onfp class, a Be P Cygni star, and some possible multiple systems. Using spectral types as broad indicators of evolutionary stages, we considered the evolutionary status of the region as a whole. We infer that massive stars at different evolutionary stages are present throughout the region, favoring the idea of a common time for the origin of recent star formation in the N159/N160 complex as a whole, while sequential star formation at different rates is probably present in several subregions.

  8. Importance of $1n$-stripping process in the $^{6}$Li+$^{159}$Tb reaction

    OpenAIRE

    Pradhan, M. K.; Mukherjee, A.; Roy, Subinit; Basu, P.; Goswami, A.; Kshetri, R.; Palit, R.; Parkar, V. V.; Ray, M.; Sarkar, M. Saha; Santra, S.

    2013-01-01

    The inclusive cross sections of the $\\alpha$-particles produced in the reaction $^{6}$Li+$^{159}$Tb have been measured at energies around the Coulomb barrier. The measured cross sections are found to be orders of magnitude larger than the calculated cross sections of $^{6}$Li breaking into $\\alpha$ and $d$ fragments, thus indicating contributions from other processes. The experimental cross sections of $1n$-stripping and $1n$-pickup processes have been determined from an entirely different me...

  9. Characterization of a TK6-Bcl-xL gly-159-ala Human Lymphoblast Clone

    Energy Technology Data Exchange (ETDEWEB)

    Chyall, L.: Gauny, S.; Kronenberg, A.

    2006-01-01

    TK6 cells are a well-characterized human B-lymphoblast cell line derived from WIL-2 cells. A derivative of the TK6 cell line that was stably transfected to express a mutated form of the anti-apoptotic protein Bcl-xL (TK6-Bcl-xL gly-159- ala clone #38) is compared with the parent cell line. Four parameters were evaluated for each cell line: growth under normal conditions, plating efficiency, and frequency of spontaneous mutation to 6‑thioguanine resistance (hypoxanthine phosphoribosyl transferase locus) or trifluorothymidine resistance (thymidine kinase locus). We conclude that the mutated Bcl-xL protein did not affect growth under normal conditions, plating efficiency or spontaneous mutation frequencies at the thymidine kinase (TK) locus. Results at the hypoxanthine phosphoribosyl transferase (HPRT) locus were inconclusive. A mutant fraction for TK6‑Bcl-xL gly-159-ala clone #38 cells exposed to 150cGy of 160kVp x-rays was also calculated. Exposure to x-irradiation increased the mutant fraction of TK6‑Bcl-xL gly-159-ala clone #38 cells.

  10. Why 159°?: a story about the dropping of the Hiroshima atom bomb

    Science.gov (United States)

    Prunty, Sean L.

    2015-04-01

    This paper presents an analysis of the evasive manoeuvre undertaken by the pilot of the Enola Gay aircraft following the dropping of the first uranium bomb. The pilot was instructed to make a 159° turn following the bomb’s release in order to acquire the greatest distance from the point at which the bomb explodes. Accordingly, the objective here is to investigate why the angle should be exactly 159°. The optimum flight-path to maximize the distance from the detonation point is analysed by considering the escape or exit angle taken by the aircraft following a turning-manoeuvre that points it directly away from the detonation site. A range of escape angles are predicted based on the requirement to exit the turning radius prior to detonation. By using information that appeared in a historical account of the event regarding the manoeuvre undertaken by the pilot following the release of the bomb, an estimate is made of the escape angle. Despite the fact that the result shows reasonable agreement with the value of 159°, some uncertainty is expressed as to the close coincidence obtained. In addition, the location of the aircraft and the time of arrival of the shock wave following detonation are also briefly discussed.

  11. Influence of intramolecular f-f interactions on nuclear spin driven quantum tunneling of magnetizations in quadruple-decker phthalocyanine complexes containing two terbium or dysprosium magnetic centers.

    Science.gov (United States)

    Fukuda, Takamitsu; Matsumura, Kazuya; Ishikawa, Naoto

    2013-10-10

    Nuclear spin driven quantum tunneling of magnetization (QTM) phenomena, which arise from admixture of more than two orthogonal electronic spin wave functions through the couplings with those of the nuclear spins, are one of the important magnetic relaxation processes in lanthanide single molecule magnets (SMMs) in the low temperature range. Although recent experimental studies have indicated that the presence of the intramolecular f-f interactions affects their magnetic relaxation processes, little attention has been given to their mechanisms and, to the best of our knowledge, no rational theoretical models have been proposed for the interpretations of how the nuclear spin driven QTMs are influenced by the f-f interactions. Since quadruple-decker phthalocyanine complexes with two terbium or dysprosium ions as the magnetic centers show moderate f-f interactions, these are appropriate to investigate the influence of the f-f interactions on the dynamic magnetic relaxation processes. In the present paper, a theoretical model including ligand field (LF) potentials, hyperfine, nuclear quadrupole, magnetic dipolar, and the Zeeman interactions has been constructed to understand the roles of the nuclear spins for the QTM processes, and the resultant Zeeman plots are obtained. The ac susceptibility measurements of the magnetically diluted quadruple-decker monoterbium and diterbium phthalocyanine complexes, [Tb-Y] and [Tb-Tb], have indicated that the presence of the f-f interactions suppresses the QTMs in the absence of the external magnetic field (H(dc)) being consistent with previous reports. On the contrary, the faster magnetic relaxation processes are observed for [Tb-Tb] than [Tb-Y] at H(dc) = 1000 Oe, clearly demonstrating that the QTMs are rather enhanced in the presence of the external magnetic field. Based on the calculated Zeeman diagrams, these observations can be attributed to the enhanced nuclear spin driven QTMs for [Tb-Tb]. At the H(dc) higher than 2000 Oe, the

  12. HSPC159 promotes proliferation and metastasis via inducing EMT and activating PI3K/Akt pathway in breast cancer.

    Science.gov (United States)

    Zheng, Jie; Zhang, Mengxue; Zhang, Liying; Ding, Xiaodi; Li, Wentong; Lu, Shijun

    2018-05-08

    HSPC159 is a novel human galectin-related protein and has been shown to involved in the carcinogenesis. Little is known about HSPC159 expression and function in breast cancer. Here we showed that HSPC159 was aberrantly expressed in both breast cancer cell lines and tumor tissues and that its expression was associated with poor prognosis of breast cancer patients. Using gain- and loss-of-function methods we found that HSPC159 enhanced breast cancer cells proliferation and metastasis in vitro and in vivo. Mechanistically, HSPC159 was found to induce epithelial-mesenchymal transition (EMT) and F-actin polymerization process of breast cancer cells. Moreover, HSPC159 promoted proliferation, migration and invasion through activating PI3K/Akt signaling pathway in breast cancer. In conclusion, our findings demonstrated that HSPC159 contributed to breast cancer progression via PI3K/Akt pathway and might serve as a potential therapeutic target for the treatment of breast cancer. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  13. SPITZER VIEW OF YOUNG MASSIVE STARS IN THE LARGE MAGELLANIC CLOUD H II COMPLEXES. II. N 159

    International Nuclear Information System (INIS)

    Chen, C.-H. Rosie; Indebetouw, Remy; Chu, You-Hua; Gruendl, Robert A.; Seale, Jonathan P.; Testor, Gerard; Heitsch, Fabian; Meixner, Margaret; Sewilo, Marta

    2010-01-01

    The H II complex N 159 in the Large Magellanic Cloud is used to study massive star formation in different environments, as it contains three giant molecular clouds (GMCs) that have similar sizes and masses but exhibit different intensities of star formation. We identify candidate massive young stellar objects (YSOs) using infrared photometry, and model their spectral energy distributions to constrain mass and evolutionary state. Good fits are obtained for less evolved Type I, I/II, and II sources. Our analysis suggests that there are massive embedded YSOs in N 159B, a maser source, and several ultracompact H II regions. Massive O-type YSOs are found in GMCs N 159-E and N 159-W, which are associated with ionized gas, i.e., where massive stars formed a few Myr ago. The third GMC, N 159-S, has neither O-type YSOs nor evidence of previous massive star formation. This correlation between current and antecedent formation of massive stars suggests that energy feedback is relevant. We present evidence that N 159-W is forming YSOs spontaneously, while collapse in N 159-E may be triggered. Finally, we compare star formation rates determined from YSO counts with those from integrated Hα and 24 μm luminosities and expected from gas surface densities. Detailed dissection of extragalactic GMCs like the one presented here is key to revealing the physics underlying commonly used star formation scaling laws.

  14. MicroRNA159 can act as a switch or tuning microRNA independently of its abundance in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Maria M Alonso-Peral

    Full Text Available The efficacy of gene silencing by plant microRNAs (miRNAs is generally assumed to be predominantly determined by their abundance. In Arabidopsis the highly abundant miRNA, miR159, acts as a molecular "switch" in vegetative tissues completely silencing the expression of two GAMYB-like genes, MYB33 and MYB65. Here, we show that miR159 has a diminished silencing efficacy in the seed. Using reporter gene constructs, we determined that MIR159 and MYB33 are co-transcribed in the aleurone and embryo of germinating seeds. However in contrast to vegetative tissues, MYB33 is not completely silenced. Instead, miR159 appears to shape the spatio-temporal expression pattern of MYB33 during seed germination. Transcript profiling in a time course during seed germination in wild-type and a mir159 mutant in which miR159 is almost absent, revealed that transcript levels of the GAMYB-like genes were similar between these two genotypes during germination, but much higher in the mir159 mutant once germination had completed. This attenuation in the silencing of the GAMYB-like genes was not explained by a decrease in mature miR159 levels, which remained constant at all time points during seed germination. We propose that miR159 acts as a tuner of GAMYB-like levels in Arabidopsis germinating seeds and that the activity of this miRNA is attenuated in the seed compared to vegetative tissues. This implies that the efficacy of miRNA-mediated silencing is not solely determined by miRNA abundance and target transcript levels, but is being determined through additional mechanisms.

  15. In vitro and in vivo studies of gadolinium-159 liposomes in cancer treatment

    International Nuclear Information System (INIS)

    Soares, Daniel Cristian Ferreira

    2011-01-01

    In Brazil, estimates of new cancer cases, valid for the years 2010 and 2011 show that the disease will be responsible for the deaths of about 500,000 people. As an alternative therapy the radiotherapy technique, widely used in treating various types of tumors, act indiscriminate tumoral and healthy cells. Seeking to minimize these effects, nano structured carriers containing radioisotopes, such as liposomes, have been studied with the aim of improving the specificity of action of ionizing radiation, delivering and retaining adequate amounts of radioactive material in tumor cells, leading them to death. In this context, the present study, we prepared liposomes stealth pH-sensitive metal complex containing the radioactive 159 Gd-DTPA-BMA ( 159 Gd-SpHL) aiming to study in vitro and in vivo its effects in cancer treatment. The vesicles showed encapsulation rate of about 20%, average diameter of 100 nm and low release kinetics of radioactivity in biological media. The formulation was characterized through physic-chemical and morphological studies and the results revealed a low polydispersity index and negative Zeta potential. We studied in vitro and in vivo its action against the cells of Ehrlich tumor models and RT2 (rat glioma). The results of in vitro studies showed that the complex has significant radioactive cytotoxicity against the cells of two of the three models studied and that, being encapsulated in liposomes, the cytotoxicity was greatly enhanced. Additionally, we investigated the involvement of caspase-3 protein in Ehrlich and RT2 cell death. The results suggest that the main mechanism involved in the cytotoxic action of radioactive complex is related to apoptosis. The results of in vivo studies showed that liposomes containing 159 Gd-DTPA-BMA accumulated significantly in Ehrlich solid tumor in mice. Aiming to improve this uptake, we prepared pH-sensitive liposomes coated with folate containing the same radioactive complex ( 159 Gd-FTSpHL). The results

  16. Dual-mode T_1 and T_2 magnetic resonance imaging contrast agent based on ultrasmall mixed gadolinium-dysprosium oxide nanoparticles: synthesis, characterization, and in vivo application

    International Nuclear Information System (INIS)

    Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong

    2015-01-01

    A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)

  17. Extraction of Dysprosium Ions with DTPA Functionalized Superparamagnetic Nanoparticles Probed by Energy Dispersive X-ray Fluorescence and TEM/High-Angle Annular Dark Field Imaging.

    Science.gov (United States)

    Melo, Fernando Menegatti de; Almeida, Sabrina da Nobrega; Uezu, Noemi Saori; Ramirez, Carlos Alberto Ospina; Santos, Antonio Domingues Dos; Toma, Henrique Eisi

    2018-06-01

    The extraction of dysprosium (Dy3+) ions from aqueous solution was carried out successfully, using magnetite (Fe3O4) nanoparticles functionalized with diethylenetriaminepentaacetic acid (MagNP@DTPA). The process was monitored by energy dispersive X-ray fluorescence spectroscopy, as a function of concentration, proceeding according to a Langmuir isotherm with an equilibrium constant of 2.57 × 10-3 g(MagNP) L-1 and a saturation limit of 63.2 mgDy/gMagNP. The presence of paramagnetic Dy3+ ions attached to the superparamagnetic nanoparticles led to an overall decrease of magnetization. By imaging the nanoparticles surface using scanning transmission electron microscopy equipped with high resolution elemental analysis, it was possible to probe the binding of the Dy3+ ions to DTPA, and to show their distribution in a region of negative magnetic field gradients. This finding is coherent with the observed decrease of magnetization, associated with the antiferromagnetic coupling between the lanthanide ions and the Fe3O4 core.

  18. Fractional momentum transfer in incomplete fusion reaction: measurement of recoil range distributions in 20Ne + 159Tb system

    International Nuclear Information System (INIS)

    Ali, R.; Singh, D.; Pachouri, Dipti; Afzal Ansari, M.; Rashid, M.H.

    2007-01-01

    The recoil range distribution (RRD) of several residues have been measured for the system 20 Ne + 159 Tb at 165 MeV beam energy by collecting the recoiling residues in the Al-catcher foils of varying thickness

  19. Tratamento artroscópico da instabilidade anterior do ombro: estudo retrospectivo de 159 casos Anterior instability of the shoulder: retrospective study on 159 cases

    Directory of Open Access Journals (Sweden)

    Arnaldo Amado Ferreira Neto

    2011-01-01

    Full Text Available OBJETIVO: Análise dos resultados de 159 pacientes com instabilidade anterior do ombro submetidos ao tratamento artroscópico de janeiro de 2001 a dezembro de 2005. MÉTODOS: Estudo retrospectivo de prontuários com dados completos. RESULTADOS: Em 108 pacientes notou-se a lesão de Bankart e em 62 pacientes a lesão do tipo SLAP estava presente. Utilizou-se em média 2,7 âncoras. Apresentaram complicações 42 casos; 14 tinham dor aos esforços, 12 tinham algum grau de diminuição da rotação externa, 16 apresentaram recidiva. Os pacientes que evoluíram com complicações utilizaram em média 2,5 âncoras, enquanto naqueles sem complicações a média foi de 2,8 (pOBJECTIVE: To analyze the results of 159 patients with anterior instability of the shoulder submitted to arthroscopic treatment from January 2001 to December 2005. METHODS: Retrospective study of complete patient records. RESULTS: In 108 patients the Bankart lesion was found, while in 62 patients, SLAP type lesions were found. An average of 2.7 anchors was used. 42 cases presented complications; 14 had pain on effort, 12 had some degree of reduction of external rotation, and 16 had recorrence. The patients who developed complications used an average of 2.5 anchors, while those without complications used an average of 2.8 anchors (p<0.05. Of the 35 patients with anterior glenoid bone lesion, 8 had recorrence, while of the 124 patients without fractures, 8 had recorrence (p<0.05. Of the 113 patients with first-time traumatic dislocations, 12 developed limitation of external rotation, while in 46 atraumatic cases none developed limitation (p<0.05. Of the patients with SLAP lesion, 11 developed pain, while in the cases without this lesion, only 3 presented pain (p<0.05. CONCLUSION: There were more recurrences (deveria ser plural e recurrences, nao recurrence in cases of anterior glenoid bone lesion. Post-operative pain was more frequent when the lesion type was SLAP. Limitation of

  20. Silica nanoparticles containing 159-Gadolinium as potential system for cancer treatment

    International Nuclear Information System (INIS)

    Oliveira, Andre Felipe de; Ferreira, Tiago Hilario; Sousa, Edesia Martins Barros de; Lacerda, Marco Aurelio

    2013-01-01

    Ordered silica nanoparticles are compounds highly organized which have very interesting textural characteristics, such as high thermal stability, well defined pore size, narrow size distribution and high area surface. Among the various types of nano materials ordered, the SBA-16 have a meso structure that can be considered very interesting due to the fact of the arrangement of mesoporous (tri dimensional as a cage) and spherical morphology, which make it in a promising material for a range of bioapplications such as incorporation of drugs and radioisotopes. In this study Gadodiamide® (Omniscan-General Electric Healthcare Company), a frequently non-ionic gadolinium complex contrasting used in MRI's was incorporated in the silica matrix SBA-16 as a carrier. From this gadolinium it is possible to obtain the isotope 159 Gd by neutron irradiation, wherein the isotope 158 Gd captures a neutron and becomes 159 Gd [ 15 '8Gd(n,c) 1 '5 9 Gd]. The 159 Gd is a beta (endpoint energy of 970.6 keV) and gamma (main energy: 363.54 keV) emitter with a half-life of 18.59 hours. These characteristics are similar to that of other isotopes already used in nuclear medicine such as 90 Y. In this work, the 158 Gd incorporated in the Gd-silica was activated by the neutron flux generated by the cyclotron located in the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) during the production of the 18 FDG. Atomic emission spectroscopy (ICP-AES) and infrared spectroscopy (FTIR) were used to confirm the presence of the gadolinium complex in the silica matrix. The antitumor activity of the complex after the irradiation was evaluated through cytotoxicity assay with T98 cell lines derived from a human glioblastoma multiform tumor. (author)

  1. Study of Quasielastic scattering for 7Li+159Tb at around- barrier energies

    Directory of Open Access Journals (Sweden)

    Mukherjee A.

    2017-01-01

    Full Text Available Quasielastic scattering cross sections for the reaction 7Li+159Tb have been measured at large backangles, at energies around the Coulomb barrier. The quasielastic barrier distribution has been extracted from the measured quasielastic scattering excitation function, including and excluding α particle contribution. The peak of the quasielastic barrier distribution including α particle contribution shows a shift towards higher energy compared to the peak of the distribution without α particles. The quasielastic barrier distribution when compared to the calculated fusion barrier distribution, appears to show reasonable agreement for the system.

  2. Incomplete fusion reactions in 16O+159Tb system: Spin distribution measurements

    Directory of Open Access Journals (Sweden)

    Sharma Vijay R.

    2015-01-01

    Full Text Available In order to explore the reaction modes on the basis of their entry state spin population, an experiment has been done by employing particle-γ coincidence technique carried out at the Inter University Accelerator Centre, New Delhi. The preliminary analysis conclusively demonstrates, spin distribution for some reaction products populated via complete and/or incomplete fusion of 16O with 159Tb system found to be distinctly different. Further, the existence of incomplete fusion at low bombarding energies indicates the possibility to populate high spin states.

  3. Die verwysing van hupèr eléous in Romeine 15:9

    Directory of Open Access Journals (Sweden)

    E. Engelbrecht

    1986-01-01

    Full Text Available The reference of hupèr eléous in Romans 15:9 The question of how hupèr eléous is to be understood in Romans 15:9 is answered with two presuppositions in mind. The letter to the Romans is understood as a paranetic reminder which culminates in 15:7-13. Furthermore it is argued that the context of this passage is the letter itself rather than a Pauline theology. The microstructure of the term is investigated to determine the resiprocal interrelationship between the term and its immediate neighbourhood. These results are used to control the presuppositions relating to the macro-context. The term hupèr eléous functions within the idea that Christ's acceptance of the congregation is coordinated by God's truthfulness towards Israel and his mercy towards the gentiles. This mercy of God is a new and surprising act of God, but since this mercy of God is Christ's acceptance of the gentiles, it is related to God's truthfulness to Israel which was manifested in Christ's confirmation of the promises given to the patriarchs. This has implications for the interrelationship between the church and the Jews.

  4. Study of the 14N + 159Tb reaction between 6 and 22 MeV/u

    International Nuclear Information System (INIS)

    Balster, G.J.

    1987-01-01

    The main topic of this thesis is the study of the dynamics of asymmetric nucleus-nucleus collisions from low to intermediate energies by concentrating on one specific reaction, 14 N+ 159 Tb. The main experimental techniques involved are inclusive measurements and measurements of coincidences between particles and KX-rays. Additional experiments that were performed to support this study are also discussed. Results from measurements of target KX-ray production cross sections for heavy ion beams at energies above the Coulomb barrier are presented. It is shown that these cross sections can be accurately calculated and hence that the measurement of target KX-rays can serve as a convenient way of normalizing the particle-KX-ray coincidence data. Results from inclusive measurements of 92 MeV 14 N induced reactions on different targets are employed to investigate the reaction systematics at low energies. The systematic study of the 14 N+ 159 Tb reaction between 6 and 22 MeV/u via inclusive measurements and the measurement of particle-KX-ray coincidences is then presented. (Auth.)

  5. Global use structures of the magnetic materials neodymium and dysprosium. A scenario-based analysis of the effect of the diffusion of electromobility on the demand for rare earths; Globale Verwendungsstrukturen der Magnetwerkstoffe Neodym und Dysprosium. Eine szenariobasierte Analyse der Auswirkung der Diffusion der Elektromobilitaet auf den Bedarf an Seltenen Erden

    Energy Technology Data Exchange (ETDEWEB)

    Gloeser-Chahoud, Simon; Kuehn, Andre; Tercero Espinoza, Luis

    2016-06-15

    Neodymium-iron-boron magnets (NdFeB) have experienced a significant demand as the most powerful permanent magnet in recent years, especially for the manufacture of compact electric servomotors with high efficiency and high power density, especially for mobile applications in hybrid traction motors and electric vehicles or for electric bikes. However, NdFeB magnets are also increasingly being used in general mechanical engineering (conveying and pumping systems, tools, air conditioning systems, lift motors, etc.), in the small electric motors of conventional passenger cars or in the generators of large wind power plants with permanent magnetic direct drive. Nevertheless, there is still high uncertainty in the use structures of NdFeB magnets and the contained rare earth elements neodymium and dysprosium. An effective instrument for increasing the market transparency and the understanding of complex anthropogenic material cycles is the dynamic material flow modeling. In the present work paper, this instrument is used for an in-depth analysis of the use structures of NdFeB magnets and the contained rare earths on a global scale. The dynamic modeling of product usage cycles reveals today's usage structures and quantifies future magnetic quantities in obsolete product flows. It could be shown that the magnets in today's scrap volume are mainly contained in obsolete electronics applications such as hard disks (HDD), CD and DVD drives, which makes the recycling hardly seem to be economical due to the small magnets and the high material spread, but in the foreseeable future with larger magnetic quantities from synchronous servomotors and generators can be expected, which significantly increases the recycling potential. In a further step, the effect of the diffusion of alternative drives in the automotive market on the dysprosium requirement is analyzed using a system dynamics model and possible adaptation mechanisms in the form of different substitution effects in

  6. Probing the limit of nuclear existence: Proton emission from 159Re

    International Nuclear Information System (INIS)

    Joss, D.T.; Darby, I.G.; Page, R.D.; Uusitalo, J.; Eeckhaudt, S.; Grahn, T.; Greenlees, P.T.; Jones, P.M.; Julin, R.; Juutinen, S.; Ketelhut, S.; Leino, M.; Leppaenen, A.-P.; Nyman, M.; Pakarinen, J.; Rahkila, P.; Saren, J.; Scholey, C.; Steer, A.; Cannon, A.J.; Stevenson, P.D.; Al-Khalili, J.S.; Ertuerk, S.; Venhart, M.; Gall, B.; Hadinia, B.; Simpson, J.

    2006-01-01

    The observation of the new nuclide 159 75 Re 84 provides important insights into the evolution of single-particle structure and the mass surface in heavy nuclei beyond the proton drip line. This nuclide, 26 neutrons away from the nearest stable rhenium isotope, was synthesised in the reaction 106 Cd( 58 Ni, p4n) and identified via its proton radioactivity using the ritu gas-filled separator and the great focal-plane spectrometer. Comparisons of the measured proton energy (E p =1805+/-20 keV) and decay half-life (t 1/2 =21+/-4 μs) with values calculated using the WKB method indicate that the proton is emitted from an h 11/2 state. The implications of these results for future experimental investigations into even more proton unbound nuclei using in-flight separation techniques are considered

  7. Genomewide Identification of Essential Genes and Fitness Determinants of Streptococcus mutans UA159

    Science.gov (United States)

    Zeng, Lin; Culp, David J.

    2018-01-01

    ABSTRACT Transposon mutagenesis coupled with next-generation DNA sequencing (Tn-seq) is a powerful tool for discovering regions of the genome that are required for the survival of bacteria in different environments. We adapted this technique to the dental caries pathogen Streptococcus mutans UA159 and identified 11% of the genome as essential, with many genes encoding products required for replication, translation, lipid metabolism, and cell wall biogenesis. Comparison of the essential genome of S. mutans UA159 with those of selected other streptococci for which such information is available revealed several metabolic pathways and genes that are required in S. mutans, but not in some Streptococcus spp. We further identified genes that are essential for sustained growth in rich or defined medium, as well as for persistence in vivo in a rodent model of oral infection. Collectively, our results provide a novel and comprehensive view of the genes required for essential processes of S. mutans, many of which could represent potential targets for therapeutics. IMPORTANCE Tooth decay (dental caries) is a common cause of pain, impaired quality of life, and tooth loss in children and adults. It begins because of a compositional change in the microorganisms that colonize the tooth surface driven by repeated and sustained carbohydrate intake. Although several bacterial species are associated with tooth decay, Streptococcus mutans is the most common cause. Therefore, it is important to identify biological processes that contribute to the survival of S. mutans in the human mouth, with the aim of disrupting the processes with antimicrobial agents. We successfully applied Tn-seq to S. mutans, discovering genes that are required for survival, growth, and persistence, both in laboratory environments and in a mouse model of tooth decay. This work highlights new avenues for the control of an important human pathogen. PMID:29435491

  8. The influence of ICRF-159 and levamisole on the incidence of metastases following local irradiation of a solid tumor

    Energy Technology Data Exchange (ETDEWEB)

    Baker, D.; Constable, W.; Elkon, D.; Rinehart, L.

    1981-11-15

    Courses of irradiation consisting of 6000 rad in ten equal fractions over 12 days delivered to KHT sarcomas in mice controlled 55% of the local tumors but 83% of the mice died from metastases. Three strategies to reduce the risk of metastatic spread were tested. The fractionation scheme was changed to deliver the same total dose using a large initial fraction followed by seven equal portions with the same overall time. ICRF-159 was used with the intention of partially synchronizing the tumor growth fraction in a radiosensitive state of the growth cycle and of promoting normalization of the tumor vasculature. Levamisole was used to stimulate the immune system. The combination of ICRF-159 with the eight-fraction radiation course proved to be effective for both increasing local control and decreasing the incidence of metastases. The addition of levamisole did not improve the results obtained with a combination of ICRF-159 and irradiation.

  9. Influence of ICRF-159 and levamisole on the incidence of metastases following local irradiation of a solid tumor

    Energy Technology Data Exchange (ETDEWEB)

    Baker, D.; Constable, W.; Elkon, D.; Rinehart, L.

    1981-11-15

    Courses of irradiation consisting of 6000 rad in ten equal fractions over 12 days delivered to KHT sarcomas in mice controlled 55% of the local tumors but 83% of the mice died from metastases. Three strategies to reduce the risk of metastatic spread were tested. The fractionation scheme was changed to deliver the same total dose using a large initial fraction followed by seven equal portions with the same overall time. ICRF-159 was used with the intention of partially synchronizing the tumor growth fraction in a radiosensitive state of the growth cycle and of promoting normalization of the tumor vasculature. Levamisole was used to stimulate the immune system. The combination of ICRF-159 with the eight-fraction radiation course proved to be effective for both increasing local control and decreasing the incidence of metastases. The addition of levamisole did not improve the results obtained with a combination of ICRF-159 and irradiation.

  10. Synthesis and characterization of a family of structurally characterized dysprosium alkoxides for improved fatigue-resistance characteristics of PDyZT thin films.

    Science.gov (United States)

    Boyle, Timothy J; Bunge, Scott D; Clem, Paul G; Richardson, Jacob; Dawley, Jeffrey T; Ottley, Leigh Anna M; Rodriguez, Mark A; Tuttle, Bruce A; Avilucea, Gabriel R; Tissot, Ralph G

    2005-03-07

    Using either an ammoniacal route, the reaction between DyCl3, Na0, and HOR in liquid ammonia, or preferentially reacting Dy(N(SiMe3)2)3 with HOR in a solvent, we isolated a family of dysprosium alkoxides as [Dy(mu-ONep)2(ONep)]4 (1), (ONep)2Dy[(mu3-ONep)(mu-ONep)Dy(ONep)(THF)]2(mu-ONep) (2), (ONep)2Dy[(mu3-ONep)(mu-ONep)Dy(ONep)(py)]2(mu-ONep) (3), [Dy3(mu3-OBut)2(mu-OBut3(OBut)4(HOBut)2] (4), [Dy3(mu3-OBut)2(mu-OBut)3(OBut)4(THF)2] (5), [Dy3(mu3-OBut)2(mu-OBut)3(OBut)4(py)2] (6), (DMP)Dy(mu-DMP)4[Dy(DMP)2(NH3)]2 (7), [Dy(eta6-DMP)(DMP)2]2 (8), Dy(DMP)3(THF)3 (9), Dy(DMP)3(py)3 (10), Dy(DIP)3(NH3)2 (11), [Dy(eta6-DIP)(DIP)2]2 (12), Dy(DIP)3(THF)2 (13), Dy(DIP)3(py)3 (14), Dy(DBP)3(NH3) (15), Dy(DBP)3 (16), Dy(DBP)3(THF) (17), Dy(DBP)3(py)2 (18), [Dy(mu-TPS)(TPS2]2 (19), Dy(TPS)3(THF)3 (20), and Dy(TPS)3(py)3 (21), where ONep = OCH2CMe3, OBut) = OCMe3, DMP = OC6H3(Me)(2)-2,6, DIP = OC6H3(CHMe2)(2)-2,6, DBP = OC6H3(CMe3)(2)-2,6, TPS = OSi(C6H5)3, tol = toluene, THF = tetrahydrofuran, and py = pyridine. We were not able to obtain X-ray quality crystals of compounds 2, 8, and 9. The structures observed and data collected for the Dy compounds are consistent with those reported for its other congeners. A number of these precursors were used as Dy dopants in Pb(Zr0.3Ti0.7)O3 (PZT 30/70) thin films, with compound 12 yielding the highest-quality films. The resulting Pb0.94Dy0.04(Zr0.3Ti0.7)O3 [PDyZT (4/30/70)] had similar properties to PZT (30/70), but showed substantial resistance to polarization reversal fatigue.

  11. The role of dysprosium on the structural and magnetic properties of (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles

    International Nuclear Information System (INIS)

    Rahimi, Hamed; Ghasemi, Ali; Mozaffarinia, Reza; Tavoosi, Majid

    2017-01-01

    In current work, Nd2Fe14B nanoparticles was synthesized by sol-gel method. Dysprosium powders were added into Nd2Fe14B nanoparticles by mechanical alloying process in order to enhancement of coercivity. The phase analysis, structure, and magnetic properties of annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles with different Dy-content (x=0.1, 0.2, 0.3, 0.4, 0.5, 0.6) were investigated by employing X-ray diffraction, X-ray photoelectron spectroscopy, energy dispersive spectroscopy, field emission scanning electron microscope, transmission electron microscope and vibrating sample magnetometer techniques. The results showed that with an increase in Dy amounts, the coercivity of particles increased from 2.9 kOe to 13.4 kOe and then decreased to 5.6 kOe. By adding an optimum amount of Dy (x=0.4), the coercivity was significantly increased from 2.9 kOe to 13.4 kOe. The average particle size of annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles was below 10 nm. Magnetization reversal studies indicate that the coercivity of milled and annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles is controlled by the nucleation of reversed magnetic domains. The experimental results in the angular dependence of coercivity for (Nd_1_−_xDy_x)_2Fe_1_4B permanent magnets showed that the normalized coercivity of the permanent magnets H_c(θ)/H_c(0) increases from 1 to about 1.2–1.5 with increasing θ from 0 to about π/3, for x=0.4–0.6. - Highlights: • Dy was added to Nd_2Fe_1_4B nanoparticles to improve the coercivity. • A maximum squareness ratio of 0.99 was obtained. • The average particle size decreased with an increase in Dy-content.

  12. Defense Language Institute Russian Basic Course. Volumes XXVIII, Lessons 131-140. Volume XXX, Lessons 151-159.

    Science.gov (United States)

    Defense Language Inst., Washington, DC.

    The 19 lessons in these two volumes are intended for the advanced phase of a 159-lesson intensive audiolingual basic Russian course developed recently by the Defense Language Institute to train native speakers of English to a Level 3 second language proficiency. These third and fifth volumes contain such features as (1) texts on the Russian Civil…

  13. Measured thermal and fast neutron fluence rates for ATF-1 holders during ATR cycle 158B/159A

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Larry Don [Idaho National Lab. (INL), Idaho Falls, ID (United States); Miller, David Torbet [Idaho National Lab. (INL), Idaho Falls, ID (United States); Walker, Billy Justin [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-11-01

    This report contains the thermal (2200 m/s) and fast (E>1MeV) neutron fluence rate data for the ATF-1 holders located in core for ATR Cycle 158B/159A which were measured by the Radiation Measurements Laboratory (RML).

  14. 10-GHz 1.59-μm quantum dash passively mode-locked two-section lasers

    DEFF Research Database (Denmark)

    Dontabactouny, Madhoussoudhana; Rosenberg, C.; Semenova, Elizaveta

    2010-01-01

    This paper reports the fabrication and the characterisation of a 10 GHz two-section passively mode-locked quantum dash laser emitting at 1.59 μm. The potential of the device's mode-locking is investigated through an analytical model taking into account both the material parameters and the laser...

  15. Characteristics of Korean Alcoholic Beverages Produced by Using Rice Nuruks Containing Aspergillus oryzae N159-1.

    Science.gov (United States)

    Kim, Hye Ryun; Lee, Ae Ran; Kim, Jae-Ho

    2017-06-01

    Herein, nuruks derived from non-glutinous and glutinous rice inoculated with Aspergillus oryzae N159-1 (having high alpha-amylase and beta-glucosidase activities) were used to produce Korean alcoholic beverages. The resultant beverages had enhanced fruity (ethyl caproate and isoamyl alcohol) and rose (2-phenethyl acetate and phenethyl alcohol) flavors and high taste scores.

  16. Characteristics of Korean Alcoholic Beverages Produced by Using Rice Nuruks Containing Aspergillus oryzae N159-1

    OpenAIRE

    Kim, Hye Ryun; Lee, Ae Ran; Kim, Jae-Ho

    2017-01-01

    Herein, nuruks derived from non-glutinous and glutinous rice inoculated with Aspergillus oryzae N159-1 (having high alpha-amylase and beta-glucosidase activities) were used to produce Korean alcoholic beverages. The resultant beverages had enhanced fruity (ethyl caproate and isoamyl alcohol) and rose (2-phenethyl acetate and phenethyl alcohol) flavors and high taste scores.

  17. 17 CFR 1.59 - Activities of self-regulatory organization employees, governing board members, committee members...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Activities of self-regulatory... COMMODITY EXCHANGE ACT Miscellaneous § 1.59 Activities of self-regulatory organization employees, governing...) Self-regulatory organization means “self-regulatory organization,” as defined in Commission regulation...

  18. Insights into the 1.59-Mbp largest plasmid of Azospirillum brasilense CBG497.

    Science.gov (United States)

    Acosta-Cruz, Erika; Wisniewski-Dyé, Florence; Rouy, Zoé; Barbe, Valérie; Valdés, María; Mavingui, Patrick

    2012-09-01

    The plant growth-promoting proteobacterium Azospirillum brasilense enhances growth of many economically important crops, such as wheat, maize, and rice. The sequencing and annotation of the 1.59-Mbp replicon of A. brasilense CBG497, a strain isolated from a maize rhizosphere grown on an alkaline soil in the northeast of Mexico, revealed a GC content of 68.7 % and the presence of 1,430 potential protein-encoding genes, 1,147 of them classified into clusters of orthologous groups categories, and 16 tRNA genes representing 11 tRNA species. The presence of sixty-two genes representatives of the minimal gene set and chromid core genes suggests its importance in bacterial survival. The phaAB → G operon, reported as involved in the bacterial adaptation to alkaline pH in the presence of K(+), was also found on this replicon and detected in several Azospirillum strains. Phylogenetic analysis suggests that it was laterally acquired. We were not able to show its inference on the adaptation to basic pH, giving a hint about the presence of an alternative system for adaptation to alkaline pH.

  19. Global use structures of the magnetic materials neodymium and dysprosium. A scenario-based analysis of the effect of the diffusion of electromobility on the demand for rare earths

    International Nuclear Information System (INIS)

    Gloeser-Chahoud, Simon; Kuehn, Andre; Tercero Espinoza, Luis

    2016-01-01

    Neodymium-iron-boron magnets (NdFeB) have experienced a significant demand as the most powerful permanent magnet in recent years, especially for the manufacture of compact electric servomotors with high efficiency and high power density, especially for mobile applications in hybrid traction motors and electric vehicles or for electric bikes. However, NdFeB magnets are also increasingly being used in general mechanical engineering (conveying and pumping systems, tools, air conditioning systems, lift motors, etc.), in the small electric motors of conventional passenger cars or in the generators of large wind power plants with permanent magnetic direct drive. Nevertheless, there is still high uncertainty in the use structures of NdFeB magnets and the contained rare earth elements neodymium and dysprosium. An effective instrument for increasing the market transparency and the understanding of complex anthropogenic material cycles is the dynamic material flow modeling. In the present work paper, this instrument is used for an in-depth analysis of the use structures of NdFeB magnets and the contained rare earths on a global scale. The dynamic modeling of product usage cycles reveals today's usage structures and quantifies future magnetic quantities in obsolete product flows. It could be shown that the magnets in today's scrap volume are mainly contained in obsolete electronics applications such as hard disks (HDD), CD and DVD drives, which makes the recycling hardly seem to be economical due to the small magnets and the high material spread, but in the foreseeable future with larger magnetic quantities from synchronous servomotors and generators can be expected, which significantly increases the recycling potential. In a further step, the effect of the diffusion of alternative drives in the automotive market on the dysprosium requirement is analyzed using a system dynamics model and possible adaptation mechanisms in the form of different substitution effects in the

  20. Studies on an (S)-2-amino-3-(3-hydroxy-5-methyl-4-isoxazolyl)propionic acid (AMPA) receptor antagonist IKM-159

    DEFF Research Database (Denmark)

    Juknaite, Lina; Sugamata, Yutaro; Tokiwa, Kazuya

    2013-01-01

    IKM-159 was developed and identified as a member of a new class of heterotricyclic glutamate analogs that act as AMPA receptor-selective antagonists. However, it was not known which enantiomer of IKM-159 was responsible for its pharmacological activities. Here, we report in vivo and in vitro neur...

  1. Dysprosium doping induced shape and magnetic anisotropy of Fe{sub 3−x}Dy{sub x}O{sub 4} (x=0.01–0.1) nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Jain, Richa [School of Sciences, Indira Gandhi National Open University, Maidan Garhi, New Delhi 110068 (India); Department of Physics, ARSD college, University of Delhi, New Delhi 110021 (India); Luthra, Vandna [Department of Physics, Gargi College, Siri Fort Road, New Delhi 110049 (India); Gokhale, Shubha, E-mail: sgokhale@ignou.ac.in [School of Sciences, Indira Gandhi National Open University, Maidan Garhi, New Delhi 110068 (India)

    2016-09-15

    The effect of dysprosium doping on evolution of structural and magnetic properties of magnetite (Fe{sub 3}O{sub 4}) nanoparticles is reported. A standard route of co-precipitation was used for the synthesis of undoped and doped magnetite nanoparticles Fe{sub 3−x}Dy{sub x}O{sub 4} (x=0.0–0.1). Transmission electron microscopy (TEM) shows formation of round shaped particles with diameter in the range of 8–14 nm for undoped sample. On doping beyond x=0.01, the formation of rod like structures is initiated along with the round shaped particles. The number of rods is found to increase with increasing doping concentration. Magnetic characterization using Vibrating Sample Magnetometer (VSM) revealed doping dependent magnetic properties which can be correlated with the crystallite size as determined from X-ray diffraction (XRD). Enhancement in the saturation magnetization in the initial stages of doping can be explained on the basis of incorporation of Dy{sup 3+} ions in the inverse spinel structure at the octahedral site in place of Fe{sup 3+} ions. Subsequent decrease in saturation magnetization observed beyond x=0.03 could be attributed to precipitation of excess Dy in form of dysprosium ferrite phase. - Highlights: • Report on formation of nanorods in magnetite prompted by Dy doping. • Observation of anisotropic magnetic behaviour emanating from the shape anisotropy. • Evidence of Dy{sup 3+} ions occupying octahedral site in place of Fe{sup 3+} ions. • Nanorods envisaged to be useful as catalysts and in biomedical applications.

  2. Complete and incomplete fusion dynamics of {sup 6,7}Li + {sup 159}Tb reactions near the Coulomb barrier

    Energy Technology Data Exchange (ETDEWEB)

    Gautam, Manjeet Singh [Thapar University, School of Physics and Materials Science, Patiala (India); Indus Degree College, Department of Physics, Kinana, Jind, Haryana (India); Grover, Neha; Sharma, Manoj K. [Thapar University, School of Physics and Materials Science, Patiala (India)

    2017-01-15

    The complete fusion (CF) and incomplete fusion (ICF) cross-sections are estimated for {sup 6,} {sup 7}Li + {sup 159}Tb reactions using the energy-dependent Woods-Saxon potential model (EDWSP model) and dynamical cluster-decay model (DCM). The CF data of the {sup 6}Li + {sup 159}Tb({sup 7}Li + {sup 159}Tb) reaction at above barrier energies is suppressed with reference to expectations of the EDWSP model by 25% (20%) which is smaller than the reported data by ∝ 9% (6%). This suppression is correlated with the projectile breakup effect. The projectiles {sup 6,7}Li are loosely bound systems, which may break up into charged fragments prior to reaching the fusion barrier and subsequently one of the fragment is captured by the target leading to the suppression of fusion data at above barrier energies. The sum of CF and ICF, which is termed as total fusion cross-section (TF), removes the discrepancies between theoretical predictions and the above barrier complete fusion data and hence is adequately explained via the EDWSP model over a wide range of energy spread across the Coulomb barrier. In addition to fusion, the decay mechanism of {sup 6}Li + {sup 159}Tb reaction is studied within the framework of the dynamical cluster-decay model (DCM). The breakup of the projectile ({sup 6}Li) in the entrance channel indicates the presence of ICF, which is investigated further using the collective clusterization approach of DCM. The present theoretical analysis suggests that a larger barrier modification is needed to address the fusion data of chosen reactions in the below barrier energy region. (orig.)

  3. Dysprosium selective potentiometric membrane sensor

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of); Faridbod, Farnoush; Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2013-03-01

    A novel Dy(III) ion-selective PVC membrane sensor was made using a new synthesized organic compound, 3,4-diamino-N Prime -((pyridin-2-yl)methylene)benzohydrazide (L) as an excellent sensing element. The electrode showed a Nernstian slope of 19.8 {+-} 0.6 mV per decade in a wide concentration range of 1.0 Multiplication-Sign 10{sup -6}-1.0 Multiplication-Sign 10{sup -2} mol L{sup -1}, a detection limit of 5.5 Multiplication-Sign 10{sup -7} mol L{sup -1}, a short conditioning time, a fast response time (< 10 s), and high selectivity towards Dy(III) ion in contrast to other cations. The proposed sensor was successfully used as an indicator electrode in the potentiometric titration of Dy(III) ions with EDTA. The membrane sensor was also applied to the F{sup -} ion indirect determination of some mouth washing solutions and to the Dy{sup 3+} determination in binary mixtures. Highlights: Black-Right-Pointing-Pointer The novelty of this work is based on the high affinity of the ionophore toward the Dy{sup 3+} ions. Black-Right-Pointing-Pointer This technique is very simple, fast and inexpensive and it is not necessary to use sophisticated equipment. Black-Right-Pointing-Pointer The newly developed sensor is superior to the formerly reported Dy{sup 3+} sensors in terms of selectivity.

  4. CD14-159C/T polymorphism in the development of delayed skin hypersensitivity to tuberculin.

    Directory of Open Access Journals (Sweden)

    Magdalena Druszczynska

    Full Text Available The skin tuberculin test (TST, an example of a delayed-type hypersensitivity (DTH reaction, is based on measuring the extent of skin induration to mycobacterial tuberculin (PPD. Little is known about the genetic basis of TST reactivity, widely used for diagnosing TB infection. The study investigated the relationship of the single base change polymorphic variants in CD14 gene (CD14(-159C/T with the development of DTH to PPD in BCG-vaccinated Polish Caucasian individuals. We found persistent lack of TST reactivity in about 40% of healthy subjects despite receiving more than one dose of BCG. The TST size was negatively correlated with the number of BCG inoculations. The distribution of C/T genotype was significantly more frequent among TST-negative compared with TST-positive individuals. The concentration of serum sCD14 was positively associated with mCD14 expression, but not with the TST status or CD14(-159C/T polymorphism. A significant increase in mCD14 expression and serum sCD14 levels was found in TB group. We hypothesize that CD14(-159C/T polymorphic variants might be one of genetic components in the response to attenuated M. bovis BCG bacilli.

  5. Tandem duplications of a degenerated GTP-binding domain at the origin of GTPase receptors Toc159 and thylakoidal SRP

    International Nuclear Information System (INIS)

    Hernandez Torres, Jorge; Maldonado, Monica Alexandra Arias; Chomilier, Jacques

    2007-01-01

    The evolutionary origin of some nuclear encoded proteins that translocate proteins across the chloroplast envelope remains unknown. Therefore, sequences of GTPase proteins constituting the Arabidopsis thaliana translocon at the outer membrane of chloroplast (atToc) complexes were analyzed by means of HCA. In particular, atToc159 and related proteins (atToc132, atToc120, and atToc90) do not have proven homologues of prokaryotic or eukaryotic ancestry. We established that the three domains commonly referred to as A, G, and M originate from the GTPase G domain, tandemly repeated, and probably evolving toward an unstructured conformation in the case of the A domain. It resulted from this study a putative common ancestor for these proteins and a new domain definition, in particular the splitting of A into three domains (A1, A2, and A3), has been proposed. The family of Toc159, previously containing A. thaliana and Pisum sativum, has been extended to Medicago truncatula and Populus trichocarpa and it has been revised for Oryza sativa. They have also been compared to GTPase subunits involved in the cpSRP system. A distant homology has been revealed among Toc and cpSRP GTP-hydrolyzing proteins of A. thaliana, and repetitions of a GTPase domain were also found in cpSRP protein receptors, by means of HCA analysis

  6. E1-E2 interference in /sup 159/Tb(γ,n) and /sup 209/Bi(γ,n) reactions

    International Nuclear Information System (INIS)

    Birenbaum, Y.; Berant, Z.; Kahane, S.; Moreh, R.; Wolf, A.

    1986-01-01

    Angular distributions of fast neutrons from the (γ,n) reactions on /sup 159/Tb and /sup 209/Bi were measured. Gamma sources in the 7--11.4 MeV range were obtained from (n,γ) reactions using thermal neu- trons. Pronounced asymmetries around 90 0 were observed for the angular distributions of photoneu- trons leading to the ground and a few excited states, in both the spherical /sup 209/Bi and the deformed /sup 159/Tb nuclei. These asymmetries indicate strong and similar E1-E2 interference effects in the two nuclei. The direct-semidirect model was modified to be used for target nuclei with one proton outside an even-even core. From a detailed comparison of the data with calculations using the modified direct-semidirect model, the contributions of different partial waves are estimated. Contributions of the compound nucleus process are included, and are shown to affect to some extent the calculated angular distribution's energy dependence

  7. Adherence to oral rehydration therapy among in-patient children aged 1-59 months with some or no dehydration.

    Science.gov (United States)

    Migowa, A N; Gatinu, B; Nduati, R W

    2010-04-01

    To determine adherence to oral rehydration solution (ORS) among in-patients aged 1-59 months suffering from gastroenteritis and having some dehydration (SD) or no dehydration (ND) in two rural hospitals in Kenya. Children aged 1-59 months suffering from acute gastroenteritis with (SD) or (ND) were enrolled into the study, examined and medical records reviewed. On the second and third day of follow up, children were re-examined to ascertain hydration status and care-takers interviewed. Ninety-nine children were enrolled. Forty-five (75%) of the 60 children with SD received a correct prescription for ORS but only 12 (20%) received the correct amount. Among the 39 children with ND, 23 (59%) received a correct prescription for ORS, however only 16 (41%) received the correct amount. On the 3rd day, 9 (15%) of the 60 children with SD at baseline and 2 (5%) of the 39 with ND were classified as having SD. Four in five children with SD and 6 in 10 children with ND fail to receive the correct amounts of ORS.

  8. VizieR Online Data Catalog: NIR polarimetric study in the LMC N159/N160 field (Kim+, 2017)

    Science.gov (United States)

    Kim, J.; Jeong, W.-S.; Pyo, J.; Pak, S.; Park, W.-K.; Kwon, J.; Tamura, M.

    2018-04-01

    Simultaneous JHKs polarimetric observations of the N159/N160 c were performed on 2007 February 3 and 5. We used the near-infrared camera SIRIUS (Nagayama et al. 2003SPIE.4841..459N) and the polarimeter SIRPOL (Kandori et al. 2006SPIE.6269E..51K) of the Infrared Survey Facility (IRSF) 1.4 m telescope at the South African Astronomical Observatory in Sutherland, South Africa. The camera has a field of view of 7.7"x7.7" and a pixel scale of 0.45"/pixel. One set of observations for a target field consisted of 20 s exposures at 10 dithered positions for four wave-plate angles (0°, 45°, 22.5°, and 67.5°) in the J, H, and Ks bands, and the whole sequence is repeated 10 and 9 times for the N159 and N160 fields centered at (α, δ)2000=(5h39m37.1s, -69°43'45.1") and (5h40m05.6s, -69°36'25.8"), respectively. (2 data files).

  9. Identification and Functional Characterization of P159L Mutation in in a Family with Maturity-Onset Diabetes of the Young 5 (MODY5

    Directory of Open Access Journals (Sweden)

    Eun Ky Kim

    2014-12-01

    Full Text Available Mutation in HNF1B, the hepatocyte nuclear factor-1β (HNF-1β gene, results in maturity-onset diabetes of the young (MODY 5, which is characterized by gradual impairment of insulin secretion. However, the functional role of HNF-1β in insulin secretion and glucose metabolism is not fully understood. We identified a family with early-onset diabetes that fulfilled the criteria of MODY. Sanger sequencing revealed that a heterozygous P159L (CCT to CTT in codon 159 in the DNA-binding domain mutation in HNF1B was segregated according to the affected status. To investigate the functional consequences of this HNF1B mutation, we generated a P159L HNF1B construct. The wild-type and mutant HNF1B constructs were transfected into COS-7 cells in the presence of the promoter sequence of human glucose transporter type 2 (GLUT2. The luciferase reporter assay revealed that P159L HNF1B had decreased transcriptional activity compared to wild-type (p < 0.05. Electrophoretic mobility shift assay showed reduced DNA binding activity of P159L HNF1B. In the MIN6 pancreatic β-cell line, overexpression of the P159L mutant was significantly associated with decreased mRNA levels of GLUT2 compared to wild-type (p < 0.05. However, INS expression was not different between the wild-type and mutant HNF1B constructs. These findings suggests that the impaired insulin secretion in this family with the P159L HNF1B mutation may be related to altered GLUT2 expression in β-cells rather than decreased insulin gene expression. In conclusion, we have identified a Korean family with an HNF1B mutation and characterized its effect on the pathogenesis of diabetes.

  10. Iron Nanoparticles (Fe3O4 Used to Synthesize Magnetic Sodium Alginate Hydrogel Beads for the Removal of Basic Blue 159 from Aqueous Solutions

    Directory of Open Access Journals (Sweden)

    Atiyeh Ghajarieh

    2017-11-01

    Full Text Available Dyes are a main source of pollutants in textile plant effluents. Due to their molecular structure, they are usually toxic, carcinogenous, and persistent in the environment. The aim of the present work was to explore the removal of basic blue159 (BB159 using magnetic sodium alginate hydrogel beads. Magnetic sodium alginate hydrogel beads were initially synthesized  accoriodng to Rocher method using CaCl2 as a crosslink agent. Fourier transform infrared spectroscopy (FTIR was then employed to examine the functional groups on the surface of the magnetic sodium alginate hydrogel beads. In a third stage, the magnetic properties of the beads were measured using a vibrating sample magnetometer (VSM and the magnetic parameters were calculated. Subsequently, the effects of such parameters as adsorbent dosage, pH, initial concentration of dye, and contact time were evaluated on the BB159 removal efficiency of the adsorbent used. Finally, the Langmuir, Freundlich, Temkin, and B.E.T models were exploited to study the adsorption isotherm of BB159 onto the magnetic sodium alginate hydrogel beads. It was found that the magnetic sodium alginate beads possess both –COO and –OH groups that play important roles in the adsorption of the positively charged BB159 dye. A saturation magnetization equal to 21/8(emu/g was obtained for the sodium alginate beads/nano Fe3O4. Results also revealed that the highest dye removal from aqueous solutions was achieved at pH=11 in 120 minutes for 9 grams of the adsorbent. The study indicated that BB159 removal using the magnetic sodium alginate hydrogel beads as the adsorbent obeys the Langmuir model. Moreover, it was shown that the efficiency of the process for BB159 removal from aqueous solutions was satisfactory (85%.

  11. Novel Neurovascular Protective Agents: Effects of INV-155, INV-157, INV-159, and INV-161 versus Lipoic Acid and Captopril in a Rat Stroke Model

    Directory of Open Access Journals (Sweden)

    Barry J. Connell

    2012-01-01

    Full Text Available Background. Lipoic acid (LA, which has significant antioxidant properties, may also function as a potent neuroprotectant. The synthetic compounds INV-155, INV-157, INV-159, and INV-161 are physiochemical combinations of lipoic acid and captopril. We sought to determine if these compounds have neuroprotective potential following middle cerebral artery occlusion (MCAO in rats. Methods. Male Sprague-Dawley rats were injected intravenously with captopril (1–50 mg/kg 30 minutes prior to MCAO. Blood pressure, heart rate, baroreceptor reflex sensitivity, and infarct size were measured. In addition, dose response effect on infarct size and cardiovascular parameters was determined using INV-155, INV-157, INV-159, and INV-161 and compared to captopril and LA. Results. Pretreatment with captopril and LA at all doses tested was neuroprotective. The compounds INV-159 (0.5–10 mg/kg and INV-161 (1–10 mg/kg produced a significant,dose-dependent decrease in infarct size. In contrast, INV-155 and INV-157 had no effect on infarct size. Conclusions. Combined pretreatment with captopril potentiated the neuroprotective benefit observed following LA alone. Both INV-159 and INV-161 were also neuroprotective. These results suggest that patients taking combinations of captopril and LA, either as combination therapy or in the form of INV-159 or INV-161, may also benefit from significant protection against cerebral infarction.

  12. Marine and offshore pollution regulations for sanitary effluents discharge - 2010 scenario: MEPC.159(55); Legislacao ambiental para o descarte de efluentes sanitarios por navios e plataformas offshore - cenario 2010: MEPC.159(55)

    Energy Technology Data Exchange (ETDEWEB)

    Canale, Cristiane Lopes de Almeida; Arruda, Jose Eduardo; Miocque, Andre [VICEL, Rio das Ostras, RJ (Brazil)

    2008-07-01

    In response to the constant increase of the marine environment destruction, due to the exploration of its natural resources, several important international conventions have been edited since the years 60's aiming to improve the control of the pollution in the oceans. Annex IV of MARPOL 73/78 (The international Convention for the Prevention of Pollution from Ships) issued by the International Maritime Organization (IMO) entered in force in August 1st, 2005 establishing international rules for controlling the pollution caused by human sewage discharged from ships and offshore platforms. The rules established by IMO Resolutions go through constant improvements due to frequent innovations on technology, science and politics. Brazil as one of the MARPOL 73/78 Convention signatory countries, applies all the rules determined in this Convention through specific legislation. In October 2006 the IMO Marine Environment Protection Committee established the new resolution MEPC.159 (55) amending the parameters of sewage analysis and the performance tests for Sewage Treatment Units to be installed on board ships and offshore platforms from January 1st 2010, with the purpose to reduce the parameters of the pollution caused by human sewage discharge on board ships and offshore platforms. (author)

  13. Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101.

    Science.gov (United States)

    Xue, Tao; Liu, Zhenhua; Dai, Xuehuan; Xiang, Fengning

    2017-09-01

    Organ growth is a fundamental developmental process basing on cell proliferation and differentiation. The growth of the plant root is sustained by the activity of the root meristem, a process controlled in part by various transcription factors. Here, the miR159 has been identified as a post transcriptional repressor of root growth, on the basis that the mir159ab double mutant developed a larger meristem than did the wild type, and that it formed longer roots. In the mutant, the abundance of MYB33, MYB65 and MYB101 transcript was substantially increased. When MYB33, MYB65 and MYB101 were replaced by the miR159-resistant forms mMYB33, mMYB65 and mMYB101 respectively, the root meristem was similarly enlarged and the growth of the primary root enhanced. MYB65 activity promoted cell division in the root meristem by accelerating the cell cycle. The data suggest that miR159 acts as a key repressor of the primary root's growth, acting through its repression of MYB65 and consequent blocking of the cell cycle. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Rietveld refinement of the mixed boracite Fe1.59Zn1.41B7O13Br

    Directory of Open Access Journals (Sweden)

    Sandra Ulloa-Godínez

    2009-11-01

    Full Text Available The structural characterization of the new iron–zinc heptaborate bromide with composition Fe1.59Zn1.41B7O13Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable interatomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetrahedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetrahedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF was used to determinate the Fe/Zn ratio.

  15. Rietveld refinement of the mixed boracite Fe(1.59)Zn(1.41)B(7)O(13)Br.

    Science.gov (United States)

    Ulloa-Godínez, Sandra; Rosales, Ivonne; Bucio, Lauro; Farías, Mario H; Campa-Molina, Jorge

    2009-10-31

    The structural characterization of the new iron-zinc hepta-borate bromide with composition Fe(1.59)Zn(1.41)B(7)O(13)Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable inter-atomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetra-hedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetra-hedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF) was used to determinate the Fe/Zn ratio.

  16. KINEMATIC STRUCTURE OF MOLECULAR GAS AROUND HIGH-MASS YSO, PAPILLON NEBULA, IN N159 EAST IN THE LARGE MAGELLANIC CLOUD: A NEW PERSPECTIVE WITH ALMA

    Energy Technology Data Exchange (ETDEWEB)

    Saigo, Kazuya; Harada, Ryohei; Kawamura, Akiko [Chile Observatory, National Astronomical Observatory of Japan, National Institutes of Natural Science, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Onishi, Toshikazu; Tokuda, Kazuki; Morioka, Yuuki [Department of Physical Science, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8531 (Japan); Nayak, Omnarayani; Meixner, Margaret [The Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Sewiło, Marta [NASA Goddard Space Flight Center, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States); Indebetouw, Remy [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904 (United States); Torii, Kazufumi; Ohama, Akio; Hattori, Yusuke; Yamamoto, Hiroaki; Tachihara, Kengo [Department of Physics, Nagoya University, Chikusa-ku, Nagoya 464-8602 (Japan); Minamidani, Tetsuhiro [Nobeyama Radio Observatory, 462-2 Nobeyama Minamimaki-mura, Minamisaku-gun, Nagano 384-1305 (Japan); Inoue, Tsuyoshi [Division of Theoretical Astronomy, National Astronomical Observatory (Japan); Madden, Suzanne; Lebouteiller, Vianney [Laboratoire AIM, CEA, Universite Paris VII, IRFU/Service d’Astrophysique, Bat. 709, F-91191 Gif-sur-Yvette (France); Galametz, Maud [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); and others

    2017-01-20

    We present the ALMA Band 3 and Band 6 results of {sup 12}CO(2-1), {sup 13}CO(2-1), H30 α recombination line, free–free emission around 98 GHz, and the dust thermal emission around 230 GHz toward the N159 East Giant Molecular Cloud (N159E) in the Large Magellanic Cloud (LMC). LMC is the nearest active high-mass star-forming face-on galaxy at a distance of 50 kpc and is the best target for studing high-mass star formation. ALMA observations show that N159E is the complex of filamentary clouds with the width and length of ∼1 pc and several parsecs. The total molecular mass is 0.92 × 10{sup 5} M {sub ⊙} from the {sup 13}CO(2-1) intensity. N159E harbors the well-known Papillon Nebula, a compact high-excitation H ii region. We found that a YSO associated with the Papillon Nebula has the mass of 35 M {sub ⊙} and is located at the intersection of three filamentary clouds. It indicates that the formation of the high-mass YSO was induced by the collision of filamentary clouds. Fukui et al. reported a similar kinematic structure toward two YSOs in the N159 West region, which are the other YSOs that have the mass of ≳35 M {sub ⊙}. This suggests that the collision of filamentary clouds is a primary mechanism of high-mass star formation. We found a small molecular hole around the YSO in Papillon Nebula with a sub-parsec scale. It is filled by free–free and H30 α emission. The temperature of the molecular gas around the hole reaches ∼80 K. It indicates that this YSO has just started the distruction of parental molecular cloud.

  17. KINEMATIC STRUCTURE OF MOLECULAR GAS AROUND HIGH-MASS YSO, PAPILLON NEBULA, IN N159 EAST IN THE LARGE MAGELLANIC CLOUD: A NEW PERSPECTIVE WITH ALMA

    International Nuclear Information System (INIS)

    Saigo, Kazuya; Harada, Ryohei; Kawamura, Akiko; Onishi, Toshikazu; Tokuda, Kazuki; Morioka, Yuuki; Nayak, Omnarayani; Meixner, Margaret; Sewiło, Marta; Indebetouw, Remy; Torii, Kazufumi; Ohama, Akio; Hattori, Yusuke; Yamamoto, Hiroaki; Tachihara, Kengo; Minamidani, Tetsuhiro; Inoue, Tsuyoshi; Madden, Suzanne; Lebouteiller, Vianney; Galametz, Maud

    2017-01-01

    We present the ALMA Band 3 and Band 6 results of 12 CO(2-1), 13 CO(2-1), H30 α recombination line, free–free emission around 98 GHz, and the dust thermal emission around 230 GHz toward the N159 East Giant Molecular Cloud (N159E) in the Large Magellanic Cloud (LMC). LMC is the nearest active high-mass star-forming face-on galaxy at a distance of 50 kpc and is the best target for studing high-mass star formation. ALMA observations show that N159E is the complex of filamentary clouds with the width and length of ∼1 pc and several parsecs. The total molecular mass is 0.92 × 10 5 M ⊙ from the 13 CO(2-1) intensity. N159E harbors the well-known Papillon Nebula, a compact high-excitation H ii region. We found that a YSO associated with the Papillon Nebula has the mass of 35 M ⊙ and is located at the intersection of three filamentary clouds. It indicates that the formation of the high-mass YSO was induced by the collision of filamentary clouds. Fukui et al. reported a similar kinematic structure toward two YSOs in the N159 West region, which are the other YSOs that have the mass of ≳35 M ⊙ . This suggests that the collision of filamentary clouds is a primary mechanism of high-mass star formation. We found a small molecular hole around the YSO in Papillon Nebula with a sub-parsec scale. It is filled by free–free and H30 α emission. The temperature of the molecular gas around the hole reaches ∼80 K. It indicates that this YSO has just started the distruction of parental molecular cloud.

  18. 30__159

    African Journals Online (AJOL)

    User

    Short branched e.g. xanxan gum, and guar gum. - Branch ... carbohydrates, flavonoids terpenoids, amino acid, saponins, oil .... is a branched molecule with the main chain consisting of 1, 3- .... children and adolescent cholesterol and diabetes.

  19. Pages 153 - 159.pmd

    African Journals Online (AJOL)

    Administrator

    Methods: Convenience sampling method was used to recruit 69 pregnant women aged 21-41 years with gestational age of. 0-20 weeks in ... Keywords: progesterone, oxidative stress, recurrent spontaneous abortion, trace metals, antioxidants. African Health ... spontaneous abortion in women might be related to selenium ...

  20. 159 - 163_ize iyamu

    African Journals Online (AJOL)

    DR. AMINU

    of the treated sludge were determined (using the liquor and settled solid of the sludge) as was done for the raw sludge. RESULTS AND DISCUSSION. Table1 presents the result of the characterization of the sludge samples from the rubber processing industry. Triplicate determinations were done in each case and the mean ...

  1. 159 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    petroleum ether extract showed activity only on the fungal isolate C. albicans. The study demonstrated ... In addition to natural ..... essential oils from Origanum, Thymbra and Satureja species with ... protein from Moringa seeds". Colloids and.

  2. Synthesis and characterization of nano structures of Silica SBA-16 containing Gadolinium-159 as potential nanoparticulated system for cancer therapy

    International Nuclear Information System (INIS)

    Oliveira, Andre Felipe de

    2013-01-01

    Cancer is a leading cause of death worldwide, and malignant neoplasms of the lung, stomach, liver, colon and breast in greater numbers. And recently observed in the literature a large number of reviews where new materials, especially nanoparticle, has been studied as drug carriers and radioisotopes applied to cancer treatment. How mesoporous materials based on silica, thanks to its huge surface area and biocompatibility, have been studied intensively providing broad applications in various areas, the use of nanostructured silica SBA-16 might be a carrier specific radioisotope accumulate in the cells malignant. Thus the aim of this study is to develop in vitro studies using SBA-16 can selectively concentrate in malignant cells therapeutic amounts of the radioisotope Gadolinium-159 escorting them to death. This work was performed orderly synthesis of mesoporous silica, SBA-16 and incorporating the complex Gd-DTPA-BMA, as well as chemical and structural characterization. The techniques used to analyze the occurrence of the incorporation of the gadolinium complex in the silica matrix were elemental analysis (CHN), atomic emission spectroscopy (ICP-AES), infrared spectroscopy (FTIR), nitrogen adsorption (BET), small-angle X-ray scattering (SAXS) and thermogravimetric analysis (TG). To analyze the morphology of pure silica used the scanning electron microscopy (SEM) and transmission electron microscopy (TEM). By photon correlation spectroscopy (PCS) it was possible to obtain a measure of mean particle size, the polydispersity index (PDI) of the silica SBA-16, and the zeta potential by laser Doppler anemometry (LDA). The results of incorporation analyzed by ICP-AES indicated that the material SBA-16 had a higher rate of incorporation of gadolinium (93%). The release kinetics in simulated body fluid, showed considerable stability and low release (1%). The mesoporous silica SBA-16 showed cell viability in direct contact with cell culture. Samples with gadolinium

  3. The role of dysprosium on the structural and magnetic properties of (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Rahimi, Hamed; Ghasemi, Ali, E-mail: ali13912001@yahoo.com; Mozaffarinia, Reza; Tavoosi, Majid

    2017-02-15

    In current work, Nd2Fe14B nanoparticles was synthesized by sol-gel method. Dysprosium powders were added into Nd2Fe14B nanoparticles by mechanical alloying process in order to enhancement of coercivity. The phase analysis, structure, and magnetic properties of annealed (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles with different Dy-content (x=0.1, 0.2, 0.3, 0.4, 0.5, 0.6) were investigated by employing X-ray diffraction, X-ray photoelectron spectroscopy, energy dispersive spectroscopy, field emission scanning electron microscope, transmission electron microscope and vibrating sample magnetometer techniques. The results showed that with an increase in Dy amounts, the coercivity of particles increased from 2.9 kOe to 13.4 kOe and then decreased to 5.6 kOe. By adding an optimum amount of Dy (x=0.4), the coercivity was significantly increased from 2.9 kOe to 13.4 kOe. The average particle size of annealed (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles was below 10 nm. Magnetization reversal studies indicate that the coercivity of milled and annealed (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles is controlled by the nucleation of reversed magnetic domains. The experimental results in the angular dependence of coercivity for (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B permanent magnets showed that the normalized coercivity of the permanent magnets H{sub c}(θ)/H{sub c}(0) increases from 1 to about 1.2–1.5 with increasing θ from 0 to about π/3, for x=0.4–0.6. - Highlights: • Dy was added to Nd{sub 2}Fe{sub 14}B nanoparticles to improve the coercivity. • A maximum squareness ratio of 0.99 was obtained. • The average particle size decreased with an increase in Dy-content.

  4. Overexpression, crystallization and preliminary X-ray crystallographic analysis of the RNA polymerase domain of primase from Streptococcus mutans strain UA159

    International Nuclear Information System (INIS)

    Im, Dong-Won; Kim, Tae-O; Jung, Ha Yun; Oh, Ji Eun; Lee, Se Jin; Heo, Yong-Seok

    2011-01-01

    The RNA polymerase domain of primase from S. mutans strain UA159 was cloned, overexpressed, purified and crystallized. X-ray diffraction data were collected to a resolution of 1.60 Å. Primase is the enzyme that synthesizes RNA primers on single-stranded DNA during normal DNA replication. In this study, the catalytic core domain of primase from Streptococcus mutans UA159 was overexpressed in Escherichia coli, purified and crystallized. Diffraction data were collected to 1.60 Å resolution using a synchrotron-radiation source. The crystal belonged to space group P4 1 or P4 3 , with unit-cell parameters a = b = 52.63, c = 110.31 Å. The asymmetric unit is likely to contain one molecule, with a corresponding V M of 1.77 Å 3 Da −1 and a solvent content of 30.7%

  5. Purification, crystallization and preliminary X-ray diffraction analysis of enoyl-acyl carrier protein reductase (FabK) from Streptococcus mutans strain UA159

    International Nuclear Information System (INIS)

    Kim, Tae-O; Im, Dong-Won; Jung, Ha Yun; Kwon, Seong Jung; Heo, Yong-Seok

    2012-01-01

    Enoyl-acyl carrier protein reductase (FabK) from S. mutans strain UA159 was cloned, overexpressed, purified and crystallized. X-ray diffraction data were collected to a resolution of 2.40 Å. A triclosan-resistant flavoprotein termed FabK is the sole enoyl-acyl carrier protein reductase in Streptococcus pneumoniae and Streptococcus mutans. In this study, FabK from S. mutans strain UA159 was overexpressed in Escherichia coli, purified and crystallized. Diffraction data were collected to 2.40 Å resolution using a synchrotron-radiation source. The crystal belonged to space group P6 2 , with unit-cell parameters a = b = 105.79, c = 44.15 Å. The asymmetric unit contained one molecule, with a corresponding V M of 2.05 Å 3 Da −1 and a solvent content of 39.9%

  6. The 4-fold fission in 40Ar + 209Bi, 197Au and 159Tb reactions at 25MeV/u

    International Nuclear Information System (INIS)

    Dai, G.X.; Wu, H.Y.; He, Z.Y.; Luo, Q.Z.; Duan, L.M.; Zhang, B.G.; Qi, Y.J.; Li, Z.Y.; Jin, G.M.; Wen, W.X.

    1995-01-01

    The paper presents the 4-fold fission or fragmentation of hot nuclei produced in 25MeV/u 40 Ar+ 209 Bi, 197 Au and 159 Tb reactions. The events with 4 massive fragments emitted with angles larger than 36 were detected by 8 PPACs with area of 25x20cm 2 . The TKE, distributions of mass and velocity for the four fragments have been obtained. ((orig.))

  7. (Vapour+liquid) equilibria of {xCH3Cl+(1-x)HCl} at temperatures (159.01 and 182.33) K

    International Nuclear Information System (INIS)

    Senra, A.M.P.; Fonseca, I.M.A.; Lobo, L.Q.

    2005-01-01

    VLE for (CH 3 Cl+HCl) has been experimentally determined at temperatures (159.01 and 182.33) K, using a static; method. The data were used to calculate the molar excess Gibbs energy at the two temperatures. The excess molar enthalpy estimated from the G m E values for the equimolar mixture is relatively large and negative: H m E =-(1011+/-318) J.mol -1 . The results have been compared with estimates from the chemical theory of solutions

  8. Search for Correlations between Prolate-Shape Collective and Oblate-Shape Non-Collective Nuclear Rotation: High Spin States in 159,160 Yb

    International Nuclear Information System (INIS)

    Byrski, T.; Beck, F.A.; Sharpey-Schafer, J.F.

    1987-01-01

    High-spin states of 159,160 Yb have been studied using the escape-suppressed array TESSA 2. Extensions of yrast and lateral bands have been found up to I ∼40. Experimental data suggest strong correlations between maximum alignment configurations of the valence nucleons and related collective states. Theoretical analysis fully supports the idea of prolate-collective vs. oblate-non-collective correlations. Band termination interpretation is discussed

  9. Etude critique de la prise en charge de 159 personnes âgées en consultation de psychiatrie

    Science.gov (United States)

    Ben Thabet, Jihène; Ammar, Yousra; Charfi, Nada; Zouari, Lobna; Zouari, Nasreddine; Gaha, Lotfi; Maalej, Mohamed

    2014-01-01

    Introduction Le phénomène de vieillissement des populations est associé à une augmentation de la prévalence de la morbidité liée à l’âge. La prescription des psychotropes chez le sujet âgé est de plus en plus fréquente dans les institutions, les doses sont de plus en plus élevées, avec un recours fréquent à une poly pharmacothérapie. Nous nous sommes proposé de décrire les conduites thérapeutiques chez le sujet âgé consultant en psychiatrie, en vue de les confronter aux dernières recommandations en la matière. Méthodes L’étude était de type rétrospectif et descriptif. Elle a concerné les sujets âgés d'au moins 60 ans ayant consulté pour la première fois en psychiatrie, au CHU Hédi Chaker à Sfax, en 2010 ou 2011. Résultats Nous avons colligé 159 dossiers. L’âge moyen était de 73 ans. La démence et les troubles de l'humeur étaient les diagnostics les plus fréquents. Sur le plan thérapeutique, une poly thérapie faite d'au moins deux psychotropes de familles différentes a été prescrite pour 55,9%. Chez 60.3% des sujets, le traitement a été prescrit d'emblée à dose complète. Aucun dossier ne faisait état d'une prise en charge psychothérapeutique. Conclusion La prise en charge des malades de notre étude n’était pas conforme aux recommandations, notamment en matière d'association médicamenteuse, de progression des doses et d'association de la psychothérapie à la pharmacothérapie. L'information des médecins et leur sensibilisation aux particularités du sujet âgé contribuerait à optimiser les soins qui leur sont prodigués, y compris en psychiatrie. PMID:25120873

  10. ACC oxidase and miRNA 159a, and their involvement in fresh fruit bunch yield (FFB) via sex ratio determination in oil palm.

    Science.gov (United States)

    Somyong, Suthasinee; Poopear, Supannee; Sunner, Supreet Kaur; Wanlayaporn, Kitti; Jomchai, Nukoon; Yoocha, Thippawan; Ukoskit, Kittipat; Tangphatsornruang, Sithichoke; Tragoonrung, Somvong

    2016-06-01

    Oil palm (Elaeis guineesis Jacq.) is the most productive oil-bearing crop, yielding more oil per area than any other oil-bearing crops. However, there are still efforts to improve oil palm yield, in order to serve consumer and manufacturer demand. Oil palm produces female and male inflorescences in an alternating cycle. So, high sex ratio (SR), the ratio of female inflorescences to the total inflorescences, is a favorable trait in term of increasing yields in oil palm. This study aims to understand the genetic control for SR related traits, such as fresh fruit bunch yield (FFB), by characterizing genes at FFB quantitative trait loci (QTLs) on linkage 10 (chromosome 6) and linkage 15 (chromosome 10). Published oil palm sequences at the FFB QTLs were used to develop gene-based and simple sequence repeat (SSR) markers. We used the multiple QTL analysis model (MQM) to characterize the relationship of new markers with the SR traits in the oil palm population. The RNA expression of the most linked QTL genes was also evaluated in various tissues of oil palm. We identified EgACCO1 (encoding aminocyclopropane carboxylate (ACC) oxidase) at chromosome 10 and EgmiR159a (microRNA 159a) at chromosome 6 to be the most linked QTL genes or determinants for FFB yield and/or female inflorescence number with a phenotype variance explained (PVE) from 10.4 to 15 % and suggest that these play the important roles in sex determination and differentiation in oil palm. The strongest expression of EgACCO1 and the predicted precursor of EgmiR159a was found in ovaries and, to a lesser extent, fruit development. In addition, highly normalized expression of EgmiR159a was found in female flowers. In summary, the QTL analysis and the RNA expression reveal that EgACCO1 and EgmiR159a are the potential genetic factors involved in female flower determination and hence would affect yield in oil palm. However, to clarify how these genetic factors regulate female flower determination, more investigation

  11. The decay of hot dysprosium nuclei

    International Nuclear Information System (INIS)

    Atac, A.; Rekstad, J.; Guttormsen, M.; Messelt, S.; Ramsoey, T.; Thorsteinsen, T.F.; Loevhoeiden, G.; Roedland, T.

    1987-03-01

    The γ-decay following the 162,163 Dy( 3 He,αxn) reactions with E 3 He =45 MeV has been studied. Non-statistical γ-radiation with energies of E γ ≅1 MeV and ≅2 MeV is found for various residual nuclei. The properties of these γ-ray bumps depend on the number of emitted neutrons and reveal an odd-even mass dependence. New techniques to extract average neutron energies as a function of excitation energy and of the number of emitted neutrons are employed. The deduced neutron energies are consistent with Fermi-gas model predictions

  12. Important Risk Factors of Mortality Among Children Aged 1-59 Months in Rural Areas of Shahroud, Iran: A Community-based Nested Case-Control Study.

    Science.gov (United States)

    Chaman, Reza; Alami, Ali; Emamian, Mohammad Hassan; Naieni, Kourosh Holakouie; Mirmohammadkhani, Majid; Ahmadnezhad, Elham; Entezarmahdi, Rasool; Shati, Mohsen; Shariati, Mohammad

    2012-12-01

    The aim of the study was to evaluate potential risk factors of children mortality between 1-59 months of age. This nested case-control study was conducted among children born from June 1999 to March 2009 in rural areas of Shahroud, located in the central region of Iran using health care visit reports and follow-up data available in household health records. MORTALITY WAS SIGNIFICANTLY ASSOCIATED WITH BREASTFEEDING DURATION (OR: 0.87, 95% CI: 0.81-0.93), total health care visits (OR: 0.90, 95% CI: 0.83-0.98) and low birth weight (LBW) (OR: 7.38, 95% CI: 1.37-39.67). In our study, a longer breastfeeding period and more frequent health care visits were two important protective factors, while LBW was an important risk factor for 1-59 month child mortality. It seems, that complex and multiple factors may be involved in mortality of under 5-year-old children, so combined efforts would be necessary to improve child health indicators.

  13. ASSOCIATION OF POLYMORPHISM OF C159T GENE OF RECEPTOR CD14 AND ANTIENDOTOXIN IMMUNITY IN PATIENTS WITH REFRACTORY / CORTICOSTEROIDSSENSITIVE ASTHMA

    Directory of Open Access Journals (Sweden)

    Bisyuk Yu.A.

    2015-05-01

    Full Text Available Introduction. The refractory asthma refers to the phenotype, which is characterized by severe persistent course with frequent exacerbations and resistance to corticosteroid therapy. This phenotype of asthma can be related to C159T polymorphism of CD14 receptor gene Material and methods. There were studied the C159T polymorphism of CD14 gene in 331 patients with bronchial asthma. The control group consisted of 285 healthy individuals of Crimea. The C159T gene polymorphism of CD14 was detected by allele-specific polymerase chain reaction with electrophoretic detection. The distribution of genotypes was checked according to the law of the Hardy-Weinberg equilibrium by using Fisher's exact test and χ2. There was used logistic regression to determine the difference in the frequency of genotypes and alleles. Results and discussion. In our study have been identified 291 patients with corticosteroid-sensitive and 40 with refractory asthma. The genotype distribution of control (CC – 34%, CT – 51%, CT – 15% and patients with corticosteroid-sensitive asthma (CC – 29%, CT – 53%, CT – 18% were in accordance with the law of Hardy- Weinberg equilibrium and did not significantly differ (χ2 = 2.204, P = 0.332. There were no significant differences when comparing the allele and genotype frequencies by using risk allele T and C model. In the control group the frequency distribution of genotypes CC – 34%, CT – 51%, TT – 15% did not differ significantly (χ2 = 3.540, P = 0.170 from refractory asthma (CC – 52%, CT – 35%, CT – 13%. The risk analysis for the T allele showed that the frequency of CT+TT genotype in patients with refractory asthma (49% was significantly lower (OR = 0.467, CI = [0.240-0.910], χ2 = 5.17, p = 0.023 compere to control (66 %. In turn, the difference of allelic frequencies for the control and patients with persistent asthma did not differ significantly (p = 0.076. The content of antiendotoxin antibody of class A in

  14. [Long-term outcome analysis of subjective and objective parameters after breast reduction in 159 cases: Patients judge differently from plastic surgeons].

    Science.gov (United States)

    Osinga, Rik; Babst, Doris; Bodmer, Elvira S; Link, Bjoern C; Fritsche, Elmar; Hug, Urs

    2017-12-01

    This work assessed both subjective and objective postoperative parameters after breast reduction surgery and compared between patients and plastic surgeons. After an average postoperative observation period of 6.7 ± 2.7 (2 - 13) years, 159 out of 259 patients (61 %) were examined. The mean age at the time of surgery was 37 ± 14 (15 - 74) years. The postoperative anatomy of the breast and other anthropometric parameters were measured in cm with the patient in an upright position. The visual analogue scale (VAS) values for symmetry, size, shape, type of scar and overall satisfaction both from the patient's and from four plastic surgeons' perspectives were assessed and compared. Patients rated the postoperative result significantly better than surgeons. Good subjective ratings by patients for shape, symmetry and sensitivity correlated with high scores for overall assessment. Shape had the strongest influence on overall satisfaction (regression coefficient 0.357; p reduction surgery, long-term outcome is rated significantly better by patients than by plastic surgeons. Good subjective ratings by patients for shape, symmetry and sensitivity correlated with high scores for overall assessment. Shape had the strongest influence on overall satisfaction, followed by symmetry and sensitivity of the breast. Postoperative size of the breast, resection weight, type of scar, age or BMI was not of significant influence. Symmetry was the only assessed subjective parameter of this study that could be objectified by postoperative measurements. Georg Thieme Verlag KG Stuttgart · New York.

  15. Ten years of clinical experience in the use of fixed-pressure versus programmable valves: a retrospective study of 159 patients.

    Science.gov (United States)

    Mpakopoulou, Maria; Brotis, Alexandros G; Gatos, Haralampos; Paterakis, Konstantinos; Fountas, Kostas N

    2012-01-01

    The aim of this study was to present our 10-year experience with the use of fixed-pressure and programmable valves in the treatment of adult patients requiring cerebrospinal fluid (CSF) diversion. Patients (n = 159; 89 male and 70 female) suffering from hydrocephalus of various causes underwent CSF shunt implantation. Forty fixed-pressure and 119 programmable valves were initially implanted. The observed revision rate was 40% in patients with fixed-pressure valves. In 20% of these patients, a revision due to valve mechanism malfunction was undertaken, and the initial valve was replaced with a programmable one. The revision rate in the adjustable-pressure valve subgroup was 20%. The infection rate for the fixed-pressure and programmable valve subgroups were 3%, and 1.7%, respectively. Similarly, subdural fluid collections were noticed in 17% and 4% of patients with fixed-pressure valves and programmable valves, respectively. The revision and over-drainage rates were significantly lower when using programmable valves, and thus, this type of valve is preferred whenever CSF has to be diverted.

  16. Effects of combined oleic acid and fluoride at sub-MIC levels on EPS formation and viability of Streptococcus mutans UA159 biofilms.

    Science.gov (United States)

    Cai, Jian-Na; Kim, Mi-A; Jung, Ji-Eun; Pandit, Santosh; Song, Kwang-Yeob; Jeon, Jae-Gyu

    2015-01-01

    Despite the widespread use of fluoride, dental caries, a biofilm-related disease, remains an important health problem. This study investigated whether oleic acid, a monounsaturated fatty acid, can enhance the effect of fluoride on extracellular polysaccharide (EPS) formation by Streptococcus mutans UA159 biofilms at sub-minimum inhibitory concentration levels, via microbiological and biochemical methods, confocal fluorescence microscopy, and real-time PCR. The combination of oleic acid with fluoride inhibited EPS formation more strongly than did fluoride or oleic acid alone. The superior inhibition of EPS formation was due to the combination of the inhibitory effects of oleic acid and fluoride against glucosyltransferases (GTFs) and GTF-related gene (gtfB, gtfC, and gtfD) expression, respectively. In addition, the combination of oleic acid with fluoride altered the bacterial biovolume of the biofilms without bactericidal activity. These results suggest that oleic acid may be useful for enhancing fluoride inhibition of EPS formation by S. mutans biofilms, without killing the bacterium.

  17. Elastic and Raman scattering of 8.5-11.4 MeV photons from 159Tb, 165Ho, and 237Np

    International Nuclear Information System (INIS)

    Bar-Noy, T.; Moreh, R.

    1977-01-01

    Differential cross sections for elastic and inelastic Raman scattering from the deformed heavy nuclei 159 Tb, 165 Ho and 237 Np were measured at five energies between 8.5 and 11.4 MeV. Angular distributions at four angles between 90 0 and 140 0 for both elastic and inelastic scattering at 9.0 and 11.4 MeV were also measured. The monoenergetic photons were obtained from thermal neutron capture in Ni and Cr. All the angular distributions and the elastic and Raman scattering at the higher energies are in good overall agreement with theoretical predictions. The theory is based on a modified simple rotator model of the giant resonance in which the effect of Delbrueck scattering was included. A trend of both the elastic and Raman scattering at lower energies to be stronger than expected are suggested by the data. However, the ratio between the Raman and elastic scattering seem to be in good agreement with theory throughout the whole energy range. This shows that there is no need to introduce a direct nonresonant component to the imaginary part of the elastic scattering amplitude to explain the experimental data. (Auth.)

  18. Comparative decay analysis of 179Re* and 189Au* formed in the reactions 20Ne+159Tb, 169Tm with Elab=8 MeV/A

    International Nuclear Information System (INIS)

    Manpreet Kaur; Singh, BirBikram

    2016-01-01

    The heavy ion induced reactions lead to the formation of composite systems, which subsequently decay because of high excitation energy and angular momentum. The study of decaying composite system facilitates to explore the number of nuclear characteristics and the reaction dynamics. The medium mass composite systems 164 Yb*, 176,182,188,196 Pt* and 200,202 Pb* have been studied successfully within the framework of dynamical cluster decay model (DCM). These studies show the emission of light particles, LP (or evaporation residues, ER), intermediate mass fragments, IMF, heavy mass fragments, HMF and symmetric fragments, SF along with signatures of quasi-fission, qf, process in their decay path. The decay of medium mass composite system 179 Re* has also been studied within DCM. In the present work, we investigate the comparative decay of two medium mass composite systems 179 Re* and 189 Au formed in the reactions with same projectile ( 20 Ne) having same E lab (or same E/A) on two different targets 159 Tb and 169 Tm, for which the experimental data is available

  19. 150 - 159_Salisu et al.

    African Journals Online (AJOL)

    User

    of interaction occurring in this natural system (Dube et al.,2000). Many soils ... minerals including gold, copper, zinc etc. The Zamfara ... contain unusually problematic concentration of lead and other ..... Copper (Cu) is an essential micronutrient ...

  20. 159 - 162_Kogo_Aniline

    African Journals Online (AJOL)

    pc

    mechanical properties of doped polyester fabric with aniline w s of various ... tion of the PANI solution rly constant up to ... computer interface and printer according to the AS. Figure 2: .... Material Systems and Structures, 23(17), pp. 1969-1986.

  1. Percutaneous Transhepatic Biliary Metal Stent for Malignant Hilar Obstruction: Results and Predictive Factors for Efficacy in 159 Patients from a Single Center

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mingwu, E-mail: lmw-jack@china.com.cn; Bai, Ming, E-mail: mingbai1983@gmail.com; Qi, Xingshun, E-mail: qixingshun19840717@126.com; Li, Kai, E-mail: lkiscoming@163.com; Yin, Zhanxin, E-mail: yinzhanxin@sina.com [Fourth Military Medical University, Department of Digestive Interventional Radiology, Xijing Hospital of Digestive Diseases (China); Wang, Jianhong, E-mail: 54526844@qq.com [Fourth Military Medical University, Department of Ultrasound, Xijing Hospital of Digestive Diseases (China); Wu, Wenbing, E-mail: wuwb211@126.com; Zhen, Luanluan, E-mail: zll2007101@163.com; He, Chuangye, E-mail: sxhechuangye@126.com [Fourth Military Medical University, Department of Digestive Interventional Radiology, Xijing Hospital of Digestive Diseases (China); Fan, Daiming, E-mail: fandaim@fmmu.edu.cn [Fourth Military Medical University, State Key Laboratory of Cancer Biology and Xijing Hospital of Digestive Diseases (China); Zhang, Zhuoli, E-mail: Zhuoli-Zhang@northwestern.edu [Northwestern University, Department of Radiology (United States); Han, Guohong, E-mail: hangh2009@gmail.com, E-mail: Hangh@fmmu.edu.cn [Fourth Military Medical University, Department of Digestive Interventional Radiology, Xijing Hospital of Digestive Diseases (China)

    2015-06-15

    AimTo investigate and compare the efficacy and safety of percutaneous transhepatic biliary stenting (PTBS) using a one- or two-stage procedure and determine the predictive factors for the efficacious treatment of malignant hilar obstruction (MHO).Methods159 consecutive patients with MHO who underwent PTBS were enrolled between January 2010 and June 2013. Patients were classified into one- or two-stage groups. Independent predictors of therapeutic success were evaluated using a logistic regression model.Results108 patients were treated with one-stage PTBS and 51 patients were treated with two-stage PTBS. The stents were technically successful in all patients. Successful drainage was achieved in 114 patients (71.4 %). A total of 42 early major complications were observed. Re-interventions were attempted in 23 patients during follow-up. The cumulative primary patency rates at 3, 6, and 12 months were 88, 71, and 48 %, respectively. Stent placement using a one- or two-stage procedure did not significantly affect therapeutic success, early major complications, median stent patency, or survival. A stent placed across the duodenal papilla was an independent predictor of therapeutic success (odds ratio = 0.262, 95 % confidence interval [0.107–0.642]). Patients with stents across papilla had a lower rate of cholangitis compared with patients who had a stent above papilla (7.1 vs. 20.3 %, respectively, p = 0.03).ConclusionsThe majority of patients with MHO who underwent one-stage PTBS showed similar efficacy and safety outcomes compared with those who underwent two-stage PTBS. Stent placement across the duodenal papilla was associated with a higher therapeutic success rate.

  2. Percutaneous transhepatic biliary metal stent for malignant hilar obstruction: results and predictive factors for efficacy in 159 patients from a single center.

    Science.gov (United States)

    Li, Mingwu; Bai, Ming; Qi, Xingshun; Li, Kai; Yin, Zhanxin; Wang, Jianhong; Wu, Wenbing; Zhen, Luanluan; He, Chuangye; Fan, Daiming; Zhang, Zhuoli; Han, Guohong

    2015-06-01

    To investigate and compare the efficacy and safety of percutaneous transhepatic biliary stenting (PTBS) using a one- or two-stage procedure and determine the predictive factors for the efficacious treatment of malignant hilar obstruction (MHO). 159 consecutive patients with MHO who underwent PTBS were enrolled between January 2010 and June 2013. Patients were classified into one- or two-stage groups. Independent predictors of therapeutic success were evaluated using a logistic regression model. 108 patients were treated with one-stage PTBS and 51 patients were treated with two-stage PTBS. The stents were technically successful in all patients. Successful drainage was achieved in 114 patients (71.4 %). A total of 42 early major complications were observed. Re-interventions were attempted in 23 patients during follow-up. The cumulative primary patency rates at 3, 6, and 12 months were 88, 71, and 48 %, respectively. Stent placement using a one- or two-stage procedure did not significantly affect therapeutic success, early major complications, median stent patency, or survival. A stent placed across the duodenal papilla was an independent predictor of therapeutic success (odds ratio = 0.262, 95 % confidence interval [0.107-0.642]). Patients with stents across papilla had a lower rate of cholangitis compared with patients who had a stent above papilla (7.1 vs. 20.3 %, respectively, p = 0.03). The majority of patients with MHO who underwent one-stage PTBS showed similar efficacy and safety outcomes compared with those who underwent two-stage PTBS. Stent placement across the duodenal papilla was associated with a higher therapeutic success rate.

  3. Sensitivity to House Dust Mites Allergens with Atopic Asthma and Its Relationship with CD14 C(-159T) Polymorphism in Patients of West Bengal, India.

    Science.gov (United States)

    Ghosh, Amlan; Dutta, Shampa; Podder, Sanjoy; Mondal, Priti; Laha, Arghya; Saha, Nimai Chandra; Moitra, Saibal; Saha, Goutam Kumar

    2018-01-10

    India is the home to around 15-20 million asthmatics, and asthma prevalence is increasing in Indian metropolitan area, including Kolkata, West Bengal. Complex interactions of genetic and environmental factors are involved in asthma. Genome-wide search for susceptible loci regulating IgE response (atopy) have identified a candidate gene CD14 which is most important in the context of allergic responses of respiratory system. This study was aimed to investigate the role of house dust and house dust mites in development of bronchial asthma and to explore the possible association of candidate gene CD14 with disease manifestation among Kolkata patient population. Skin-prick test was done among 950 asthmatic patients against 8 aeroallergens, including house dust and house dust mites and total serum IgE and allergen-specific IgE were measured. Polymerase chain reaction-restriction fragment length polymorphism was done in patients and nonasthmatic control (n = 255 in each) to characterize a functional polymorphism, C(-159)T, of CD14, a positional candidate gene for allergy. We identified house dust as the most common aeroallergen sensitizer among atopic patients in Kolkata followed by Dermatophagoides pteronyssinus and Dermatophagoides farinae Hughes (Acari: Pyroglyphidae) mites. Patient's sera contain significantly higher IgE level than that of control. Allergen-specific IgE antibody test revealed that 76.36% patients had specific IgE antibody against D. pteronyssinus mite. There was a significant difference in the distribution of alleles and genotypes for CD14 polymorphism with an increase in disease severity. So, in Kolkata, house dust mite is a common aeroallergen and D. pteronyssinus is predominant among mites. The present study revealed that bronchial asthma has a genetic background. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. Abundant Hydrothermal Venting in the Southern Ocean Near 62°S/159°E on the Australian-Antarctic Ridge

    Science.gov (United States)

    Baker, E. T.; Hahm, D.; Rhee, T. S.; Park, S. H.; Lupton, J. E.; Walker, S. L.; Choi, H.

    2014-12-01

    Circum-Antarctic Ridges (CARs) comprise almost one-third of the global Mid-Ocean Ridge, yet remain terra incognita for hydrothermal activity and chemosynthetic ecosystems. The InterRidge Vents Database lists only 3 confirmed (visualized) and 35 inferred (plume evidence) active sites along the ~21,000 km of CARs. Here, we report on a multi-year effort to locate and characterize hydrothermal activity on two 1st-order segments of the Australian-Antarctic Ridge that are perhaps more isolated from other known vent fields than any other vent site on the Mid-Ocean Ridge. KR1 is a 300-km-long segment near 62°S/159°E, and KR2 a 90-km-long segment near 60°S/152.5°E. We used profiles collected by Miniature Autonomous Plume Recorders (MAPRs) on rock corers in March and December of 2011 to survey each segment, and an intensive CTD survey in Jan/Feb 2013 to pinpoint sites and sample plumes on KR1. Optical and oxidation-reduction potential (ORP, aka Eh) anomalies indicate multiple active sites on both segments. Seven profiles on KR2 found 3 sites, each separated by ~25 km. Forty profiles on KR1 identified 13 sites, some within a few km of each other. The densest site concentration on KR1 occurred along a relatively inflated, 90-km-long section near the segment center. CTD tows covered 20 km of the eastern, most inflated portion of this area, finding two 6-km-long zones centered near 158.6°E and 158.8°E with multiple plume anomalies. Three ORP anomalies within 50 m of the seafloor indicate precise venting locations. We call this area the Mujin "Misty Harbor" vent field. Vent frequency sharply decreases away from Mujin. 3He/heat ratios determined from 20 plume samples in the Mujin field were mostly <0.015 fM/J, indicative of chronic venting, but 3 samples, 0.021-0.034 fM/J, are ratios typical of a recent eruption. The spatial density of hydrothermal activity along KR1 and KR2 is similar to other intermediate-rate spreading ridges. We calculate the plume incidence (ph) along

  5. Specific management of post-chikungunya rheumatic disorders: a retrospective study of 159 cases in Reunion Island from 2006-2012.

    Directory of Open Access Journals (Sweden)

    Emilie Javelle

    2015-03-01

    Full Text Available BACKGROUND: Since 2003, the tropical arthritogenic chikungunya (CHIK virus has become an increasingly medical and economic burden in affected areas as it can often result in long-term disabilities. The clinical spectrum of post-CHIK (pCHIK rheumatic disorders is wide. Evidence-based recommendations are needed to help physicians manage the treatment of afflicted patients. PATIENTS AND METHODS: We conducted a 6-year case series retrospective study in Reunion Island of patients referred to a rheumatologist due to continuous rheumatic or musculoskeletal pains that persisted following CHIK infection. These various disorders were documented in terms of their clinical and therapeutic courses. Post-CHIK de novo chronic inflammatory rheumatisms (CIRs were identified according to validated criteria. RESULTS: We reviewed 159 patient medical files. Ninety-four patients (59% who were free of any articular disorder prior to CHIK met the CIR criteria: rheumatoid arthritis (n=40, spondyloarthritis (n=33, undifferentiated polyarthritis (n=21. Bone lesions detectable by radiography occurred in half of the patients (median time: 3.5 years pCHIK. A positive therapeutic response was achieved in 54 out of the 72 patients (75% who were treated with methotrexate (MTX. Twelve out of the 92 patients (13% received immunomodulatory biologic agents due to failure of contra-indication of MTX treatment. Other patients mainly presented with mechanical shoulder or knee disorders, bilateral distal polyarthralgia that was frequently associated with oedema at the extremities and tunnel syndromes. These pCHIK musculoskeletal disorders (MSDs were managed with pain-killers, local and/or general anti-inflammatory drugs, and physiotherapy. CONCLUSION: Rheumatologists in Reunion Island managed CHIK rheumatic disorders in a pragmatic manner following the outbreak in 2006. This retrospective study describes the common mechanical and inflammatory pCHIK disorders. We provide a diagnostic

  6. MCM-41 mesoporous silica nanoparticles functionalized with aptamer and radiolabelled with 90Y and 159Gd as a potential therapeutic agent against colorectal cancer

    International Nuclear Information System (INIS)

    Ferreira, Carolina de Aguiar

    2014-01-01

    Colorectal cancer (CRC) is a malignancy that affects large intestine and rectum, and it is the most common malignancy of the gastrointestinal tract, the third most commonly diagnosed type of cancer in the world and the second leading cause of cancer-related death in the United States. Nowadays, available therapeutic procedures for this type of cancer are limited and ineffective. Conventional radiotherapy is not an often used approach in the treatment of CRC due to the fact that peristaltic movements hamper the targeting of ionizing radiation and this type of treatment is used as adjuvant and palliative to control symptoms. Therefore, surgical intervention is the primary therapeutic choice against this disease. Researches based on the combination of radioisotopes and nanostructured carriers systems have demonstrated significant results in improving the selectivity action as well as reducing the radiation dose into healthy tissues. MCM-41 mesoporous silica nanoparticles have unique characteristics such as high surface area and well-defined pore diameters making these nanoparticles an ideal candidate of therapeutic agent carrier. Thus, the objective of this work is to synthesize and characterize MCM-41 mesoporous silica nanoparticles conjugated with yttrium-90 and gadolinium-159 and evaluate this system as a potential therapeutic agent. The nanoparticles were synthesized via sol-gel method. The sample was characterized using FTIR, SAXS, PCS, Zeta Potential analysis, Thermal analysis, CHN elemental analysis, nitrogen adsorption, scanning and transmission electron microscopy. The ability to incorporate Y +3 and Gd +3 ion was determined in vitro using different ratios (1:1, 1:3, 1:5 v/v) of YCL 3 and Gd 2 O 3 and silica nanoparticles dispersed in saline, pH 7.4. The non-incorporated Y +3 and Gd +3 ions were removed by ultracentrifugation procedure and the concentration of ions in the supernatant was determined by ICP-AES. Cell viability was assessed by colorimetric MTT

  7. Synthesis and characterization of nano structures of Silica SBA-16 containing Gadolinium-159 as potential nanoparticulated system for cancer therapy; Sintese e caracterizacao de nanoestruturas de Silica SBA-16 contendo Gadolinio-159 como potencial sistema nanoparticulado para o tratamento do cancer

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Andre Felipe de

    2013-07-01

    Cancer is a leading cause of death worldwide, and malignant neoplasms of the lung, stomach, liver, colon and breast in greater numbers. And recently observed in the literature a large number of reviews where new materials, especially nanoparticle, has been studied as drug carriers and radioisotopes applied to cancer treatment. How mesoporous materials based on silica, thanks to its huge surface area and biocompatibility, have been studied intensively providing broad applications in various areas, the use of nanostructured silica SBA-16 might be a carrier specific radioisotope accumulate in the cells malignant. Thus the aim of this study is to develop in vitro studies using SBA-16 can selectively concentrate in malignant cells therapeutic amounts of the radioisotope Gadolinium-159 escorting them to death. This work was performed orderly synthesis of mesoporous silica, SBA-16 and incorporating the complex Gd-DTPA-BMA, as well as chemical and structural characterization. The techniques used to analyze the occurrence of the incorporation of the gadolinium complex in the silica matrix were elemental analysis (CHN), atomic emission spectroscopy (ICP-AES), infrared spectroscopy (FTIR), nitrogen adsorption (BET), small-angle X-ray scattering (SAXS) and thermogravimetric analysis (TG). To analyze the morphology of pure silica used the scanning electron microscopy (SEM) and transmission electron microscopy (TEM). By photon correlation spectroscopy (PCS) it was possible to obtain a measure of mean particle size, the polydispersity index (PDI) of the silica SBA-16, and the zeta potential by laser Doppler anemometry (LDA). The results of incorporation analyzed by ICP-AES indicated that the material SBA-16 had a higher rate of incorporation of gadolinium (93%). The release kinetics in simulated body fluid, showed considerable stability and low release (1%). The mesoporous silica SBA-16 showed cell viability in direct contact with cell culture. Samples with gadolinium

  8. MCM-41 mesoporous silica nanoparticles functionalized with aptamer and radiolabelled with {sup 90}Y and {sup 159}Gd as a potential therapeutic agent against colorectal cancer; Nanoparticulas de silica mesoporosa MCM-41 funcionalizadas com aptamero e radiomarcadas com {sup 90}Y e {sup 159}Gd como um potencial agente terapeutico contra cancer colorretal

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Carolina de Aguiar

    2014-06-01

    Colorectal cancer (CRC) is a malignancy that affects large intestine and rectum, and it is the most common malignancy of the gastrointestinal tract, the third most commonly diagnosed type of cancer in the world and the second leading cause of cancer-related death in the United States. Nowadays, available therapeutic procedures for this type of cancer are limited and ineffective. Conventional radiotherapy is not an often used approach in the treatment of CRC due to the fact that peristaltic movements hamper the targeting of ionizing radiation and this type of treatment is used as adjuvant and palliative to control symptoms. Therefore, surgical intervention is the primary therapeutic choice against this disease. Researches based on the combination of radioisotopes and nanostructured carriers systems have demonstrated significant results in improving the selectivity action as well as reducing the radiation dose into healthy tissues. MCM-41 mesoporous silica nanoparticles have unique characteristics such as high surface area and well-defined pore diameters making these nanoparticles an ideal candidate of therapeutic agent carrier. Thus, the objective of this work is to synthesize and characterize MCM-41 mesoporous silica nanoparticles conjugated with yttrium-90 and gadolinium-159 and evaluate this system as a potential therapeutic agent. The nanoparticles were synthesized via sol-gel method. The sample was characterized using FTIR, SAXS, PCS, Zeta Potential analysis, Thermal analysis, CHN elemental analysis, nitrogen adsorption, scanning and transmission electron microscopy. The ability to incorporate Y{sup +3} and Gd{sup +3} ion was determined in vitro using different ratios (1:1, 1:3, 1:5 v/v) of YCL{sub 3} and Gd{sub 2}O{sub 3} and silica nanoparticles dispersed in saline, pH 7.4. The non-incorporated Y{sup +3} and Gd{sup +3} ions were removed by ultracentrifugation procedure and the concentration of ions in the supernatant was determined by ICP-AES. Cell viability

  9. Synthesis and characterization of phosphors based on calcium and magnesium silicates doped with europium and dysprosium; Síntese e caracterização de fósforos a base de silicatos de cálcio e magnésio dopados com európio e disprósio

    Energy Technology Data Exchange (ETDEWEB)

    Misso, Agatha Matos

    2016-07-01

    Ca and Mg silicates based phosphors were prepared by sol-gel method combined with the molten salts process. The gel of silica was obtained from Na{sub 2}SiO{sub 3} solution by using europium, dysprosium, calcium and magnesium chloride solutions. Therefore, those chlorides were homogeneously dispersed into the gel. The obtained gel was dried and heat treated to 900° C for 1h to allow the fusion of the present salts. Then it was water washed until negative test for Cl{sup -}, and dried. The reduction of the europium to Eu{sup 2+} was performed under atmosphere of 5% of H{sub 2} and 95% of Ar to 900° C for 3h, to reach CaMgSi{sub 2}O{sub 6}:Eu{sup 2+} and CaMgSi{sub 2}O{sub 6}:Eu{sup 2+}:Dy{sup 3+} phosphors. Diopside was identified as main crystalline phase and quartz, as secondary phase from XRD (X-ray diffraction) patterns. SEM (scanning electron microscopy) micrographs, of the samples showed needles, spheres, leaves and rods of particles and agglomerates. Thermal analysis (TGA-DTGA) curves revealed that the crystallization temperature of CaMgSi{sub 2}O{sub 6}:Eu{sup 2+} lies around 765° C. Photoluminescence spectroscopy of the phosphors was studied based on interconfigurational 4f{sup N} → 4f{sup N-1} 5d transition of Eu{sup 2+} ion. The spectra of excitation showed 4f{sup N} → 4f{sup N-1} 5d transition of Eu{sup 2+} ion broad band, related to the ligand to metal charge transfer transition (LMCT) O{sup 2-} (2p) → Eu{sup 3+} in the 250 nm region, when the emission is monitored at 583,5 nm. It also presents the 4f ↔ 4f transitions of Eu{sup 3+} ion bands, showing the {sup 7}F{sub 0} → {sup 5}L{sub 6} transition at 393 nm. From emission spectra with excitation monitored at 393 nm, it can be observed fine peaks between 570 and 750 nm which are characteristics of {sup 5}D{sub 0} → {sup 7}F{sub J} (J = 0 - 5) transition of Eu{sup 3+} ion, indicating that the Eu{sup 3+} ion occupies a site with center of inversion. Finally, the obtained results indicate

  10. Photodissociation spectroscopy of the dysprosium monochloride molecular ion

    Energy Technology Data Exchange (ETDEWEB)

    Dunning, Alexander, E-mail: alexander.dunning@gmail.com; Schowalter, Steven J.; Puri, Prateek; Hudson, Eric R. [Department of Physics and Astronomy, University of California, Los Angeles, California 90095 (United States); Petrov, Alexander; Kotochigova, Svetlana [Department of Physics, Temple University, Philadelphia, Pennsylvania 19122 (United States)

    2015-09-28

    We have performed a combined experimental and theoretical study of the photodissociation cross section of the molecular ion DyCl{sup +}. The photodissociation cross section for the photon energy range 35 500 cm{sup −1} to 47 500 cm{sup −1} is measured using an integrated ion trap and time-of-flight mass spectrometer; we observe a broad, asymmetric profile that is peaked near 43 000 cm{sup −1}. The theoretical cross section is determined from electronic potentials and transition dipole moments calculated using the relativistic configuration-interaction valence-bond and coupled-cluster methods. The electronic structure of DyCl{sup +} is extremely complex due to the presence of multiple open electronic shells, including the 4f{sup 10} configuration. The molecule has nine attractive potentials with ionically bonded electrons and 99 repulsive potentials dissociating to a ground state Dy{sup +} ion and Cl atom. We explain the lack of symmetry in the cross section as due to multiple contributions from one-electron-dominated transitions between the vibrational ground state and several resolved repulsive excited states.

  11. Influence of dysprosium addition on the structural, morphological ...

    Indian Academy of Sciences (India)

    Microwave absorption properties of hexaferrite (70 wt%)–acrylic resin. (30 wt%) composites ... the RE ions were substituted for Sr (Ba) or Fe, taking into accounts the .... general the RE substitutions weaken the super exchange interactions ...

  12. Single molecule magnet behaviour in robust dysprosium-biradical complexes.

    Science.gov (United States)

    Bernot, Kevin; Pointillart, Fabrice; Rosa, Patrick; Etienne, Mael; Sessoli, Roberta; Gatteschi, Dante

    2010-09-21

    A Dy-biradical complex was synthesized and characterized down to very low temperature. ac magnetic measurements reveal single molecule magnet behaviour visible without any application of dc field. The transition to the quantum tunneling regime is evidenced. Photophysical and EPR measurements provide evidence of the excellent stability of these complexes in solution.

  13. Scissors Mode of Dipolar Quantum Droplets of Dysprosium Atoms

    Science.gov (United States)

    Ferrier-Barbut, Igor; Wenzel, Matthias; Böttcher, Fabian; Langen, Tim; Isoard, Mathieu; Stringari, Sandro; Pfau, Tilman

    2018-04-01

    We report on the observation of the scissors mode of a single dipolar quantum droplet. The existence of this mode is due to the breaking of the rotational symmetry by the dipole-dipole interaction, which is fixed along an external homogeneous magnetic field. By modulating the orientation of this magnetic field, we introduce a new spectroscopic technique for studying dipolar quantum droplets. This provides a precise probe for interactions in the system, allowing us to extract a background scattering length for 164Dy of 69 (4 )a0 . Our results establish an analogy between quantum droplets and atomic nuclei, where the existence of the scissors mode is also only due to internal interactions. They further open the possibility to explore physics beyond the available theoretical models for strongly dipolar quantum gases.

  14. Calorimetric investigation of an yttrium-dysprosium spin glass

    International Nuclear Information System (INIS)

    Wenger, L.E.

    1978-01-01

    In an effort to compare the spin glass characteristics of yttrium--rare earth alloys with those of the noble-metal spin glasses, the susceptibility and heat capacity of Y/sub 0.98/Dy/sub 0.02/ have been measured in the temperature range 2.5--40 K. The low-field ac susceptibility measurement shows the characteristic cusp-like peak at 7.64 K. The magnetic specific heat of the same sample shows a peak at 7.0 K and may be qualitatively described as a semi-cusp. The magnetic entropy change from absolute zero to 7 K is approximately 0.52 of cR ln(2J+1). These results are qualitatively different than previous calorimetric results on the archetypal spin glasses, AuFe and CuMn, where rounded maxima are observed at temperatures above the spin glass transition temperatures

  15. Emission spectra of yttrium vanadate doped with bismuth and dysprosium

    International Nuclear Information System (INIS)

    Pawar, B.V.; Patil, R.N.

    1975-01-01

    The fluorescence spectra of YVO 4 :Bi and YVO 4 :Bi:Dy phosphors under X-rays and ultra-violet radiation have been studied. The observations on the phosphors with constant Bi 3+ and varying Dy 3+ concentration can be attributed to radiationless transfer of energy from Bi 3+ to Dy 3+ coupled with non-radiative losses due to self-quenching at higher level of Dy 3+ concentration. While the observations on the phosphors with constant Dy 3+ and varying Bi 3+ concentration indicate that there is radiationless transfer from Bi 3+ to Dy 3+ under X-ray or UV irradiation. (author)

  16. Dysprosium-free melt-spun permanent magnets

    International Nuclear Information System (INIS)

    Brown, D N; Wu, Z; He, F; Miller, D J; Herchenroeder, J W

    2014-01-01

    Melt-spun NdFeB powders can be formed into a number of different types of permanent magnet for a variety of applications in electronics, automotive and clean technology industries. The melt-spinning process produces flake powder with a fine uniform array of nanoscale Nd 2 Fe 14 B grains. These powders can be net-shape formed into isotropic polymer-bonded magnets or hot formed into fully dense magnets. This paper discusses the influence of heavy rare earth elements and microstructure on the magnetic performance, thermal stability and material cost of NdFeB magnets. Evidence indicates that melt-spun nanocrystalline NdFeB magnets are less dependent on heavy rare earth elements for high-temperature performance than the alternative coarser-grained sintered NdFeB magnets. In particular, hot-pressed melt-spun magnets are an attractive low-cost solution for applications that require thermal stability up to 175–200 °C. (paper)

  17. Dysprosium-free melt-spun permanent magnets.

    Science.gov (United States)

    Brown, D N; Wu, Z; He, F; Miller, D J; Herchenroeder, J W

    2014-02-12

    Melt-spun NdFeB powders can be formed into a number of different types of permanent magnet for a variety of applications in electronics, automotive and clean technology industries. The melt-spinning process produces flake powder with a fine uniform array of nanoscale Nd2Fe14B grains. These powders can be net-shape formed into isotropic polymer-bonded magnets or hot formed into fully dense magnets. This paper discusses the influence of heavy rare earth elements and microstructure on the magnetic performance, thermal stability and material cost of NdFeB magnets. Evidence indicates that melt-spun nanocrystalline NdFeB magnets are less dependent on heavy rare earth elements for high-temperature performance than the alternative coarser-grained sintered NdFeB magnets. In particular, hot-pressed melt-spun magnets are an attractive low-cost solution for applications that require thermal stability up to 175-200 °C.

  18. Crystal and molecular structure of dysprosium (3) n-aminobenzoate

    International Nuclear Information System (INIS)

    Khiyalov, M.S.; Amiraslanov, I.R.; Mamedov, Kh.S.; Movsumov, Eh.M.

    1981-01-01

    The X ray diffraction investigation of the Dy(NH 2 C 6 H 4 COO) 3 x3H 2 O complex is carried out. Triclinic crystals have lattice parameters α=11.095(15), b=9.099(17), c=12.780 (15)A, α=108.051(12), β=89.072(10); γ=104.954(12) 0 , space group P anti 1, Z=2. The structure consists of dimer molecules. The third water molecule in the formula is an outer spherical one. The average lengths of Dy-O and Dy-OH 2 are 2.39 and 2.40 A respectively, the average value of Dy-O in bridge carboxylates (2.26A) is remarkably shorter. Hydrogen bonds between amine ligand ends, carboxylic groups oxygen and water molecules bind complex molecules into the three-dimensional frame [ru

  19. Microscopic study of neutron-rich dysprosium isotopes

    International Nuclear Information System (INIS)

    Vargas, Carlos E.; Velazquez, Victor; Lerma, Sergio

    2013-01-01

    Microscopic studies in heavy nuclei are very scarce due to large valence spaces involved. This computational problem can be avoided by means of the use of symmetry-based models. Ground-state, γ and β bands, and their B(E2) transition strengths in 160-168 Dy isotopes, are studied in the framework of the pseudo-SU(3) model which includes the preserving symmetry Q . Q term and the symmetry-breaking Nilsson and pairing terms, systematically parametrized. Additionally, three rotor-like terms are considered, whose free parameters, fixed for all members of the chain, are used to fine tune the moment of inertia of rotational bands and the band head of γ and β bands. The model succesfully describes in a systematic way rotational features in these nuclei and allows to extrapolate toward the midshell nucleus 170 Dy. The results presented show that it is possible to study a full chain of isotopes or isotones in the region with the present model. (orig.)

  20. Microscopic study of neutron-rich dysprosium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Vargas, Carlos E. [Universidad Veracruzana, Facultad de Fisica e Inteligencia Artificial, Xalapa (Mexico); Universidad Nacional Autonoma de Mexico, Facultad de Ciencias, Apartado Postal 70-542, Mexico D.F. (Mexico); Velazquez, Victor [Universidad Nacional Autonoma de Mexico, Facultad de Ciencias, Apartado Postal 70-542, Mexico D.F. (Mexico); Lerma, Sergio [Universidad Veracruzana, Facultad de Fisica e Inteligencia Artificial, Xalapa (Mexico)

    2013-01-15

    Microscopic studies in heavy nuclei are very scarce due to large valence spaces involved. This computational problem can be avoided by means of the use of symmetry-based models. Ground-state, {gamma} and {beta} bands, and their B(E2) transition strengths in {sup 160-168}Dy isotopes, are studied in the framework of the pseudo-SU(3) model which includes the preserving symmetry Q . Q term and the symmetry-breaking Nilsson and pairing terms, systematically parametrized. Additionally, three rotor-like terms are considered, whose free parameters, fixed for all members of the chain, are used to fine tune the moment of inertia of rotational bands and the band head of {gamma} and {beta} bands. The model succesfully describes in a systematic way rotational features in these nuclei and allows to extrapolate toward the midshell nucleus {sup 170}Dy. The results presented show that it is possible to study a full chain of isotopes or isotones in the region with the present model. (orig.)

  1. Structural and magnetic study of dysprosium substituted cobalt ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Hemaunt, E-mail: hvatsal@gmail.com [Department of Physics, Govind Ballabh Pant University of Agr. & Technology, Pantnagar, Uttarakhand 263145 (India); Srivastava, R.C. [Department of Physics, Govind Ballabh Pant University of Agr. & Technology, Pantnagar, Uttarakhand 263145 (India); Pal Singh, Jitendra [Advanced Analysis Centre, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Negi, P. [Department of Physics, Govind Ballabh Pant University of Agr. & Technology, Pantnagar, Uttarakhand 263145 (India); Agrawal, H.M. [Advanced Analysis Centre, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Das, D. [UGC-DAE CSR Kolkata Centre, Kolkata 700098 (India); Hwa Chae, Keun [Advanced Analysis Centre, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of)

    2016-03-01

    The present work investigates the magnetic behavior of Dy{sup 3+} substituted cobalt ferrite nanoparticles. X-ray diffraction studies reveal presence of cubic spinel phases in these nanoparticles. Raman spectra of these nanoparticles show change in intensity of Raman bands, which reflects cation redistribution in cubic spinel lattice. Saturation magnetization and coercivity decrease with increase of Dy{sup 3+}concentration in these nanoparticles. Room temperature Mössbauer measurements show the cation redistribution in these nanoparticles and corroborates the results obtained from Raman Spectroscopic measurements. Decrease in magnetization of Dy{sup 3+} substituted cobalt ferrite is attributed to the reduction in the magnetic interaction and cation redistribution. - Highlights: • Slight decrease in crystallite size after Dy{sup 3+} doping. • Saturation magnetization and coercivity decrease after Dy{sup 3+} doping. • Mössbauer measurements show the cation redistribution in the samples.

  2. Dysprosium Acetylacetonato Single-Molecule Magnet Encapsulated in Carbon Nanotubes

    Directory of Open Access Journals (Sweden)

    Ryo Nakanishi

    2016-12-01

    Full Text Available Dy single-molecule magnets (SMMs, which have several potential uses in a variety of applications, such as quantum computing, were encapsulated in multi-walled carbon nanotubes (MWCNTs by using a capillary method. Encapsulation was confirmed by using transmission electron microscopy (TEM. In alternating current magnetic measurements, the magnetic susceptibilities of the Dy acetylacetonato complexes showed clear frequency dependence even inside the MWCNTs, meaning that this hybrid can be used as magnetic materials in devices.

  3. RECQ1 A159C Polymorphism Is Associated With Overall Survival of Patients With Resected Pancreatic Cancer: A Replication Study in NRG Oncology Radiation Therapy Oncology Group 9704

    Energy Technology Data Exchange (ETDEWEB)

    Li, Donghui, E-mail: dli@mdanderson.org [Department of Gastrointestinal Medical Oncology, University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Moughan, Jennifer [NRG Oncology Statistics and Data Management Center, Philadelphia, Pennsylvania (United States); Crane, Christopher [Department of Gastrointestinal Medical Oncology, University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Hoffman, John P. [Department of Surgical Oncology, Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Regine, William F. [Department of Radiation Oncology, University of Maryland, Baltimore, Maryland (United States); Abrams, Ross A. [Rush University Medical Center, Chicago, Illinois (United States); Safran, Howard [Brown University Oncology Group, Providence, Rhode Island (United States); Liu, Chang; Chang, Ping [Department of Gastrointestinal Medical Oncology, University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Freedman, Gary M. [Department of Radiation Oncology, University of Pennsylvania, Philadelphia, Pennsylvania (United States); Winter, Kathryn A. [NRG Oncology Statistics and Data Management Center, Philadelphia, Pennsylvania (United States); Guha, Chandan [Department of Radiation Oncology, Montefiore Medical Center, Bronx, New York (United States); Abbruzzese, James L. [Duke University Medical Center, Durham, North Carolina (United States)

    2016-03-01

    Purpose: To confirm whether a previously observed association between RECQ1 A159C variant and clinical outcome of resectable pancreatic cancer patients treated with preoperative chemoradiation is reproducible in another patient population prospectively treated with postoperative chemoradiation. Methods and Materials: Patients were selected, according to tissue availability, from eligible patients with resected pancreatic cancer who were enrolled on the NRG Oncology Radiation Therapy Oncology Group 9704 trial of 5-fluorouacil (5-FU)-based chemoradiation preceded and followed by 5-FU or gemcitabine. Deoxyribonucleic acid was extracted from paraffin-embedded tissue sections, and genotype was determined using the Taqman method. The correlation between genotype and overall survival was analyzed using a Kaplan-Meier plot, log-rank test, and multivariate Cox proportional hazards models. Results: In the 154 of the study's 451 eligible patients with evaluable tissue, genotype distribution followed Hardy-Weinberg equilibrium (ie, 37% had genotype AA, 43% AC, and 20% CC). The RECQ1 variant AC/CC genotype carriers were associated with being node positive compared with the AA carrier (P=.03). The median survival times (95% confidence interval [CI]) for AA, AC, and CC carriers were 20.6 (16.3-26.1), 18.8 (14.2-21.6), and 14.2 (10.3-21.0) months, respectively. On multivariate analysis, patients with the AC/CC genotypes were associated with worse survival than patients with the AA genotype (hazard ratio [HR] 1.54, 95% CI 1.07-2.23, P=.022). This result seemed slightly stronger for patients on the 5-FU arm (n=82) (HR 1.64, 95% CI 0.99-2.70, P=.055) than for patients on the gemcitabine arm (n=72, HR 1.46, 95% CI 0.81-2.63, P=.21). Conclusions: Results of this study suggest that the RECQ1 A159C genotype may be a prognostic or predictive factor for resectable pancreatic cancer patients who are treated with adjuvant 5-FU before and after 5-FU-based chemoradiation. Further study is

  4. MicroRNA profiling of tomato leaf curl new delhi virus (tolcndv infected tomato leaves indicates that deregulation of mir159/319 and mir172 might be linked with leaf curl disease

    Directory of Open Access Journals (Sweden)

    Haq Qazi MR

    2010-10-01

    Full Text Available Abstract Background Tomato leaf curl virus (ToLCV, a constituent of the genus Begomovirus, infects tomato and other plants with a hallmark disease symptom of upward leaf curling. Since microRNAs (miRs are known to control plants developmental processes, we evaluated the roles of miRNAs in Tomato leaf curl New Delhi virus (ToLCNDV induced leaf curling. Results Microarray analyses of miRNAs, isolated from the leaves of both healthy and ToLCNDV agroinfected tomato cv Pusa Ruby, revealed that ToLCNDV infection significantly deregulated various miRNAs representing ~13 different conserved families (e.g., miR319, miR172, etc.. The precursors of these miRNAs showed similar deregulated patterns, indicating that the transcription regulation of respective miRNA genes was perhaps the cause of deregulation. The expression levels of the miRNA-targeted genes were antagonistic with respect to the amount of corresponding miRNA. Such deregulation was tissue-specific in nature as no analogous misexpression was found in flowers. The accumulation of miR159/319 and miR172 was observed to increase with the days post inoculation (dpi of ToLCNDV agroinfection in tomato cv Pusa Ruby. Similarly, these miRs were also induced in ToLCNDV agroinfected tomato cv JK Asha and chilli plants, both exhibiting leaf curl symptoms. Our results indicate that miR159/319 and miR172 might be associated with leaf curl symptoms. This report raises the possibility of using miRNA(s as potential signature molecules for ToLCNDV infection. Conclusions The expression of several host miRNAs is affected in response to viral infection. The levels of the corresponding pre-miRs and the predicted targets were also deregulated. This change in miRNA expression levels was specific to leaf tissues and observed to be associated with disease progression. Thus, certain host miRs are likely indicator of viral infection and could be potentially employed to develop viral resistance strategies.

  5. Les conjonctivites néonatales dans le canton de Glidji au Sud du Togo: une étude transversale à propos de 159 nouveau-nés

    Science.gov (United States)

    Kokou, Vonor; Nidain, Maneh; Kassoula, Nononsaa Batomguela; Kwassi, Fiaty- Amenouvor; Meba, Banla; Patrice, Balo Komi

    2016-01-01

    Introduction Le but de l’étude était décrire les aspects épidémiologiques des conjonctivites néonatales dans le canton de Glidji au Sud du Togo. Methodes Nous avons mené une étude transversale dans les 4 Unités Sanitaires Périphériques du canton de Glidji du 19 Mars au 13 Mai 2009 soit 8 semaines. Tous les nouveau-nés ont été inclus et la conjonctivite néonatale était définie par la présence chez un nouveau-né d'au moins deux des signes suivants: hyperhémie conjonctivale, œdème palpébral, chémosis, sécrétions purulentes, larmoiement. Les paramètres étudiés étaient l’âge, le sexe, les facteurs de risque, les antécédents, la présence ou non de conjonctivite, les germes en causes et l’évolution sous traitement. Resultats Sur la période, 159 nouveau-nés ont été examinés. L’âge moyen était de 10,9 jours avec des extrêmes de 0 à 28 jours. Il y avait 80 garçons pour 79 filles soit un sex-ratio de 1,01. Sur les 159 nouveau-nés, 7 cas de conjonctivite ont été diagnostiqués soit une prévalence de 4,4%. Les facteurs de risque identifiés étaient l'accouchement par voie basse et la présence d'IST chez la mère pendant la grossesse. Sur les 7 cas de conjonctivite, l'examen cytobactériologique a permis d'isoler le staphylococcus aureus dans 2 cas. L’évolution des cas de conjonctivite sous traitement était favorable avec régression des signes dès le 3è jour. Conclusion Les conjonctivites néonatales avaient une prévalence de 4,4% dans le canton de Glidji au sud du Togo et le staphylocoque doré était le germe en cause. Leur prévention passe par un bon suivi lors de la consultation prénatale et l'instillation de collyre antibiotique à la naissance PMID:27642383

  6. 45 CFR 159.110 - Definitions.

    Science.gov (United States)

    2010-10-01

    ...(b)(2) of the PHSA. Health Insurance Product: Means a package of benefits that an issuer offers that... Group Coverage: Means health insurance coverage offered to employees of small employers in the small... apply unless otherwise provided: Health Insurance Coverage: We adopt the Public Health Service Act (PHSA...

  7. 19 CFR 159.61 - General.

    Science.gov (United States)

    2010-04-01

    ... detail the duly authorized succession by which it is entitled to file the certification. (ii) A member... produced. A company, business or person that has ceased production of the product covered by the... under this section. (ii) Acquisition by related company—(A) Related company defined. A company, business...

  8. ZfI reports no. 159

    International Nuclear Information System (INIS)

    1990-08-01

    The Reports cover six contributions to various topics, five of which (nondestructive materials testing; gamma radiation transport model; mathematical modelling of a special Compton tomography arrangement, of gamma radiation transport, and of a gamma radiation backscatter arrangement) are reported separately in the data bank. (BBR) [de

  9. Search Results | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    GFU for Underutilized Species : towards an enabling environment for the ... sector microcredit programs in Ghana : does infant and young child nutrition improve? ... effects on aquatic organisms, and points to new directions for future work.

  10. 159 THEORETICAL SYNTAX IN SECOND LANGUAGE ...

    African Journals Online (AJOL)

    Second language teaching practicioners have tried to a greater or lesser extent in the past to apply the insights of linguistic .... The actual processes, procedures, activities and techniques of teachers and learners within the classroom ..... English relative clauses by adult Spanish and Japanese speakers. In S. Gass and.

  11. Search Results | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Quantifying the direct and indirect effects of Dissolved Organic Matter (DOM) on ... quantitative open economy models to study international trade transmission, the ... cost, user-friendly risk mapping system that can be used in any community.

  12. 32 CFR 159.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... include an Internet Web site, consistent with security considerations and requirements). (f) The Heads of... Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE SECURITY PRIVATE SECURITY CONTRACTORS... accountability and visibility of contracts, contractors, and specified equipment associated with private security...

  13. 40 CFR 159.153 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... tolerance, food additive regulation, action level, or other limitation on pesticide residues imposed by law... requirement are: mammals, birds, reptiles, amphibians, fish, aquatic invertebrates, insects, arachnids...

  14. 32 CFR 159.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... identify the organization responsible for managing these processes: (i) Registering, processing, accounting... of weapons by civilians, and the Law of Armed Conflict. (E) Written acknowledgment by the PSC and its...

  15. 7 CFR 930.159 - Handler diversion.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... normal market channels. Products which are voluntarily destroyed must have deteriorated in condition to such an extent that they are not acceptable for use in normal market channels. (e) Contributions to...

  16. Search Results | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The diffusion of information and communication technologies (ICTs), notably the mobile ... Survey on the Use of Mobile Telephone for Micro and Small Business ... (ICTs) have become key factors driving social and economic advancement.

  17. 19 CFR 159.63 - Certifications.

    Science.gov (United States)

    2010-04-01

    ... the Assistant Commissioner, Office of Finance, Headquarters, or designee, that must be received within...; acquisition by related company. The statement must include information as to whether the domestic producer... whether it has been acquired by a company or business that is related to a company, within the meaning of...

  18. 14 CFR 171.159 - Installation requirements.

    Science.gov (United States)

    2010-01-01

    ... Installation requirements. (a) The facility must be installed according to accepted good engineering practices... must have a reliable source of suitable primary power, either from a power distribution system or...

  19. Publications | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity ... Innovation and productivity in information technology services and ... than 700 Senegalese women for work in the agricultural sector in Spain since then.

  20. 76 FR 159 - Discretionary Grant Program

    Science.gov (United States)

    2011-01-03

    ... these funds to initiate an orderly closeout of HRSA-funded activities which clearly fall within the... Supplemental Funding: $250,000. Authority: Section 501(c)(1) of the Social Security Act, as amended. CFDA... requirements, deeming this quality check of sufficient importance to mandate successful participation as a...

  1. Page | 159 UNIVERSALITY OF PRISONERS' RIGHT AND ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Abstract. This paper examines the concept of human right as well as the universality in the application of the concept to the prisoners' welfare in most countries of the world. To determine the level of conformity of this concept in Nigeria, the paper discusses the post-conviction problems prisoners face in Nigeria as against ...

  2. Assessment and management of children aged 1-59 months presenting with wheeze, fast breathing, and/or lower chest indrawing; results of a multicentre descriptive study in Pakistan.

    Science.gov (United States)

    Hazir, T; Qazi, S; Nisar, Y B; Ansari, S; Maqbool, S; Randhawa, S; Kundi, Z; Asghar, R; Aslam, S

    2004-11-01

    Using current WHO guidelines, children with wheezing are being over prescribed antibiotics and bronchodilators are underutilised. To improve the WHO case management guidelines, more data is needed about the clinical outcome in children with wheezing/pneumonia overlap. In a multicentre prospective study, children aged 1-59 months with auscultatory/audible wheeze and fast breathing and/or lower chest indrawing were screened. Response to up to three cycles of inhaled salbutamol was recorded. The responders were enrolled and sent home on inhaled bronchodilators, and followed up on days 3 and 5. A total of 1622 children with wheeze were screened from May 2001 to April 2002, of which 1004 (61.8%) had WHO defined non-severe and 618 (38.2%) severe pneumonia. Wheeze was audible in only 595 (36.7%) of children. Of 1004 non-severe pneumonia children, 621 (61.8%) responded to up to three cycles of bronchodilator. Of 618 severe pneumonia children, only 166 (26.8%) responded. Among responders, 93 (14.9%) in the non-severe and 63 (37.9%) children in the severe pneumonia group showed subsequent deterioration on follow ups. No family history of wheeze, temperature >100 degrees F, and lower chest indrawing were identified as predictors of subsequent deterioration. Two third of children with wheeze are not identified by current WHO ARI (acute respiratory infections) guidelines. Antibiotics are over prescribed and bronchodilators under utilised in children with wheeze. Children with wheeze constitute a special ARI group requiring a separate management algorithm. In countries where wheeze is common it would be worthwhile to train health workers in use of the stethoscope to identify wheeze.

  3. Adsorption of dysprosium on the graphite (0001) surface: Nucleation and growth at 300 K

    International Nuclear Information System (INIS)

    Kwolek, Emma J.; Lii-Rosales, Ann; Lei, Huaping; Wang, Cai-Zhuang; Tringides, Michael C.; Evans, James W.; Wallingford, Mark; Zhou, Yinghui; Thiel, Patricia A.

    2016-01-01

    We have studied nucleation and growth of Dy islands on the basal plane of graphite at 300 K using scanning tunneling microscopy, density functional theory (DFT) in a form that includes van der Waals interactions, and analytic theory. The interaction of atomic Dy with graphite is strong, while the diffusion barrier is small. Experiment shows that at 300 K, the density of nucleated islands is close to the value predicted for homogeneous nucleation, using critical nucleus size of 1 and the DFT-derived diffusion barrier. Homogeneous nucleation is also supported by the monomodal shape of the island size distributions. Comparison with the published island density of Dy on graphene shows that the value is about two orders of magnitude smaller on graphite, which can be attributed to more effective charge screening in graphite. The base of each island is 3 atomic layers high and atomically ordered, forming a coincidence lattice with the graphite. Islands resist coalescence, probably due to multiple rotational orientations associated with the coincidence lattice. Upper levels grow as discernible single-atom layers. Analysis of the level populations reveals significant downward interlayer transport, which facilitates growth of the base. This island shape is metastable, since more compact three-dimensional islands form at elevated growth temperature.

  4. Dysprosium separation from aqueous phase by non-dispersive solvent extraction employing hollow fibre membrane module

    International Nuclear Information System (INIS)

    Yadav, Kartikey K.; Singh, D.K.; Kain, V.

    2017-01-01

    Rare earth elements (REEs) consist of fourteen lanthanides and three elements which are Sc, Y and La resulting in total 17 REEs. In the last decade, these rare earths elements which have unique physical and chemical properties have been highly in demand for their application in almost all walks of life. Various methods such as ion exchange, precipitation and solvent extraction have been used to recover these elements from aqueous solutions. These traditional methods have some inherent disadvantages like handling of hazardous organic chemicals, ineffectiveness to recover a very low concentration of contaminated source etc. In this regard, an important method i.e. liquid membrane offers separation scheme; which combines the characteristics, of solvent extraction and solid membrane separation, to overcome the disadvantages of conventional techniques. Various experiments were carried out to evaluate the effect of feed acidity, metal ion concentration, carrier concentration, feed composition, flow rates and phase ratio on the transport of rare earths metal ions across the membrane

  5. Manufacturing of Dysprosium-Iron Alloys by Electrolysis in Fluoride-Based Electrolytes: Oxide Solubility Determinations

    Science.gov (United States)

    Martinez, Ana Maria; Støre, Anne; Osen, Karen Sende

    2018-04-01

    Electrolytic production of light rare earth elements and alloys takes place in a fluoride-based electrolyte using rare earth oxides as raw material. The optimization of this method, mainly in terms of the energy efficiency and environmental impact control, is rather challenging. Anode effects, evolution of fluorine-containing compounds, and side cathode reactions could largely be minimized by a good control of the amount of rare earth oxide species dissolved in the fluoride-based electrolyte and their dissolution rate. The oxide content of the fluoride melts REF3-LiF (RE = Nd, Dy) at different compositions and temperatures were experimentally determined by carbothermal analysis of melt samples. The highest solubility values of oxide species, added as Dy2O3 and Dy2(CO3)3, were obtained to be of ca. 3 wt pct (expressed as Dy2O3) in the case of the equimolar DyF3-LiF melt at 1323 K (1050 °C). The oxide saturation values increased with the amount of REF3 present in the molten bath and the working temperature.

  6. A naproxen complex of dysprosium intercalates into calf thymus DNA base pairs

    International Nuclear Information System (INIS)

    Yang, Mengsi; Jin, Jianhua; Xu, Guiqing; Cui, Fengling; Luo, Hongxia

    2014-01-01

    Highlights: • Binding mode to ctDNA was studied by various methods. • Intercalation is the most possible binding mode. • Dynamic and static quenching occurred simultaneously. • Hydrophobic force played a major role. • Binding characteristic of rare earth complexes to DNA are dependent on the element. - Abstract: The binding mode and mechanism of dysprosium–naproxen complex (Dy–NAP) with calf thymus deoxyribonucleic acid (ctDNA) were studied using UV–vis and fluorescence spectra in physiological buffer (pH 7.4). The results showed that more than one type of quenching process occurred and the binding mode between Dy–NAP with ctDNA might be intercalation. In addition, ionic strength, iodide quenching and fluorescence polarization experiments corroborated the intercalation binding mode between Dy–NAP and ctDNA. The calculated thermodynamic parameters ΔG, ΔH and ΔS at different temperature demonstrated that hydrophobic interaction force played a major role in the binding process

  7. White light emission and color tunability of dysprosium doped barium silicate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, Lokesh; Sharma, Anchal; Vishwakarma, Amit K.; Jha, Kaushal [Department of Applied Physics, Delhi Technological University, Delhi 110042 (India); Jayasimhadri, M., E-mail: jayaphysics@yahoo.com [Department of Applied Physics, Delhi Technological University, Delhi 110042 (India); Ratnam, B.V.; Jang, Kiwan [Department of Physics, Changwon National University, Changwon 641-77 (Korea, Republic of); Rao, A.S.; Sinha, R.K. [Department of Applied Physics, Delhi Technological University, Delhi 110042 (India)

    2016-01-15

    The present work elucidates the synthesis of Dy{sup 3+} doped barium silicate glasses, along with the subsequent studies performed to evaluate its viability in solid state lighting applications. The synthesized photonic glasses were investigated via X-Ray Diffraction, Scanning Electron Microscopy and Fourier Transform Infrared Spectroscopy. The photoluminescence properties were examined under ultraviolet (UV)/near UV (NUV) excitation. Photoluminescence spectrum exhibited characteristic emission bands at λ{sub em}=483 nm (blue) and λ{sub em}=576 nm (yellow) which are ascribed to the {sup 4}F{sub 9/2}→{sup 6}H{sub 15/2} and {sup 4}F{sub 9/2}→{sup 6}H{sub 13/2} transitions of Dy{sup 3+} ion, respectively. The chromaticity coordinates under excitation of λ{sub ex}=348 nm are (0.31, 0.34), which lies in the white region of CIE 1931 chromaticity diagram and are in excellent proximity with the standard equal energy white illuminant (0.333, 0.333). The calculated correlated color temperature and the yellow to blue (Y/B) ratio are found to be 6602 K and 1.12, respectively for the optimized sample. The synthesized photonic glass also offered the possibility of tuning the color as exemplified through the variation in CIE coordinates, correlated color temperature and the Y/B ratio. The results confirm the possibility of color tunability from the proposed glass and may be useful for various photonic device applications. - Highlights: • Successfully synthesized Dy{sup 3+} doped barium silicate glasses. • Structural properties thoroughly discussed by using XRD and FT-IR. • Photoluminescence and colorimetry properties have been investigated. • Y/B ratio and the reason for color tunability have been successfully explained. • CIE coordinates of Dy{sup 3+}:BBS glass confirm its suitability for w-LEDs.

  8. New ultrasonic attenuation maxima for single crystal dysprosium in a magnetic field

    International Nuclear Information System (INIS)

    Treder, R.A.; Maekawa, S.; Levy, M.

    1976-01-01

    The temperatures and corresponding applied basal plane magnetic fields are reported for longitudinal ultrasonic attenuation maxima in a cylindrical Dy sample. Besides maxima at Tsub(N) and Tsub(C), two new maxima are observed and possible explanations for their existence are given. (Auth.)

  9. Adsorption of dysprosium on the graphite (0001) surface: Nucleation and growth at 300 K

    Energy Technology Data Exchange (ETDEWEB)

    Kwolek, Emma J.; Lii-Rosales, Ann [The Ames Laboratory, Ames, Iowa 50011 (United States); Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Lei, Huaping; Wang, Cai-Zhuang; Tringides, Michael C.; Evans, James W. [The Ames Laboratory, Ames, Iowa 50011 (United States); Department of Physics and Astronomy, Iowa State University, Ames, Iowa 50011 (United States); Wallingford, Mark; Zhou, Yinghui [The Ames Laboratory, Ames, Iowa 50011 (United States); Thiel, Patricia A., E-mail: pthiel@iastate.edu [The Ames Laboratory, Ames, Iowa 50011 (United States); Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Department of Materials Science and Engineering, Iowa State University, Ames, Iowa 50011 (United States)

    2016-12-07

    We have studied nucleation and growth of Dy islands on the basal plane of graphite at 300 K using scanning tunneling microscopy, density functional theory (DFT) in a form that includes van der Waals interactions, and analytic theory. The interaction of atomic Dy with graphite is strong, while the diffusion barrier is small. Experiment shows that at 300 K, the density of nucleated islands is close to the value predicted for homogeneous nucleation, using critical nucleus size of 1 and the DFT-derived diffusion barrier. Homogeneous nucleation is also supported by the monomodal shape of the island size distributions. Comparison with the published island density of Dy on graphene shows that the value is about two orders of magnitude smaller on graphite, which can be attributed to more effective charge screening in graphite. The base of each island is 3 atomic layers high and atomically ordered, forming a coincidence lattice with the graphite. Islands resist coalescence, probably due to multiple rotational orientations associated with the coincidence lattice. Upper levels grow as discernible single-atom layers. Analysis of the level populations reveals significant downward interlayer transport, which facilitates growth of the base. This island shape is metastable, since more compact three-dimensional islands form at elevated growth temperature.

  10. An operationally simple method for separating the rare-earth elements neodymium and dysprosium

    Energy Technology Data Exchange (ETDEWEB)

    Bogart, Justin A.; Lippincott, Connor A.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)

    2015-07-06

    Rare-earth metals are critical components of electronic materials and permanent magnets. Recycling of consumer materials is a promising new source of rare earths. To incentivize recycling there is a clear need for simple methods for targeted separations of mixtures of rare-earth metal salts. Metal complexes of a tripodal nitroxide ligand [{(2-"tBuNO)C_6H_4CH_2}{sub 3}N]{sup 3-} (TriNOx{sup 3-}), feature a size-sensitive aperture formed of its three η{sup 2}-(N,O) ligand arms. Exposure of metal cations in the aperture induces a self-associative equilibrium comprising [M(TriNOx)thf]/[M(TriNOx)]{sub 2} (M=rare-earth metal). Differences in the equilibrium constants (K{sub eq}) for early and late metals enables simple Nd/Dy separations through leaching with a separation ratio S{sub Nd/Dy}=359. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. An Operationally Simple Method for Separating the Rare-Earth Elements Neodymium and Dysprosium.

    Science.gov (United States)

    Bogart, Justin A; Lippincott, Connor A; Carroll, Patrick J; Schelter, Eric J

    2015-07-06

    Rare-earth metals are critical components of electronic materials and permanent magnets. Recycling of consumer materials is a promising new source of rare earths. To incentivize recycling there is a clear need for simple methods for targeted separations of mixtures of rare-earth metal salts. Metal complexes of a tripodal nitroxide ligand [{(2-(t) BuNO)C6 H4 CH2 }3 N](3-) (TriNOx(3-) ), feature a size-sensitive aperture formed of its three η(2) -(N,O) ligand arms. Exposure of metal cations in the aperture induces a self-associative equilibrium comprising [M(TriNOx)thf]/ [M(TriNOx)]2 (M=rare-earth metal). Differences in the equilibrium constants (Keq ) for early and late metals enables simple Nd/Dy separations through leaching with a separation ratio SNd/Dy =359. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Cerium: an unlikely replacement of dysprosium in high performance Nd-Fe-B permanent magnets.

    Science.gov (United States)

    Pathak, Arjun K; Khan, Mahmud; Gschneidner, Karl A; McCallum, Ralph W; Zhou, Lin; Sun, Kewei; Dennis, Kevin W; Zhou, Chen; Pinkerton, Frederick E; Kramer, Matthew J; Pecharsky, Vitalij K

    2015-04-24

    Replacement of Dy and substitution of Nd in NdFeB-based permanent magnets by Ce, the most abundant and lowest cost rare earth element, is important because Dy and Nd are costly and critical rare earth elements. The Ce, Co co-doped alloys have excellent high-temperature magnetic properties with an intrinsic coercivity being the highest known for T ≥ 453 K. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. A Linear Tetranuclear Dysprosium(III) Compound Showing Single-Molecule Magnet Behavior

    Energy Technology Data Exchange (ETDEWEB)

    Ke, Hongshan; Xu, Gong Feng; Guo, Yun-Nan; Gamez, Patrick; Beavers, Christine M; Teat, Simon J; Tang, Jinkui

    2010-04-20

    Although magnetic measurements reveal a single-relaxation time for a linear tetranuclear Dy(III) compound, the wide distribution of the relaxation time observed clearly suggests the presence of two slightly different anisotropic centres, therefore opening new avenues for investigating the relaxation dynamics of lanthanide aggregates.

  14. Experimental study of induced staggered magnetic fields in dysprosium gallium garnet (DGG)

    International Nuclear Information System (INIS)

    Steiner, M.; Corliss, L.M.; Hastings, J.M.; Blume, M.; Giordano, N.; Wolf, W.P.

    1979-01-01

    Neutron diffraction techniques have been used to study induced staggered magnetic field effects in DGG. The application of a uniform magnetic field at temperatures much greater than the Neel temperature induces a significant amount of antiferromagnetic order. The temperature and field dependences of this effect are in good agreement with recent theoretical predicions

  15. Influence of dysprosium and terbium additions on aluminium structure and properties

    International Nuclear Information System (INIS)

    Fridlyander, I.N.; Sokolovskaya, E.M.; Zimina, E.N.; Tkachenko, E.A.; Artemova, M.S.

    1992-01-01

    The influence of 0.3%Dy and 0.3%Tb additions were investigated on grain size in aluminium ingots and on recrystallization and mechanical properties in 1.5 mm thick sheets. Grain refinement in ingots was revealed along with an increase of sheet recrystallization temperature and grain growth retardation in the process of secondary recrystallization. Ultimate strength was found to rise at some decrease of specific elongation

  16. Improvement of high-frequency characteristics of Z-type hexaferrite by dysprosium doping

    International Nuclear Information System (INIS)

    Mu Chunhong; Liu Yingli; Song Yuanqiang; Wang Liguo; Zhang Huaiwu

    2011-01-01

    Z-type hexaferrite has great potential applications as anti-EMI material for magnetic devices in the GHz region. In this work, Dy-doped Z-type hexaferrites with nominal stoichiometry of Ba 3 Co 2 Dy x Fe 24-x O 41 (x 0.0, 0.05, 0.5, 1.0) were prepared by an improved solid-state reaction method. The effects of rare earth oxide (Dy 2 O 3 ) addition on the phase composition, microstructure and electromagnetic properties of the ceramics were investigated. Structure and micromorphology characterizations indicate that certain content of Dy doping will cause the emergence of the second phase Dy 3 Fe 5 O 12 at the grain boundaries of the majority phase Z-type hexaferrite, due to which the straightforward result is the grain refinement during the successive sintering process. Permeability spectra measurements show that the initial permeability reaches its maximum of 17 at 300 MHz with x = 0.5, while the cutoff frequency keeps above 800 MHz. The apparent specific anisotropy field H K of Dy-doped Z-type hexaferrites decreases with x increasing. The relationships among phase composition, grain size, permeability spectra, and anisotropy are theoretically investigated, and according to the analysis, Dy doping effects on its magnetic properties can be well explained and understood.

  17. Synthesis, photoluminescence and intramolecular energy transfer model of a dysprosium complex

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Aiqin; Zhang Jiuli; Pan Qiliang; Wang Shuhua [College of Materials Science and Engineering, Taiyuan University of Technology, No. 79 West Yingze Street, Taiyuan, Shanxi 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials of Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); Jia Husheng, E-mail: Jia_Husheng@126.com [College of Materials Science and Engineering, Taiyuan University of Technology, No. 79 West Yingze Street, Taiyuan, Shanxi 030024 (China) and Key Laboratory of Interface Science and Engineering in Advanced Materials of Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); Xu Bingshe [College of Materials Science and Engineering, Taiyuan University of Technology, No. 79 West Yingze Street, Taiyuan, Shanxi 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials of Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China)

    2012-04-15

    The energy of the highest occupied molecular orbital and the lowest unoccupied molecular orbital as well as their energy gaps, and the singlet and triplet state energy levels of 4-benzoylbenzoic acid (HL=4-BBA) and triphenylphosphine oxide (TPPO) were calculated with the Gaussian03 program package. The singlet state and triplet state energy levels were also estimated from the UV-vis absorption spectra and phosphorescence spectra. The results suggest that the calculated values approximately coincided with the experimental values. A Dy(III) complex was synthesized with 4-BBA as primary ligand and TPPO as neutral ligand. The structure of the complex was characterized by elemental analysis, {sup 1}H NMR spectrometry, and FTIR spectrometry. TG-DTG analysis indicates that the complex kept stable up to 305 Degree-Sign C. The photoluminescence properties were studied by fluorescence spectrometry. The results show that Dy(III) ion sensitized by 4-BBA and TPPO emitted characteristic peaks at 572 nm ({sup 4}F{sub 9/2}-{sup 6}H{sub 13/2}) and 480 nm ({sup 4}F{sub 9/2}-{sup 6}H{sub 15/2}), and its Commission Internationale de L'Eclairge coordinates were calculated as x=0.33 and y=0.38, being located in the white range. Intermolecular energy transfer process was discussed and energy transfer model was also proposed. - Highlights: Black-Right-Pointing-Pointer Quantum calculation provides theoretical method of ligand choice for rare earth. Black-Right-Pointing-Pointer The complex Dy(L){sub 3}(TPPO){sub 2} emitted white light. Black-Right-Pointing-Pointer The CIE coordinates were calculated as x=0.33 and y=0.38. Black-Right-Pointing-Pointer Energy transfer in Dy(L){sub 3}(TPPO){sub 2} followed Dexter electron exchange theory.

  18. Crystal-field magnetic anisotropy of dilute dysprosium or erbium in yttrium single crystals

    DEFF Research Database (Denmark)

    Høg, J.; Touborg, P.

    1974-01-01

    Magnetization measurements have been performed between 1.3 and 300 K in fields up to 50 × 105 A/m in the a, b, and c directions of hcp crystals of pure Y and Y doped with 0.14-at.% Dy or 0.14-at.% Er, using the Faraday method and a vibrating-sample method. The characteristic behavior of both...

  19. Extraction and stripping of neodymium (III) and dysprosium (III) by TRUEX solvent

    International Nuclear Information System (INIS)

    Rout, Alok; Venkatesan, K.A.; Antony, M.P.; Srinivasan, T.G.; Vasudeva Rao, P.R.

    2009-01-01

    McCabe-Thiele diagram for the extraction and stripping of Nd (III) and Dy (III) by TRUEX solvent has been constructed to determine the number of stages required for complete extraction and stripping. (author)

  20. 159 Aspects technico-économiques de la transformation de ...

    African Journals Online (AJOL)

    PR BOKO

    plant species used as non-timber forest products such as timber and in public Savè and Glazoué in the hills department .... Par rapport aux vendeurs des objets de vannerie, les enquêtes ont été faites dans les marchés les arrêts de ... Dans la commune de Glazoué, l'enquête a été faite à Tiho et dans le marché de Glazoué.

  1. 33 CFR 159.126 - Coliform test: Type II devices.

    Science.gov (United States)

    2010-07-01

    ... follows: During each of the 10 test days, one sample must be taken at the beginning, middle and end of an 8-consecutive hour period with one additional sample taken immediately following the peak capacity...: Type II devices. (a) The arithmetic mean of the fecal coliform bacteria in 38 of 40 samples of effluent...

  2. 33 CFR 159.123 - Coliform test: Type I devices.

    Science.gov (United States)

    2010-07-01

    ... as follows: During each of the 10-test days, one sample must be taken at the beginning, middle, and end of an 8-consecutive hour period with one additional sample taken immediately following the peak...: Type I devices. (a) The arithmetic mean of the fecal coliform bacteria in 38 of 40 samples of effluent...

  3. Television Programming, Monopolistic Competition and Welfare. Technical Report No. 159.

    Science.gov (United States)

    Spence, Michael; Owen, Bruce

    An economic analysis of television programing was conducted focusing on the public welfare implications of alternative market structures and policies in the broadcasting industry. Welfare was measured by the sum of producer's and consumer's surplus. It was demonstrated that any of the private market systems considered contain biases against…

  4. People’s Republic of China Scientific Abstracts, Number 159

    Science.gov (United States)

    1976-12-14

    down sensation in the anal canal, lower abdominal pain and distension , borborygmus, urgency, and sudden passage of large amounts of fowl smelling...cases; bleeding from incompletely thrombosed artery after slough in 4 cases; injection of too large quantity or too deep causing muscular layer slough...reactions to treatment occurred. They included: sudden capillary distension , scattered red patches, foreign body rejection reaction and secondary

  5. Dicty_cDB: CHB159 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *tttkmlfkmstkt*m*sxplw*rmlc*ssprxmfiemxxrp*m*s*st wkrmlrccp*tttxmlikmsxkt*m*nxslw*rmlc*k*x*lfnl*rlkl*kkrftlc...wkrmlrccp*tttkmlfkmstkt*m*sxplw*rmlc*ssprxmfiemxxrp*m*s*st wkrmlrccp*tttxmlikmsxkt*m*nxslw*rmlc*k*x*lfnl*rlk

  6. 46 CFR 159.001-5 - Correspondence and applications.

    Science.gov (United States)

    2010-10-01

    ....001-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND... Correspondence and applications. Unless otherwise specified, all correspondence and applications in connection with approval and testing of equipment and materials must be addressed to: Commandant (CG-5214), U.S...

  7. Politsei ostab ja rendib 159 uut teenistusautot / Kadri Põldaru

    Index Scriptorium Estoniae

    Põldaru, Kadri

    2005-01-01

    Politseiamet sõlmib lepingu firmadega Amserv Auto ja Elke Auto, ostes nendelt ühispakkumise alusel 59 Toyota Corollat. 100 Nissan Primera kasutusrendiks sõlmib politsei lepingu AS-iga Balti Liising

  8. 19 CFR 159.34 - Certified quarterly rate.

    Science.gov (United States)

    2010-04-01

    ..., Denmark, Finland, France, Germany, Hong Kong, India, Iran, Ireland, Italy, Japan, Malaysia, Mexico... Customs purposes in connection with merchandise exported on such date. (2) Certified daily rate. If the... merchandise exported on such day. [T.D. 73-175, 38 FR 17482, July 2, 1973, as amended by T.D. 81-117, 46 FR...

  9. 36 CFR 1192.159 - Mobility aid accessibility.

    Science.gov (United States)

    2010-07-01

    ... covered by this subpart shall provide a level-change mechanism or boarding device (e.g., lift or ramp... provide other appropriate mechanisms or systems, to ensure that the vehicle cannot be moved when the lift... entrance ramp) shall not deflect more than 3 degrees (exclusive of vehicle roll or pitch) in any direction...

  10. 49 CFR 38.159 - Mobility aid accessibility.

    Science.gov (United States)

    2010-10-01

    .... (a)(1) General. All vehicles covered by this subpart shall provide a level-change mechanism or... brakes, transmission, or door, or shall provide other appropriate mechanisms or systems, to ensure that... entrance ramp) shall not deflect more than 3 degrees (exclusive of vehicle roll or pitch) in any direction...

  11. South of Sahara | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Language English. Les acquisitions massives de terres peuvent s'accompagner d'avantages comme des emplois, des infrastructures et un accès à la nourriture et aux ... Research will focus on a systems approach to improving maternal and child healthcare delivery in Kenya, specifically within primary care facilities.

  12. What we do | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Red de Líderes de Gobierno Electrónico de América Latina y El Caribe -RED GEALC) was initiated in 2003 under the first phase ... Peru, South America, North And Central America, Argentina, Colombia, Dominican Republic, Ecuador, Mexico.

  13. 40 CFR 159.165 - Toxicological and ecological studies.

    Science.gov (United States)

    2010-07-01

    ... the median lethal dose (LD50), median lethal concentration (LC50) or irritation indices, are not... lethal dose (LD50), median lethal concentration (LC50), or median effective concentration (EC50). (2) At... less of the lowest LC50 or LD50 for a similar species. (4) For plants when tested at the maximum label...

  14. Publications | Page 159 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Japan's System of Official Development Assistance. Une contribution des plus précieuses non seulement aux milieux de la coopération au service du développement dans le monde, mais aussi aux milieux universitaires en général qui aident à comprendre l'APD du Japon – Kimio Fujita, Président, Agence japonaise de ...

  15. 19 CFR 159.22 - Net weights and tares.

    Science.gov (United States)

    2010-04-01

    ... per half box for paper wrappings, and actual tare for outer containers. Ocher, dry, in casks: Eight... importer is not satisfied with the invoice tare or with the schedule tare; (2) If the port director is of...

  16. What we do | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    North And Central America, South America, Colombia, Ecuador, Canada ... through simple resource-based activities: oil, minerals, tourism and labour migration. ... University will conduct three case studies on democratic transition in Liberia, ...

  17. 33 CFR 159.14 - Application for certification.

    Science.gov (United States)

    2010-07-01

    ... description of the manufacturer's production quality control and inspection methods, record keeping systems pertaining to the manufacture of marine sanitation devices, and testing procedures; (2) The design for the... device; and (4) The name and address of the applicant and the manufacturing facility. (c) The...

  18. All projects related to | Page 159 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-12-21

    Displaying 1581 - 1590 of 6834. Catalyzing Broadband Internet in Africa. Project. This project aims to inform policies that help marginalized groups in Africa, such as women and the poor, to take advantage of the social and economic opportunities of broadband Internet. ... Start Date: December 21, 2012. Topic: VIOLENCE ...

  19. 7 CFR 457.159 - Stonefruit crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... selling through an on-farm or roadside stand, farmer's market, and permitting the general public to enter...); (f) That are grown in an orchard that, if inspected, is considered acceptable by us; and (g) That... or to determine the condition of the orchard. (2) The calendar date for the end of the insurance...

  20. 159 THE ROLE OF MUSIC AND MUSICIANS IN PROMOTING ...

    African Journals Online (AJOL)

    User

    instability, musicians and music have a holistic role to play. And this is ... musicians useful, so that the child grows up a responsible ... endearing messages of body movements… ... In a similar development, he encouraged people never to be.

  1. Antiferroquadrupolar ordering and anisotropic magnetic phase diagram of dysprosium palladium bronze, DyPd3S4

    International Nuclear Information System (INIS)

    Matsuoka, Eiichi; Tayama, Takashi; Sakakibara, Toshiro; Hiroi, Zenji; Takeda, Naoya; Ishikawa, Masayasu; Shirakawa, Naoki

    2007-01-01

    From the measurements of magnetization and specific heat, we constructed B-T phase diagrams of single-crystalline DyPd 3 S 4 which is known to exhibit antiferroquadrupolar (AFQ) and antiferromagnetic (AFM) ordering at low temperatures. The phase diagrams are found to be highly anisotropic and re-entrant, which are typical of rare-earth compounds exhibiting multipolar ordering. The crystalline electric field (CEF) scheme of Dy 3+ in DyPd 3S4 was deduced from the specific heat and magnetization measurements of the Y-diluted compounds Dy 1-x Y x Pd 3 S 4 (0.1≤x≤0.9) and discussed in detail. The CEF ground state was determined to be the orbitally-degenerated quartet Γ 67 (1) , and the overall splitting width was estimated to be about 104 K. No correlation was found between the anisotropy of T Q and that of the Zeeman splitting width of the ground quartet Γ 67 (1) . (author)

  2. Effect of Ligand Field Tuning on the SMM Behavior for Three Related Alkoxide-Bridged Dysprosium Dimers.

    Science.gov (United States)

    Peng, Yan; Mereacre, Valeriu; Baniodeh, Amer; Lan, Yanhua; Schlageter, Martin; Kostakis, George E; Powell, Annie K

    2016-01-04

    The synthesis and characterization of three Dy2 compounds, [Dy2(HL1)2(NO3)4] (1), [Dy2(L2)2(NO3)4] (2), and [Dy2(HL3)2(NO3)4] (3), formed using related tripodal ligands with a central tertiary amine bearing picolyl and alkoxy arms, 2-[(2-hydroxy-ethyl)-pyridin-2-ylmethylamino]-ethanol (H2L1), 2-(bis-pyridin-2-ylmethylamino)-ethanol (HL2), and 2-(bis-pyridin-2-ylmethylamino)-propane-1,3-diol (H2L3), are reported. The compounds are rare examples of alkoxide-bridged {Dy2} complexes and display capped square antiprism coordination geometry around each Dy(III) ion. Changes in the ligand field environment around the Dy(III) ions brought about through variations in the ligand donors can be gauged from the magnetic properties, with compounds 1 and 2 showing antiparallel coupling between the Dy(III) ions and 3 showing parallel coupling. Furthermore, slow relaxation of the magnetization typical of SMM behavior could be observed for compounds 2 and 3, suggesting that small variations in the ligand field can have a significant influence on the slow relaxation processes responsible for SMM behavior of Dy(III)-based systems.

  3. Effects of magnetic annealing on structure and multiferroic properties of pure and dysprosium substituted BiFeO 3

    KAUST Repository

    Zhang, Shuxia; Yao, Yingbang; Chen, Yao; Wang, Dongliang; Zhang, Xianping; Awaji, Satoshi; Watanabe, Kazuo; Ma, Yanwei

    2012-01-01

    In this work, the effects of magnetic annealing on crystal structure and multiferroic properties of BiFeO 3 and Bi 0.85Dy 0.15FeO 3 have been investigated. It is found that the X-ray diffraction patterns of pure BiFeO 3 samples are obviously broadened after magnetic annealing, whereas those of Bi 0.85Dy 0.15FeO 3 samples are almost unchanged. Magnetic field annealing did not affect the magnetic properties of these two kinds of samples much. However, ferroelectric properties of the two materials exhibited different behaviors after magnetic field annealing. For pure BiFeO 3 samples, the remnant polarizations (P r) are suppressed; in contrast, for Bi 0.85Dy 0.15FeO 3 samples, P r is greatly enhanced. Possible mechanisms for the effects of magnetic field annealing have been discussed. © 2012 Elsevier B.V. All rights reserved.

  4. A rational approach to the modulation of the dynamics of the magnetisation in a dysprosium-nitronyl-nitroxide radical complex.

    Science.gov (United States)

    Poneti, Giordano; Bernot, Kevin; Bogani, Lapo; Caneschi, Andrea; Sessoli, Roberta; Wernsdorfer, Wolfgang; Gatteschi, Dante

    2007-05-14

    A control of the dynamics of the magnetisation is chemically achieved in a ring-like Dy-radical based molecule, allowing the estimation of the quantum tunneling frequency with a (4)He-cooled susceptometer.

  5. Manufacturing of Dysprosium-Iron Alloys by Electrolysis in Fluoride-Based Electrolytes. Electrolysis in a Laboratory-Scale Cell

    Science.gov (United States)

    Martinez, Ana Maria; Osen, Karen Sende; Støre, Anne; Gudbrandsen, Henrik; Kjos, Ole Sigmund; Solheim, Asbjørn; Wang, Zhaohui; Oury, Alexandre; Namy, Patrick

    2018-04-01

    Electrolytic production of light rare earth elements and rare earth alloys with transition elements takes place in a fluoride-based electrolyte using rare earth oxides as raw material. The optimization of this method, mainly in terms of the energy efficiency and environmental impact control, is rather challenging. Anode effects, evolution of fluorine-containing compounds and side cathode reactions could largely be minimized by good control of the amount of rare earth oxide species dissolved in the fluoride-based electrolyte and their dissolution rate. The Dy2O3 feed rate needed for stable cell operation was studied by following up the anode voltage and gas analysis. On-line analysis of the cell off-gases by FTIR showed that the electrochemical reaction for the formation of Dy-Fe alloy gives mainly CO gas and that CF4 is starting to evolve gradually at anode voltages of ca. 3.25 V. The limiting current density for the discharge of the oxide ions at the graphite anode was in the range of 0.1 to 0.18 A cm-2 at dissolved Dy2O3 contents of ca. 1 wt pct. Modeling of the laboratory cell reactor was also carried out by implementing two models, i.e., an electrical model simulating the current density distribution at the electrodes and a laminal bubbly flow model that explains the electrolyte velocity induced by gas bubble production at the anode.

  6. Critical Rare Earths, National Security, and U.S.-China Interactions: A Portfolio Approach to Dysprosium Policy Design

    Science.gov (United States)

    2015-01-01

    from Donald and Susan Rice , both funds which enabled me to focus on the dissertation. I thank Dean Susan Marquis for her dedication to the growth of...quota of 89,2000 tonnes (Table 2.2). The sprawling black market not only prevents Beijing’s efforts to bring the production under its levers to...yttrium are often used for pigmentation for consumer products such as paint and sunglasses. REE-based lasers are used for cosmetic , epidermal, and

  7. White- and blue-light-emitting dysprosium(III) and terbium(III)-doped gadolinium titanate phosphors.

    Science.gov (United States)

    Antić, Ž; Kuzman, S; Đorđević, V; Dramićanin, M D; Thundat, T

    2017-06-01

    Here we report the synthesis and structural, morphological, and photoluminescence analysis of white- and blue-light-emitting Dy 3 + - and Tm 3 + -doped Gd 2 Ti 2 O 7 nanophosphors. Single-phase cubic Gd 2 Ti 2 O 7 nanopowders consist of compact, dense aggregates of nanoparticles with an average size of ~25 nm for Dy 3 + -doped and ~50 nm for Tm 3 + -doped samples. The photoluminescence results indicated that ultraviolet (UV) light excitation of the Dy 3 + -doped sample resulted in direct generation of white light, while a dominant yellow emission was obtained under blue-light excitation. Intense blue light was obtained for Tm 3 + -doped Gd 2 Ti 2 O 7 under UV excitation suggesting that this material could be used as a blue phosphor. Copyright © 2016 John Wiley & Sons, Ltd.

  8. Isothermal sections of phase equilibria diagrams for systems (terbium, dysprosium, holmium)-molybdenum-boron at 1273 K

    International Nuclear Information System (INIS)

    Kuz'ma, Yu.B.; Zakharchuk, N.P.; Maksimova, L.T.

    1988-01-01

    The methods of X-ray analysis are used to study the R-Mo-B (R-Tb, Dy, Ho) systems and isothermal sections of phase equilibria diagrams at 1273 K are plotted. A formation of RMoB 4 (structure of the YCrB 4 type) is confirmed and borides R 3 MoB 7 (structure of the Er 3 CrB 7 type) and ∼ RMo 4 B 8 (of the unknown structure) are obtained for the first time. Borides DyMoB 3 and HoMoB 3 are of the ErMoB 3 structure. Lattice periods of new compounds are indicated. Diffractogrammes of borides Dy 3 MoB 7 and DyMoB 3 are calculated. A peculiarity of components interaction in the systems rare-earth metal-molybdenum-boron is considered

  9. Effects of magnetic annealing on structure and multiferroic properties of pure and dysprosium substituted BiFeO 3

    KAUST Repository

    Zhang, Shuxia

    2012-07-01

    In this work, the effects of magnetic annealing on crystal structure and multiferroic properties of BiFeO 3 and Bi 0.85Dy 0.15FeO 3 have been investigated. It is found that the X-ray diffraction patterns of pure BiFeO 3 samples are obviously broadened after magnetic annealing, whereas those of Bi 0.85Dy 0.15FeO 3 samples are almost unchanged. Magnetic field annealing did not affect the magnetic properties of these two kinds of samples much. However, ferroelectric properties of the two materials exhibited different behaviors after magnetic field annealing. For pure BiFeO 3 samples, the remnant polarizations (P r) are suppressed; in contrast, for Bi 0.85Dy 0.15FeO 3 samples, P r is greatly enhanced. Possible mechanisms for the effects of magnetic field annealing have been discussed. © 2012 Elsevier B.V. All rights reserved.

  10. Generation of White Light from Dysprosium-Doped Strontium Aluminate Phosphor by a Solid-State Reaction Method

    Science.gov (United States)

    Sahu, Ishwar Prasad; Bisen, D. P.; Brahme, N.; Tamrakar, Raunak Kumar

    2016-04-01

    A single-host lattice, white light-emitting SrAl2O4:Dy3+ phosphor was synthesized by a solid-state reaction method. The crystal structure of prepared SrAl2O4:Dy3+ phosphor was in a monoclinic phase with space group P21. The chemical composition of the sintered SrAl2O4:Dy3+ phosphor was confirmed by the energy dispersive x-ray spectroscopy technique. Under ultra-violet excitation, the characteristic emissions of Dy3+ are peaking at 475 nm, 573 nm and 660 nm, originating from the transitions of 4F9/2 → 6H15/2, 4F9/2 →&!nbsp; 6H13/2 and 4F9/2 → 6H11/2 in the 4f9 configuration of Dy3+ ions. Commission International de I'Eclairage color coordinates of SrAl2O4:Dy3+ are suitable for white light-emitting phosphor. In order to investigate the suitability of the samples as white color light sources for industrial uses, correlated color temperature (CCT) and color rendering index (CRI) values were calculated. Values of CCT and CRI were found well within the defined acceptable range. Mechanoluminescence (ML) intensity of SrAl2O4:Dy3+ phosphor increased linearly with increasing impact velocity of the moving piston. Thus, the present investigation indicates piezo-electricity was responsible for producing ML in sintered SrAl2O4:Dy3+ phosphor. Decay rates of the exponential decaying period of the ML curves do not change significantly with impact velocity. The photoluminescence and ML results suggest that the synthesized SrAl2O4:Dy3+ phosphor was useful for the white light-emitting diodes and stress sensor respectively.

  11. Complexes of lanthanum(III), cerium(III), samarium(III) and dysprosium(III) with substituted piperidines

    Energy Technology Data Exchange (ETDEWEB)

    Manhas, B S; Trikha, A K; Singh, H; Chander, M

    1983-11-01

    Complexes of the general formulae M/sub 2/Cl/sub 6/(L)/sub 3/.C/sub 2/H/sub 5/OH and M/sub 2/(NO/sub 3/)/sub 6/(L)/sub 2/.CH/sub 3/OH have been synthesised by the reactions of chlorides and nitrates of La(III), Ce(III), Sm(III) and Dy(III) with 2-methylpiperidine, 3-methylpiperidine and 4-methylpiperidine. These complexes have been characterised on the basis of their elemental analysis, and IR and electronic reflectance spectra. IR spectral data indicate the presence of coordinated ethanol and methanol molecules and bidentate nitrate groups. Coordination numbers of the metal ions vary from 5 to 8. 19 refs.

  12. Study of the optical and magnetostatic properties of thin platelets of dysprosium and holmium ortho-ferrites

    International Nuclear Information System (INIS)

    Challeton, Didier

    1970-07-01

    Device applications of cylindrical magnetic domains - sometimes referred to as 'bubbles' - was first demonstrated by A.H. Bobeck in the rare earth ortho-ferrites. General magnetic and optical properties of the rare earth ortho-ferrites are considered. The theoretical study of the cylindrical magnetic domains and their stability conditions are presented in this paper. The single crystals were grown by the PbO flux method. The thin platelets (≅ 50 microns thick) preparation is specified and the magneto-optical measurements are presented. Absorption, birefringence and Faraday rotation were measured in HoFeO 3 and DyFeO 3 . The utilisation conditions of these materials are characterized by the measurements of the smallest stable domain diameter. (author) [fr

  13. Sample Results From Tank 48H Samples HTF-48-14-158, -159, -169, and -170

    Energy Technology Data Exchange (ETDEWEB)

    Peters, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hang, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-04-28

    Savannah River National Laboratory (SRNL) analyzed samples from Tank 48H in support of determining the cause for the unusually high dose rates at the sampling points for this tank. A set of two samples was taken from the quiescent tank, and two additional samples were taken after the contents of the tank were mixed. The results of the analyses of all the samples show that the contents of the tank have changed very little since the analysis of the previous sample in 2012. The solids are almost exclusively composed of tetraphenylborate (TPB) salts, and there is no indication of acceleration in the TPB decomposition. The filtrate composition shows a moderate increase in salt concentration and density, which is attributable to the addition of NaOH for the purposes of corrosion control. An older modeling simulation of the TPB degradation was updated, and the supernate results from a 2012 sample were run in the model. This result was compared to the results from the 2014 recent sample results reported in this document. The model indicates there is no change in the TPB degradation from 2012 to 2014. SRNL measured the buoyancy of the TPB solids in Tank 48H simulant solutions. It was determined that a solution of density 1.279 g/mL (~6.5M sodium) was capable of indefinitely suspending the TPB solids evenly throughout the solution. A solution of density 1.296 g/mL (~7M sodium) caused a significant fraction of the solids to float on the solution surface. As the experiments could not include the effect of additional buoyancy elements such as benzene or hydrogen generation, the buoyancy measurements provide an upper bound estimate of the density in Tank 48H required to float the solids.

  14. Evaluation of Gd and Gd159 as new approaches for cancer treatment

    International Nuclear Information System (INIS)

    Galvao, I.; Neves, M.J.

    2011-01-01

    Metal compounds have shown many biological activities and have been successfully used as anticancer agents such cisplatin. Actually gadolinium (Gd) complexed with a porphyrin Motexafin (MGd) has been investigated as redox-active compound for treatment of cancer. 1 59G d decays by beta emission with an energy of 970 keV and half-life of 18.59 hours. The de-excitation can be via gamma ray and internal conversion electron emission followed by auger electrons and x rays. Considering all of this 1 59G d could be a interesting radionuclide to be as a radio therapeutical agent. The aims of this works were to evaluate the cytotoxicity of Gd and 1 59G d on malignant brain tumors such as glioblastoma multiform, the most frequent brain tumors which has a very poor prognosis. For this purpose, it was used human glioblastoma cell lines T98 (mutant p53) and U87 (wild-type p53) to investigate the cytotoxicity of gadolinium on cell metabolism by MTT assay and also morphological changes, chromatin condensation by DAPI assay and ROS generation. Gadolinium was able to decrease cell viability, the cells presented morphological changes like round shapes and blebs formation after cell treatment with 5x10 -6 M of Gd. Nuclear changing and ROS generation occurred in a dose dependent way indicating the cytotoxic effect of Gd. Treatment with 1 59G d increased all of changes observed with treatment with Gd. These results state for an additive effect of metal toxicity and radioactivity inducing ROS generation as the main mechanism of anti tumoral action of 1 59G d. The results obtained indicated that the radioactive analogues of Gd have increased cytotoxic effects and gadolinium can be a metal of choice for development of new drugs for cancer treatment. (author)

  15. 27_159 - 166_Abdullahi et al.,_Manuscript for BAJOPAS

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... L STEM BARK EXTRACTS OF Jatropha curcas (Physic Nut). , Amina Shehu1, Ibrahim ... bial, anti-inflammatory, principles .... 5% parasitemia erythrocytes and mixed thoroughly. The sensitivity of ..... plasma membrane bebs in hepatocytes. Hepatology ... Antimicrobial screening and stability studies of crude ...

  16. Dedifferentiated chondrosarcoma: A survival analysis of 159 cases from the SEER database (2001-2011).

    Science.gov (United States)

    Strotman, Patrick K; Reif, Taylor J; Kliethermes, Stephanie A; Sandhu, Jasmin K; Nystrom, Lukas M

    2017-08-01

    Dedifferentiated chondrosarcoma is a rare malignancy with reported 5-year overall survival rates ranging from 7% to 24%. The purpose of this investigation is to determine the overall survival of dedifferentiated chondrosarcoma in a modern patient series and how it is impacted by patient demographics, tumor characteristics, and surgical treatment factors. This is a retrospective review of the Surveillance, Epidemiology, and End Results (SEER) database from 2001 to 2011. Kaplan Meier analyses were used for overall and disease-specific survival. Univariable and multivariable cox regression models were used to identify prognostic factors. Five year overall- and disease-specific survival was 18% (95% CI: 12-26%) and 28% (95% CI: 18-37%), respectively. Individuals with extremity tumors had a worse prognosis than individuals with a primary tumor in the chest wall or axial skeleton (HR 0.20, 95% CI: 0.07-0.56; P = 0.002 and HR 0.60, 95% CI: 0.36-0.99; P = 0.04, respectively). Patients with AJCC stage III or IV disease (HR 2.51, 95% CI: 1.50-4.20; P = 0.001), tumors larger than 8 cm (HR 2.17, 95% CI: 1.11-4.27; P = 0.046), metastatic disease at diagnosis (HR 3.25, 95% CI: 1.98-5.33; P chondrosarcoma is poor with a 5-year overall survival of 18%. Patients with a primary tumor located in the chest wall had a better prognosis. Tumors larger than 8 cm, presence of metastases at diagnosis, and treatment without surgical resection were significant predictors of mortality. © 2017 Wiley Periodicals, Inc.

  17. 45 CFR 159.120 - Data submission for the individual and small group markets.

    Science.gov (United States)

    2010-10-01

    ... determined by the Secretary, submit pricing and benefit information for their portal plans on or before September 3, 2010, and annually thereafter. (c) Issuers must submit updated pricing and benefit data for their portal plans whenever they change premiums, cost-sharing, types of services covered, coverage...

  18. 159 Évaluation de l'activité biologique des feuilles de l'olivier ...

    African Journals Online (AJOL)

    PC

    naturelles, nous avons essayé dans cette étude de contribuer à la connaissance de certains effets biologiques des feuilles ... alternative aux médicaments conventionnels. En Algérie, les plantes ... comparaison de deux moyennes de deux séries de mesure est réalisée grâce au test 't' de Student-Fisher. 2-5. Evaluation de ...

  19. 77 FR 56254 - 89th Meeting: RTCA Special Committee 159, Global Positioning Systems (GPS)

    Science.gov (United States)

    2012-09-12

    ... held March 16, 2012. Review Working Group (WG) Progress and Identify Issues for Resolution. GPS/3nd... Standards for Global Positioning System/Wide Area Augmentation System Airborne Equipment Assignment/Review of Future Work. Other Business. Date and Place of Next Meeting. Adjourn Attendance is open to the...

  20. 46 CFR 159.001-9 - OMB Control Numbers assigned pursuant to the Paperwork Reduction Act.

    Science.gov (United States)

    2010-10-01

    .... This section collects and displays the control numbers assigned to information collection and... Paperwork Reduction Act of 1980, (44 U.S.C. 3501 et seq.). The Coast Guard intends that this section comply with the requirements of 44 U.S.C. 3507(f) which requires that agencies display a current control...

  1. 27 CFR 1.59 - Public information as to applications acted upon.

    Science.gov (United States)

    2010-04-01

    ... business; whether the applicant is an individual, a partnership or a corporation; if a partnership, the... officers and of each stockholder owning 10 percent or more of the corporate stock. (b) The time and place... hearing, a copy of the administrative law judge's recommended decision, a copy of the appropriate TTB...

  2. Selected translated abstracts of Russian-language climate-change publications: II, Clouds. Issue 159

    Energy Technology Data Exchange (ETDEWEB)

    Burtis, M.D. [comp.

    1994-01-01

    This report presents abstracts (translated into English) of important Russian-language literature concerning clouds as they relate to climate change. In addition to the bibliographic citations and abstracts translated into English, this report presents the original citations and abstracts in Russian. Author and title indexes are included to assist the reader in locating abstracts of particular interest.

  3. 40 CFR 86.159-00 - Exhaust emission test procedures for US06 emissions.

    Science.gov (United States)

    2010-07-01

    ... run on a large single roll electric dynamometer, or an approved equivalent dynamometer configuration... validity, shall be supplied on request of the Administrator. (6) The drive wheel tires may be inflated up... psi, in order to prevent tire damage. The drive wheel tire pressure shall be reported with the test...

  4. 40 CFR 86.159-08 - Exhaust emission test procedures for US06 emissions.

    Science.gov (United States)

    2010-07-01

    ..., CH4, and NOX. (b) Dynamometer activities. (1) All official US06 tests shall be run on a large single... be supplied on request of the Administrator. (6) The drive wheel tires may be inflated up to a gauge... prevent tire damage. The drive wheel tire pressure shall be reported with the test results. (7) The...

  5. 40 CFR 93.159 - Procedures for conformity determinations of general Federal actions.

    Science.gov (United States)

    2010-07-01

    ... assumptions must be derived from the estimates of population, employment, travel, and congestion most recently... geographic location or level of population, employment, travel, and congestion, must be approved by the MPO... this subpart must be based on the latest and most accurate emission estimation techniques available as...

  6. Development of a GIS approach to mining risk assessment. Supervising Scientist report 159

    International Nuclear Information System (INIS)

    Boggs, G.S.

    2001-01-01

    A Geographic Information System (GIS) offers a means by which the data collected during the assessment of possible mining impacts can be stored and manipulated. A GIS that provides a central focus point for the storage, manipulation and retrieval of information generated by the investigation into the geomorphological impact of the ERA Jabiluka Mine has been developed. Implementing a flexible, GIS-centred approach to data management allows the data storage, manipulation and retrieval powers of GIS to be retained whilst maintaining access to the functionality contained within these other software packages. The GIS has also been linked to the DistFW hydrology model and SIBERIA landform evolution model, to provide a more spatial approach to assessing the impact of mining on the long-term landform evolution of a catchment. A GIS based rapid erosion assessment method has been developed and evaluated. The method allows the user to quickly acquire and evaluate existing data to assist in the planning of more detailed monitoring, modelling and erosion assessment programs. The rapid erosion assessment method is based on a simplified version of the Revised Universal Soil Loss Equation (RUSLE), and allows the rapid parametrisation of the model from widely available land unit and elevation datasets. The rapid erosion assessment method is evaluated through the investigation of the effects of elevation data resolution on erosion predictions and field data validation. More detailed, quantitative risk assessment can be conducted using a combination of landform evolution modelling and basin analysis in a GIS framework. SIBERIA has been parameterized using field data from Ngarradj and applied to the catchment. Due to complexities of the catchment there were some difficulties with the hydrology component. However, the results indicate that SIBERIA is suitable and simulations showed little change in the catchment in the long term. Combining these with newly developed GIS tools to provide a geomorphometric basin analysis of the year 0 and year 1000 simulated catchments strengthens erosion risk impact assessment. The geomorphometric measures considered include the hypsometric curve, width function, cumulative area distribution and area-slope relationship. Three areas have been identified as requiring further study in order to consolidate mining impact assessment: the incorporation of spatial variation in SIBERIA input parameters in the modelling process, an analysis of the sensitivity of the SIBERIA model to input parameter variations or error and the practical application of the GIS/modelling approach to assessing the impact of the ERA Jabiluka Mine on landform evolution in the Ngarradj catchment. Copyright (2001) Commonwealth of Australia

  7. Test of ground-based lidar instrument WLS7-159

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Wagner, Rozenn

    This report presents the result of the test performed for the given Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. The test aims at establishing a relation between the reference wind measurements and corresponding lidar wind indications, and evaluating a set of quality...

  8. SU-E-T-159: Evaluation of a Patient Specific QA Tool Based On TG119

    International Nuclear Information System (INIS)

    Ashmeg, S; Zhang, Y; O'Daniel, J; Yin, F; Ren, L

    2014-01-01

    Purpose: To evaluate the accuracy of a 3D patient specific QA tool by analysis of the results produced from associated software in homogenous phantom and heterogonous patient CT. Methods: IMRT and VMAT plans of five test suites introduced by TG119 were created in ECLIPSE on a solid water phantom. The ten plans -of increasing complexity- were delivered to Delta4 to give a 3D measurement. The Delta4's “Anatomy” software uses the measured dose to back-calculate the energy fluence of the delivered beams, which is used for dose calculation in a patient CT using a pencilbeam algorithm. The effect of the modulated beams' complexity on the accuracy of the “Anatomy” calculation was evaluated. Both measured and Anatomy doses were compared to ECLIPSE calculation using 3% - 3mm gamma criteria.We also tested the effect of heterogeneity by analyzing the results of “Anatomy” calculation on a Brain VMAT and a 3D conformal lung cases. Results: In homogenous phantom, the gamma passing rates were found to be as low as 74.75% for a complex plan with high modulation. The mean passing rates were 91.47% ± 6.35% for “Anatomy” calculation and 99.46% ± 0.62% for Delta4 measurements.As for the heterogeneous cases, the rates were 96.54%±3.67% and 83.87%±9.42% for Brain VMAT and 3D lung respectively. This increased error in the lung case could be due to the use of the pencil beam algorithm as opposed to the AAA used by ECLIPSE.Also, gamma analysis showed high discrepancy along the beam edge in the “Anatomy” calculated results. This suggests a poor beam modeling in the penumbra region. Conclusion: The results show various sources of errors in “Anatomy” calculations. These include beam modeling in the penumbra region, complexity of a modulated beam (shown in homogenous phantom and brain cases) and dose calculation algorithms (3D conformal lung case)

  9. FCJ-159 /b/lack up: What Trolls Can Teach Us About Race

    Directory of Open Access Journals (Sweden)

    Tanner Higgin

    2013-12-01

    Full Text Available This article explores the racial politics of trolling by examining virtual world raids conducted by users of the internet message board 4chan. Since these raids deploy offensive language and imagery that play upon African American stereotypes and history, they can be understood as participating in an ironic, post-political racism that masquerades as enlightened yet maintains online spaces as bastions of white heterosexual masculinity. Moving beyond this frame, however, this article looks awry at these performances and considers how they might also be understood as unintentional yet productive interrogations of racial politics and logics within game cultures and technologies.

  10. SU-E-J-159: Analysis of Total Imaging Uncertainty in Respiratory-Gated Radiotherapy

    International Nuclear Information System (INIS)

    Suzuki, J; Okuda, T; Sakaino, S; Yokota, N

    2015-01-01

    Purpose: In respiratory-gated radiotherapy, the gating phase during treatment delivery needs to coincide with the corresponding phase determined during the treatment plan. However, because radiotherapy is performed based on the image obtained for the treatment plan, the time delay, motion artifact, volume effect, and resolution in the images are uncertain. Thus, imaging uncertainty is the most basic factor that affects the localization accuracy. Therefore, these uncertainties should be analyzed. This study aims to analyze the total imaging uncertainty in respiratory-gated radiotherapy. Methods: Two factors of imaging uncertainties related to respiratory-gated radiotherapy were analyzed. First, CT image was used to determine the target volume and 4D treatment planning for the Varian Realtime Position Management (RPM) system. Second, an X-ray image was acquired for image-guided radiotherapy (IGRT) for the BrainLAB ExacTrac system. These factors were measured using a respiratory gating phantom. The conditions applied during phantom operation were as follows: respiratory wave form, sine curve; respiratory cycle, 4 s; phantom target motion amplitude, 10, 20, and 29 mm (which is maximum phantom longitudinal motion). The target and cylindrical marker implanted in the phantom coverage of the CT images was measured and compared with the theoretically calculated coverage from the phantom motion. The theoretical position of the cylindrical marker implanted in the phantom was compared with that acquired from the X-ray image. The total imaging uncertainty was analyzed from these two factors. Results: In the CT image, the uncertainty between the target and cylindrical marker’s actual coverage and the coverage of CT images was 1.19 mm and 2.50mm, respectively. In the Xray image, the uncertainty was 0.39 mm. The total imaging uncertainty from the two factors was 1.62mm. Conclusion: The total imaging uncertainty in respiratory-gated radiotherapy was clinically acceptable. However, an internal margin should be added to account for the total imaging uncertainty

  11. 75 FR 28318 - Eighty-Second Meeting: RTCA Special Committee 159: Global Positioning System (GPS)

    Science.gov (United States)

    2010-05-20

    ..., GPS/Inertial, Colson Board Room. Wednesday, June 9th All Day, Working Group 2, GPS/WAAS, Hilton-ATA...-NBAA Room & Hilton-ATA Room. Friday, June 11th Plenary Session--See Agenda Below Agenda--Plenary Session--Agenda June 11th, 2010--starting at 9 a.m. MacIntosh-NBAA & Hilton-ATA Rooms Chairman's...

  12. 75 FR 61818 - Eighty-Third Meeting: RTCA Special Committee 159: Global Positioning System (GPS).

    Science.gov (United States)

    2010-10-06

    ..., Working Group 2C, GPS/Inertial, MacIntosh-NBAA Room and Hilton-ATA Room. Tuesday, October 26 All Day... and Hilton-ATA Room. Thursday, October 28 (Proposed) 9--Noon, Joint Working Groups 2 & 4, Discussion--Nav and ADS-B Out Equipment Requirements, MacIntosh-NBAA Room and Hilton-ATA Room. (Otherwise WG-4...

  13. 40 CFR 159.184 - Toxic or adverse effect incident reports.

    Science.gov (United States)

    2010-07-01

    ... site (e.g., home, yard, commercial turf, agricultural (specify crop), industrial, building/office... domestic animal: (A) Type of animal (e.g., livestock, poultry, bird, fish, household pet e.g., dog/cat etc...

  14. Sud du Sahara | Page 159 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En cas de perte d'emploi, de maladie ou de mauvaise récolte, la principale source de protection sociale vers laquelle ils peuvent se tourner est l'appui que leur accorde ... Thaven Naidoo of the Climate Technology Initiative Private Finance Advisory Network (CTI PFAN) spoke about the importance of interesting the impact ...

  15. Estimation of coincidence and correlation in non-analogous Monte Carlo particle transport - 159

    International Nuclear Information System (INIS)

    Szieberth, M.; Leen Kloosterman, J.

    2010-01-01

    The conventional non-analogous Monte Carlo methods are optimized to preserve the mean value of the distributions and therefore they are not suited for non-Boltzmann problems like the estimation of coincidences or correlations. This paper presents a general method called history splitting for the non-analogous estimation of such quantities. The basic principle of the method is that a non-analogous particle history can be interpreted as a collection of analogous histories with different weights according to the probability of their realization. Calculations with a simple Monte Carlo program for a pulse-height-type estimator prove that the method is feasible and provides unbiased estimation. Different variance reduction techniques have been tried with the method and Russian roulette turned out to be ineffective in high multiplicity systems. An alternative history control method is applied instead. Simulation results of a Feynman-α measurement shows that even the reconstruction of the higher moments is possible with the history splitting method, which makes the simulation of neutron noise measurements feasible. (authors)

  16. Ce que nous faisons | Page 159 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI appuie des travaux de recherche dans les pays en voie de développement en vue de produire un changement réel et durable. Ce savoir peut servir d'outil pour résoudre des problèmes mondiaux urgents. Nous partageons ce savoir avec les autres en :

  17. SU-E-J-159: Analysis of Total Imaging Uncertainty in Respiratory-Gated Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, J; Okuda, T [Toyota memorial hospital, Toyota, Aichi (Japan); Sakaino, S; Yokota, N [Suzukake central hospital, Hamamatsu, Shizuoka (Japan)

    2015-06-15

    Purpose: In respiratory-gated radiotherapy, the gating phase during treatment delivery needs to coincide with the corresponding phase determined during the treatment plan. However, because radiotherapy is performed based on the image obtained for the treatment plan, the time delay, motion artifact, volume effect, and resolution in the images are uncertain. Thus, imaging uncertainty is the most basic factor that affects the localization accuracy. Therefore, these uncertainties should be analyzed. This study aims to analyze the total imaging uncertainty in respiratory-gated radiotherapy. Methods: Two factors of imaging uncertainties related to respiratory-gated radiotherapy were analyzed. First, CT image was used to determine the target volume and 4D treatment planning for the Varian Realtime Position Management (RPM) system. Second, an X-ray image was acquired for image-guided radiotherapy (IGRT) for the BrainLAB ExacTrac system. These factors were measured using a respiratory gating phantom. The conditions applied during phantom operation were as follows: respiratory wave form, sine curve; respiratory cycle, 4 s; phantom target motion amplitude, 10, 20, and 29 mm (which is maximum phantom longitudinal motion). The target and cylindrical marker implanted in the phantom coverage of the CT images was measured and compared with the theoretically calculated coverage from the phantom motion. The theoretical position of the cylindrical marker implanted in the phantom was compared with that acquired from the X-ray image. The total imaging uncertainty was analyzed from these two factors. Results: In the CT image, the uncertainty between the target and cylindrical marker’s actual coverage and the coverage of CT images was 1.19 mm and 2.50mm, respectively. In the Xray image, the uncertainty was 0.39 mm. The total imaging uncertainty from the two factors was 1.62mm. Conclusion: The total imaging uncertainty in respiratory-gated radiotherapy was clinically acceptable. However, an internal margin should be added to account for the total imaging uncertainty.

  18. Accuracy of liver scintigraphy in focal liver disease - a comparison with postmortem studies in 159 cases

    International Nuclear Information System (INIS)

    Biersack, H.J.; Helpap, B.; Bell, E.; Vogt, R.; Breuel, H.P.; Bonn Univ.

    1979-01-01

    Our investigations were carried out in 139 patients with various types of malignancy. Included in the investigations were 20 patients with primary liver tumor. The interval between scintigraphic examination and the histological verification ranged from 3 days to 1 year. In 62 of the patients histopathology revealed liver metastases, while 77 patients showed no liver involvement. We arrived at the correct diagnosis 'liver metastasis' in 50 out of 2 patientes. Fifty six out of 77 patients without histopathological evidence of liver metastases revealed negative scintigrams. In 18 of 20(90%) patients with focal liver disease correct diagnosis was established. Considering the fact that liver scintigraphy is a non-invasive procedure, it can be recommended as screening method. In connection with sonography and computer tomography liver scintigraphy can undoubtedly improve the diagnostic accuracy in detecting liver metastases and primary liver tumors. (orig./MG) [de

  19. 10 CFR 26.159 - Assuring specimen security, chain of custody, and preservation.

    Science.gov (United States)

    2010-01-01

    ... other entity has reason to question the integrity and identity of the specimens, the specimens may not... identification numbers on the custody-and-control form; (iii) A specimen bottle seal is broken or shows evidence... of the shipping containers are inaccessible without breaking a tamper-evident seal. (g) Couriers...

  20. In-complete fusion of 16O with 159Tb: measurement and analysis of excitation functions

    International Nuclear Information System (INIS)

    Singh, Pushpendra P.; Unnati; Sharma, Manoj Kumar; Singh, B.P.; Prasad, R.; Rakesh Kumar; Golda, K.S.; Bhardwaj, H.D.

    2006-01-01

    In order to have better understanding of incomplete fusion reaction dynamics, more experimental data covering a wide range of periodic table and energy are required. Cross-section data of such products are also in demand to determine the optimum irradiation conditions for the production of radioactive ion beams

  1. 27_159 - 166_Abdullahi et al.,_Manuscript for BAJOPAS

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... nd ethanol stem bark extracts of Jatropha curcas were effective against er, the aqueous extract ... quality biodiesel fuel el engine (Agbogidi et .... erythrocytes appearing as blue discoid cells containing life rings of the parasite ...

  2. ISO far-infrared observations of rich galaxy clusters II. Sersic 159-03

    DEFF Research Database (Denmark)

    Hansen, Lene; Jørgensen, H.E.; Nørgaard-Nielsen, Hans Ulrik

    2000-01-01

    In a series of papers we investigate far-infrared emission from rich galaxy clusters. Maps have been obtained by ISO at 60 mu m, 100 mu m, 135 mu m, and 200 mu m using the PHT-C camera. Ground based imaging and spectroscopy were also acquired. Here we present the results for the cooling flow...

  3. : tous les projets | Page 159 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    À mesure que les pays de l'Asie du Sud s'acheminent vers une plus grande intégration économique, on voit apparaître tout un éventail de difficultés interreliées ayant trait aux garanties constitutionnelles et aux garanties des droits de la personne. End Date: 17 mars 2016. Sujet: PRISONS. Région: Bangladesh, India, Nepal ...

  4. Role of offending out-door aero-allergen and CD14 C(-159)T ...

    African Journals Online (AJOL)

    Child- hood-onset and adult-onset of asthma showed significant difference in allergen sensitivity as well as genetic background with respect to CD14 polymorphism. Keywords: Asthma, aero-allergen, skin prick test, total IgE, CD14 gene polymorphism. DOI: https://dx.doi.org/10.4314/ahs.v17i4.18. Cite as: Dutta S, Mondal P, ...

  5. Yeast Interacting Proteins Database: YLR288C, YMR159C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available rotrimeric complex (Rad17p-Mec3p-Ddc1p) that forms a sliding clamp, loaded onto partial duplex DNA by a clam...that forms a sliding clamp, loaded onto partial duplex DNA by a clamp loader complex; homolog of human and S

  6. Evaluation of Gd and Gd{sup 159} as new approaches for cancer treatment

    Energy Technology Data Exchange (ETDEWEB)

    Galvao, I.; Neves, M.J., E-mail: nevesmj@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Grupo de Desenvolvimento de Radiofarmacos; Santos, R.G., E-mail: santosr@cdtn.br [Instituto Nacional de Ciencia e Tecnologia em Medicina Molecular (INCT-MM), Belo Horizonte, MG (Brazil)

    2011-07-01

    Metal compounds have shown many biological activities and have been successfully used as anticancer agents such cisplatin. Actually gadolinium (Gd) complexed with a porphyrin Motexafin (MGd) has been investigated as redox-active compound for treatment of cancer. 1{sup 59G}d decays by beta emission with an energy of 970 keV and half-life of 18.59 hours. The de-excitation can be via gamma ray and internal conversion electron emission followed by auger electrons and x rays. Considering all of this 1{sup 59G}d could be a interesting radionuclide to be as a radio therapeutical agent. The aims of this works were to evaluate the cytotoxicity of Gd and 1{sup 59G}d on malignant brain tumors such as glioblastoma multiform, the most frequent brain tumors which has a very poor prognosis. For this purpose, it was used human glioblastoma cell lines T98 (mutant p53) and U87 (wild-type p53) to investigate the cytotoxicity of gadolinium on cell metabolism by MTT assay and also morphological changes, chromatin condensation by DAPI assay and ROS generation. Gadolinium was able to decrease cell viability, the cells presented morphological changes like round shapes and blebs formation after cell treatment with 5x10{sup -6}M of Gd. Nuclear changing and ROS generation occurred in a dose dependent way indicating the cytotoxic effect of Gd. Treatment with 1{sup 59G}d increased all of changes observed with treatment with Gd. These results state for an additive effect of metal toxicity and radioactivity inducing ROS generation as the main mechanism of anti tumoral action of 1{sup 59G}d. The results obtained indicated that the radioactive analogues of Gd have increased cytotoxic effects and gadolinium can be a metal of choice for development of new drugs for cancer treatment. (author)

  7. 49 CFR 1.59 - Delegations to the Assistant Secretary for Administration.

    Science.gov (United States)

    2010-10-01

    ...) Carry out the functions delegated to the Secretary from time to time by the Administrator of General Services to lease real property for Department use. (5) Carry out the duties and responsibilities of agency... connection with claims of the United States for erroneous payment of pay and allowances or of travel...

  8. 7 CFR 989.159 - Regulation of the handling of raisins subsequent to their acquisition.

    Science.gov (United States)

    2010-01-01

    ... (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts... unless it is found to be practicable to separate the raisins into two new lots, one which meets and the other which fails to meet all of the applicable minimum standards, respectively. Any lot of mixed types...

  9. 7 CFR 993.159 - Payments for services performed with respect to reserve tonnage prunes.

    Science.gov (United States)

    2010-01-01

    ..., incidental to acquisition or storage; (ii) Direct labor costs, which include those for weighing, receiving... overhead costs, which include those for supervision, indirect labor, fuel, power and water, taxes and... the costs for necessary services rendered by handlers in connection with reserve prunes. (2) Such...

  10. 46 CFR 159.010-3 - Independent laboratory: Standards for acceptance.

    Science.gov (United States)

    2010-10-01

    ... engaged, as a regular part of its business, in performing inspections and tests that are the same as or... manufacturer; (4) Not be dependent on Coast Guard acceptance under this subchapter to remain in business; and (5) Not advertise or promote the manufacturer's equipment or material that the laboratory inspects...

  11. Hexanuclear, heterometallic, Ni₃Ln₃ complexes possessing O-capped homo- and heterometallic structural subunits: SMM behavior of the dysprosium analogue.

    Science.gov (United States)

    Goura, Joydeb; Guillaume, Rogez; Rivière, Eric; Chandrasekhar, Vadapalli

    2014-08-04

    The reaction of hetero donor chelating mannich base ligand 6,6'-{(2-(dimethylamino)ethylazanediyl)bis(methylene)}bis(2-methoxy-4-methylphenol) with Ni(ClO4)2·6H2O and lanthanide(III) salts [Dy(III) (1); Tb(III) (2); Gd (III) (3); Ho(III) (4); and Er(III) (5)] in the presence of triethylamine and pivalic acid afforded a series of heterometallic hexanuclear Ni(II)-Ln(III) coordination compounds, [Ni3Ln3(μ3-O)(μ3-OH)3(L)3(μ-OOCCMe3)3]·(ClO4)·wCH3CN·xCH2Cl2·yCH3OH·zH2O [for 1, w = 8, x = 3, y = 0, z = 5.5; for 2, w = 0, x = 5, y = 0, z = 6.5; for 3, w = 15, x = 18, y = 3, z = 7.5; for 4, w = 15, x = 20, y = 6, z = 9.5; and for 5, w = 0, x = 3, y = 2, z = 3]. The molecular structure of these complexes reveals the presence of a monocationic hexanuclear derivative containing one perchlorate counteranion. The asymmetric unit of each of the hexanuclear derivatives comprises the dinuclear motif [NiLn(L)(μ3-O)(μ3-OH)(μ-Piv)]. The cation contains three interlinked O-capped clusters: one Ln(III)3O and three Ni(II)Ln(III)2O. Each of the lanthanide centers is eight- coordinated (distorted trigonal-dodecahedron), while the nickel centers are hexacoordinate (distorted octahedral). The study of the magnetic properties of all compounds are reported and suggests single molecule magnet behavior for the Dy(III) derivative (1).

  12. Enhancement of lanthanide evaporation by complexation: Dysprosium tri-iodide mixed with indium iodide and thulium tri-iodide mixed with thallium iodide

    Energy Technology Data Exchange (ETDEWEB)

    Curry, J. J.; Henins, A.; Hardis, J. E. [National Institute of Standards and Technology, 100 Bureau Drive, Gaithersburg, Maryland 20899 (United States); Estupiñán, E. G. [OSRAM SYLVANIA Inc., 71 Cherry Hill Drive, Beverly, Massachusetts 01915 (United States); Lapatovich, W. P. [Walter Lapatovich Consulting, 51 Pye Brook Lane, Boxford, Massachusetts 01921 (United States); Shastri, S. D. [Advanced Photon Source, Argonne National Laboratory, 9700 South Cass Avenue, Argonne, Illinois 60439 (United States)

    2013-09-28

    The vapors in equilibrium with condensates of DyI{sub 3}, DyI{sub 3}/InI, TmI{sub 3}, and TmI{sub 3}/TlI were observed over the temperature range from 900 K to 1400 K using x-ray induced fluorescence. The total densities of each element (Dy, Tm, In, Tl, and I) in the vapor, summed over all atomic and molecular species, were determined. Dramatic enhancements in the total vapor densities of Dy and Tm were observed in the vapors over DyI{sub 3}/InI and TmI{sub 3}/TlI as compared to the vapors over pure DyI{sub 3} and pure TmI{sub 3}, respectively. An enhancement factor exceeding 10 was observed for Dy at T≈ 1020 K, decreasing to 0 at T≈ 1250 K. An enhancement factor exceeding 20 was observed for Tm at T≈ 1040 K, decreasing to 0 at T≈ 1300 K. Such enhancements are expected from the formation of the vapor-phase hetero-complexes DyInI{sub 4} and TmTlI{sub 4}. Numerical simulations of the thermo-chemical equilibrium suggest the importance of additional complexes in liquid phases. A description of the measurement technique is given. Improvements in the absolute calibration lead to an approximately 40% correction to previously reported preliminary results [J. J. Curry et al., Chem. Phys. Lett. 507, 52 (2011); Appl. Phys. Lett. 100, 083505 (2012)].

  13. Complexation behaviour of DADCA and DAPDA with dysprosium-166/holmium-166 parent daughter system and its potential for use in radioimmunotherapy

    International Nuclear Information System (INIS)

    Orsini, S.; University of Technology, Broadway, NSW; Di Bartolo, N.; Smith, S.; Baker, T.

    1998-01-01

    Full text: A novel approach for the delivery of therapeutic doses from 166 Ho to cancerous tissue is via the decay of its parent, 166 Dy. When designing radioimmunoconjugte, a crucial question is to determine whether the ligand used in the radiolabeling process is capable of holding the 166 Ho on decay of the parent, 166 Dy. In this study, two pendant arm macrocycles 1, 10-Diaza-4, 7, 13, 16-tetraoxacyclooctadecane-N, N'-diacetic acid, (DACDA) and 1, 10-Diaza-4, 7, 13-trioxacyclopentadecane-N, N'-diacetic acid, (DAPDA) that were reported to forms reasonably stable complexes with Dy and Ho, were synthesised. The synthesis of the two pendant arm macrocycles was first attempted using methods outlined by Chang and Rowland. The yields obtained through this method were low (10 % for both ligands) and it was considered important to investigate alternative approaches to the synthesis. The new method involved an alkylation reaction in the presence of acetonitrile and sodium bicarbonate. The method took considerably less time and the yields increased to 88 %. The ligands were characterised using 1 H NMR, 13 C NMR and mass spectrometry. The chemical and radiolytic stabilities of 166 Dy and 166 Ho complexes of the two ligands were investigated at pH = 5 and the ligands potential for use in the in vivo generator system evaluated

  14. CCDC 1402057: Experimental Crystal Structure Determination : pentakis(tetra-n-butylammonium) tetrakis(mu-oxalato)-dodecachloro-tetranitrosyl-ethanol-tetra-ruthenium-dysprosium sesquihydrate

    KAUST Repository

    Kuhn, Paul-Steffen; Cremer, Laura; Gavriluta, Anatolie; Jovanović, Katarina K.; Filipović, Lana; Hummer, Alfred A.; Bü chel, Gabriel E.; Dojčinović, Biljana P.; Meier, Samuel M.; Rompel, Annette; Radulović, Siniša; Tommasino, Jean Bernard; Luneau, Dominique; Arion, Vladimir B.

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  15. 3D dysprosium density in the metal-halide lamp measured by emission and laser absorption spectroscopy in a centrifuge at 1-10g

    NARCIS (Netherlands)

    Flikweert, A.J.; Nimalasuriya, T.; Thubé, G.M.; Kroesen, G.M.W.; Stoffels, W.W.

    2007-01-01

    The metal-halide lamp is a High Intensity Discharge (HID) lamp with a high efficiency. The salt additive (DyI3) acts as prime radiator. The present lamp suffers from non-uniform light output, caused by diffusion and convection processes. To gain a better understanding of the lamp, the convection is

  16. Effect of dysprosium substitution on electrical properties of SrBi{sub 4}Ti{sub 4}O{sub 15}

    Energy Technology Data Exchange (ETDEWEB)

    Mamatha, B., E-mail: boinanemamatha@gmail.com; Sarah, P.

    2014-10-15

    SrBi{sub 4−x}Dy{sub x}Ti{sub 4}O{sub 15} (with x = 0.02, 0.04, 0.06 and 0.08) powders have been synthesized using the stoichiometric amounts of nitrates and oxides of the constituent materials through sol–gel method. The compound so formed is characterized using X-ray diffraction. The density and lattice parameters are calculated. The impedance and electrical conductivity properties are investigated. The imaginary part of impedance as a function of frequency shows Debye like relaxation. Impedance data presented in the Nyquist plot which is used to identify an equivalent circuit and the fundamental circuit parameters are determined at different temperatures. The results of bulk a.c. conductivity as a function of frequency at different temperatures are presented. The dielectric behavior was investigated. Permittivity was calculated based on the relaxation frequency using an alternative approach based on the variation of the imaginary impedance component as a function of reciprocal angular frequency. The frequency dependence of real and imaginary permittivities was also investigated. - Highlights: • SrBi{sub 4−x}Dy{sub x}Ti{sub 4}O{sub 15} (x = 0.02, 0.04, 0.06 and 0.08) powders are produced by sol–gel method. Phase formation is confirmed by XRD analysis. • Frequency dependent imaginary part of impedance shows distribution of relaxation in system. • Broadness of Z″ peak shows distribution of relaxation frequency. • Increase in peak width at ½ maxima of Z″ with increase of temperature shows increase of relaxation frequency distribution. • Cole–Cole plots are resolved into two different circles, ascribed to different mechanisms of polarization and relaxation phenomena.

  17. Transition metal redox switches for reversible "on/off" and "slow/fast" single-molecule magnet behaviour in dysprosium and erbium bis-diamidoferrocene complexes.

    Science.gov (United States)

    Dickie, Courtney M; Laughlin, Alexander L; Wofford, Joshua D; Bhuvanesh, Nattamai S; Nippe, Michael

    2017-12-01

    Single-molecule magnets (SMMs) are considered viable candidates for next-generation data storage and quantum computing. Systems featuring switchability of their magnetization dynamics are particularly interesting with respect to accessing more complex logic gates and device architectures. Here we show that transition metal based redox events can be exploited to enable reversible switchability of slow magnetic relaxation of magnetically anisotropic lanthanide ions. Specifically, we report anionic homoleptic bis-diamidoferrocene complexes of Dy 3+ (oblate) and Er 3+ (prolate) which can be reversibly oxidized by one electron to yield their respective charge neutral redox partners (Dy: [1] - , 1 ; Er: [2] - , 2 ). Importantly, compounds 1 and 2 are thermally stable which allowed for detailed studies of their magnetization dynamics. We show that the Dy 3+ [1] - / 1 system can function as an "on"/"off" or a "slow"/"fast" redox switchable SMM system in the absence or presence of applied dc fields, respectively. The Er 3+ based [2] - / 2 system features "on"/"off" switchability of SMM properties in the presence of applied fields. Results from electrochemical investigations, UV-vis-NIR spectroscopy, and 57 Fe Mössbauer spectroscopy indicate the presence of significant electronic communication between the mixed-valent Fe ions in 1 and 2 in both solution and solid state. This comparative evaluation of redox-switchable magnetization dynamics in low coordinate lanthanide complexes may be used as a potential blueprint toward the development of future switchable magnetic materials.

  18. Comparison of MR imaging after administration of dysprosium-based magnetic-susceptibility contrast media with diffusion-weighted MR imaging in evaluation of regional cerebral ischemia

    International Nuclear Information System (INIS)

    Moseley, M.E.; Kucharczyk, J.; Kurhanewicz, J.; Mintorovitch, J.; Cohen, Y.; Rocklage, S.; Quay, S.C.; Norman, D.

    1989-01-01

    This paper reports on a study to establish whether a nonionic T2-shortening contrast agent, Dy-DTPA-bis(methylamide) (Dy-DTPA-BMA), would facilitate early detection of stroke-induced cerebral perfusion deficits. The sensitivity of susceptibility-enhanced MR imaging was compared with that of diffusion-weighted MR imaging in the same cats subjected to unilateral occlusion of the middle cerebral artery (MCA). A 2-T unit, equipped with self-shielded gradient coils (± 20 G/cm, 15-cm bore size), was used in conjunction with an 8.5-cm inner diameter low-pass bird cage proton imaging coil. Diffusion-weighted images displayed increased signal intensity in the ischemic MCA territory less than 1 hour after occlusion, whereas T2-weighted MR images without contrast enhancement usually failed to depict injury for 2--3 hours after toke. With contrast administration (0.5 mmoles/kg of Dy-DTPA-BMA), however, T2-weighted images revealed perfusion deficits (hyperintensity) within 1 hour after MCA occlusion, and these corresponded to the anatomic regions of ischemic injury shown on diffusion-weighted MR images

  19. Magnetic anisotropy and neutron scattering studies of some rare earth metals

    International Nuclear Information System (INIS)

    Day, R.

    1978-08-01

    The thesis is concerned with magnetic anisotropy of dysprosium and alloys of gadolinium: yttrium, and also neutron scattering studies of dysprosium. The experiments are discussed under the topic headings: magnetic anisotropy, rare earths, torque measurements, elastic neutron scattering, inelastic neutron scattering, dysprosium measurements, and results for the gadolinium: yttrium alloys. (U.K.)

  20. 46 CFR 159.010-15 - Contracting inspections and tests or transferrals to another laboratory or person.

    Science.gov (United States)

    2010-10-01

    ...— (1) A request in writing regarding the contract or transfer is submitted to the Commandant before the contract is executed or the transfer is completed; and (2) The Commandant notifies the laboratory in... SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF...

  1. Retraction notice to "Biomass supply chain optimisation for Organosolv-based biorefineries" [Bioresour. Technol. 159 (2014) 387-396].

    Science.gov (United States)

    Giarola, Sara; Patel, Mayank; Shah, Nilay

    2014-11-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal (http://www.elsevier.com/locate/withdrawalpolicy). This article has been retracted at the request of the Authors. This article has been retracted because it includes important elements of an unpublished model which has been developed by others. The authors believe that the most responsible course of action is to retract their paper. The Authors deeply regret this circumstance and apologize to the scientific community. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Understanding Teachers' Pedagogical Knowledge: Report on an International Pilot Study. OECD Education Working Papers, No. 159

    Science.gov (United States)

    Sonmark, Kristina; Révai, Nóra; Gottschalk, Francesca; Deligiannidi, Karolina; Burns, Tracey

    2017-01-01

    What is the nature of teachers' pedagogical knowledge? The Innovative Teaching for Effective Learning Teacher Knowledge Survey (ITEL TKS) set out to answer this question in a pilot study that ran in five countries: Estonia, Greece, Hungary Israel, and the Slovak Republic. Using convenience samples, the pilot assessed the pedagogical knowledge base…

  3. Extricate of incomplete fusion reactions at 4-7 MeV/A System:19F+159Tb

    International Nuclear Information System (INIS)

    Unnati; Mandal, S.K.; Yadav, A.; Singh, D.P.; Goswami, S.; Singh, B.P.; Sharma, M.K.

    2015-01-01

    Probing of heavy ion interactions and extricating of incomplete fusion (ICF) reactions at low energy regime is a topic of current interest. The main points of such studies is to explore the effect of various entrance channel parameters, viz., (i) the projectile energy, (ii) the mass asymmetry of interacting partners, and (iii) the input angular momenta imparted into the system. It is also pointed out that a separation of CF (Complete Fusion) from ICF is important for meaningful interpretation towards the splitting of nuclei. Further, considerable efforts are being employed to synthesize super heavy nuclei, the presence of various competing channels may add complexity to the synthesis of super heavy nuclei and obstruct the formation of such nuclei. Although, it is now possible to investigate reaction mechanism involved in formation of such nuclei but experimental studies are limited

  4. SU-E-J-159: Intra-Patient Deformable Image Registration Uncertainties Quantified Using the Distance Discordance Metric

    International Nuclear Information System (INIS)

    Saleh, Z; Thor, M; Apte, A; Deasy, J; Sharp, G; Muren, L

    2014-01-01

    Purpose: The quantitative evaluation of deformable image registration (DIR) is currently challenging due to lack of a ground truth. In this study we test a new method proposed for quantifying multiple-image based DIRrelated uncertainties, for DIR of pelvic images. Methods: 19 patients were analyzed, each with 6 CT scans, who previously had radiotherapy for prostate cancer. Manually delineated structures for rectum and bladder, which served as ground truth structures, were delineated on the planning CT and each subsequent scan. For each patient, voxel-by-voxel DIR-related uncertainties were evaluated, following B-spline based DIR, by applying a previously developed metric, the distance discordance metric (DDM; Saleh et al., PMB (2014) 59:733). The DDM map was superimposed on the first acquired CT scan and DDM statistics were assessed, also relative to two metrics estimating the agreement between the propagated and the manually delineated structures. Results: The highest DDM values which correspond to greatest spatial uncertainties were observed near the body surface and in the bowel due to the presence of gas. The mean rectal and bladder DDM values ranged from 1.1–11.1 mm and 1.5–12.7 mm, respectively. There was a strong correlation in the DDMs between the rectum and bladder (Pearson R = 0.68 for the max DDM). For both structures, DDM was correlated with the ratio between the DIR-propagated and manually delineated volumes (R = 0.74 for the max rectal DDM). The maximum rectal DDM was negatively correlated with the Dice Similarity Coefficient between the propagated and the manually delineated volumes (R= −0.52). Conclusion: The multipleimage based DDM map quantified considerable DIR variability across different structures and among patients. Besides using the DDM for quantifying DIR-related uncertainties it could potentially be used to adjust for uncertainties in DIR-based accumulated dose distributions

  5. 159. Trombectomía de Vena Cava Inferior Por Invasión de Tumor Renal

    Directory of Open Access Journals (Sweden)

    N. Miranda

    2012-04-01

    Conclusiones: en casos seleccionados, el carcinoma de célula renal extendiéndose a VCI puede ser resecado sin dificultad sin necesidad de esternotomía, CBP o PCHP, constituyendo una alternativa curativa en el tratamiento de dichos tumores.

  6. Preparation, characterization, and luminescence properties of dysprosium perchlorate with MABA-Si and phen or dipy complexes as well as SiO{sub 2}@Dy(MABA-Si)L core-shell structure nanometermeter luminescent composites

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Zheng, Yu-Shan [Inner Mongolia Autonomous Region Product Quality Inspection Institute, Hohhot 010010 (China); Cao, Xiao-fang; Bai, Juan; Fu, Zhi-Fang; Bao, Jin-Rong; Li, Yi-Lian [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China)

    2016-10-15

    Two novel ternary rare earth complexes Dy(MABA-Si)·L{sub 2}(ClO{sub 4}){sub 3}·2H{sub 2}O (L= Phen or Dipy) were prepared using HOOCC{sub 6}H{sub 4}N(CONH(CH{sub 2}){sub 3}Si-(OCH{sub 2}CH{sub 3}){sub 3}){sub 2} which was abbreviated or denoted as MABA-Si. MABA-Si was the first ligand, L was the second ligand. The corresponding two SiO{sub 2}@Dy(MABA-Si)L nanometermeter luminescent composites were synthesized as well, and the silica spheres is the core, and the ternary rare earth complex Dy(MABA-Si)·L{sub 2}(ClO{sub 4}){sub 3}·2H{sub 2}O was the shell layer, who was abbreviated or denoted as Dy((MABA-Si)L). The ternary complexes have been characterized by element analysis, molar conductivity, IR spectra and {sup 1}HNMR spectra. The results showed that the chemical formula of the complex was Dy(MABA-Si)·L{sub 2}(ClO{sub 4}){sub 3}·2H{sub 2}O. The fluorescent spectra illustrated that the complexes displayed its characteristic luminescence in solid state, and the luminescence was superior than Dy{sup 3+}. The core-shell structure of SiO{sub 2}@Dy(MABA-Si)L nanometermeter luminescent composite was characterized by SEM, TEM and IR spectra. Based on the SEM photographs, the core-shell structure particles showed its regular microstructure including smooth surface, and good dispersity. The ternary complex coated on the mono-dispersed SiO{sub 2} spheres by self-assembly. The fluorescent spectra illustrated that the core-shell structure of SiO{sub 2}@Dy(MABA-Si)L nanometermeter luminescent composites exhibited stronger fluorescent than the ternary complexes. The fluorescence lifetime of the complexes and core-shell structure composites was measured as well.

  7. Dysprosium-doped PbGa2S4 laser generating at 4.3 μm directly pumped by 1.7 μm laser diode.

    Science.gov (United States)

    Jelínková, Helena; Doroshenko, Maxim E; Jelínek, Michal; Sulc, Jan; Osiko, Vyacheslav V; Badikov, Valerii V; Badikov, Dmitrii V

    2013-08-15

    In this Letter, we demonstrate the pulsed and CW operation of the Dy:PbGa(2)S(4) laser directly pumped by the 1.7 μm laser diode. In the pulsed regime (pulse duration 5 ms; repetition rate 20 Hz), the maximum mean output power of 9.5 mW was obtained with the slope efficiency of 9.3% with respect to the absorbed pump power. The generated wavelength was 4.32 μm, and the laser beam cross section was approximately Gaussian on both axes. Stable CW laser generation was also successfully obtained with the maximum output power of 67 mW and the slope efficiency of 8%. Depopulation of the lower laser level by 1.7 μm pump radiation absorption followed by 1.3 μm upconversion fluorescence was demonstrated. These results show the possibility of construction of the compact diode-pumped solid-state pulsed or CW laser generating at 4.3 μm in the power level of tens mW operating at room temperature.

  8. Stability constants and thermodynamic parameters of trivalent gadolinium, yttrium, terbium, dysprosium and holmium complexes with 2-(p-sulphophenylazo) 1,8-dihydroxynaphthalene 3,6 disulphonic acid (trisodium salt)[SPADNS

    International Nuclear Information System (INIS)

    Dubey, S.N.; Nagpal, S.; Kalra, H.L.; Puri, D.M.

    1980-01-01

    The stepwise stability constants of Gd(III), Y(III), Tb(III), Dy(III) and Ho(III) complexes with SPADNS have been determined potentiometrically in aqueous solution using Bjerrum-Calvin technique as modified by Irving and Rossotti at different temperatures (20deg and 40deg) and 0.1 M ionic strength (NaClO 4 ). The trend in the stability of these metal complexes has been found to be: Ho(III) > Dy(III) > Tb(III) > Y(III) > Gd(III). The overall changes in ΔGdeg, ΔHdeg and ΔSdeg accompanying the complex formation have also been determined. (author)

  9. Stability constants and thermodynamic parameters of trivalent gadolinium, yttrium, terbium, dysprosium and holmium complexes with 2-(p-sulphophenylazo) 1,8-dihydroxynaphthalene 3,6 disulphonic acid (trisodium salt)(SPADNS)

    Energy Technology Data Exchange (ETDEWEB)

    Dubey, S.N.; Nagpal, S.; Kalra, H.L.; Puri, D.M. (Kurukshetra Univ. (India). Dept. of Chemistry)

    1980-10-01

    The stepwise stability constants of Gd(III), Y(III), Tb(III), Dy(III) and Ho(III) complexes with SPADNS have been determined potentiometrically in aqueous solution using Bjerrum-Calvin technique as modified by Irving and Rossotti at different temperatures (20deg and 40deg) and 0.1 M ionic strength (NaClO/sub 4/). The trend in the stability of these metal complexes has been found to be: Ho(III) > Dy(III) > Tb(III) > Y(III) > Gd(III). The overall changes in ..delta..Gdeg, ..delta..Hdeg and ..delta..Sdeg accompanying the complex formation have also been determined.

  10. Poly[(6-carboxypicolinato-κ3O2,N,O6(μ3-pyridine-2,6-dicarboxylato-κ5O2,N,O6:O2′:O6′dysprosium(III

    Directory of Open Access Journals (Sweden)

    Xu Li

    2009-11-01

    Full Text Available In the title complex, [Dy(C7H3NO4(C7H4NO4]n, one of the ligands is fully deprotonated while the second has lost only one H atom. Each DyIII ion is coordinated by six O atoms and two N atoms from two pyridine-2,6-dicarboxylate and two 6-carboxypicolinate ligands, displaying a bicapped trigonal-prismatic geometry. The average Dy—O bond distance is 2.40 Å, some 0.1Å longer than the corresponding Ho—O distance in the isotypic holmium complex. Adjacent DyIII ions are linked by the pyridine-2,6-dicarboxylate ligands, forming a layer in (100. These layers are further connected by π–π stacking interactions between neighboring pyridyl rings [centroid–centroid distance = 3.827 (3 Å] and C—H...O hydrogen-bonding interactions, assembling a three-dimensional supramolecular network. Within each layer, there are other π–π stacking interactions between neighboring pyridyl rings [centroid–centroid distance = 3.501 (2 Å] and O—H...O and C—H...O hydrogen-bonding interactions, which further stabilize the structure.

  11. Moving Up from the Segment: A Comment on Aichert and Ziegler's Syllable Frequency and Syllable Structure in Apraxia of Speech, "Brain and Language," 88, 148-159, 2004

    Science.gov (United States)

    Varley, Rosemary; Whiteside, Sandra; Windsor, Fay; Fisher, Helen

    2006-01-01

    In a recent article, Aichert and Ziegler (2004) explore whether apraxia of speech (AOS) can be explained by disruption of the phonetic plans for high frequency syllables. This approach is a hybrid one, combining the notion of a mental syllabary with an explanation that the impairment in AOS results from reduced access to supra-segmental phonetic…

  12. Nuclear Polluters' Charter. Council directive 96/29/EURATOM (OJ L159 29th June 1996), the 'Basic Standards Directive'; briefing for MPs and MEPs

    International Nuclear Information System (INIS)

    Bramhall, R.

    1997-01-01

    The nuclear industry has huge 'back end' problems: acres of radioactive waste stacked up with no final disposal route; hundreds of thousands of tonnes of metals, glass, plastic, and concrete too 'hot' to re-use or dump. Sea dumping has been ruled out, Nirex's deep repository is back to square one, the waste mountain is growing, and hundreds of nuclear factories and power stations await decommissioning. But by May 2000 the UK and all member states are required to conform with a dangerously vague and permissive Directive, and deregulate much of this expensive, embarrassing, and harmful waste. Below certain very lax limits it will become a financial asset to be sold on the open market. What cannot be sold will be landfilled and incinerated without restriction. Ostensibly, the Directive is a 'harmonisation' of radiation exposure standards. It was promulgated by the European Commission under the Euratom Treaty of 1957. The European Parliament has no power over Euratom, and (with one exception) amendments advised by MEPs were ignored. The Directive effectively deregulates reuse, recycling, disposal, and incineration of radioactive materials below certain threshold levels. It specifically allows recycling of contaminated materials and drops a precautionary proviso used in earlier European legislation. Spokesmen from the nuclear industry, the regulators, and the Commission openly admit that there is nothing to stop hundreds of thousands of tonnes of radioactive materials from nuclear licensed sites - potentially, their entire inventory - being diluted into industrial feedstocks of recyclable materials and ending up in consumer goods, fertilisers or any product. The Commission's view is let the buyers beware if they don't want contaminated goods or raw materials. National radiation protection agencies which advise the Commission and national governments claim that there is no threat to health, according to internationally accepted radiation risk factors. But those same agencies set the standards, through their incestuous relationships with the International Commission on Radiological Protection (ICRP). From its inception, both the personnel and the work of ICRP were heavily influenced by the nuclear industry and the politics of nuclear confrontation. Their impartiality is in doubt and the underlying science is demonstrably unreliable. BSE, asbestos, tobacco, and many chemicals are now seen to cause disease in ways scientists did not at first understand; man-made radiation is the extreme example. Disastrous consequences were foretold by Nobel laureates Linus Pauling and Andrei Sakharov in the late 1950s, and there is now plentiful evidence that genetic damage from weapons-testing fallout is the major cause of the current world-Wide cancer epidemic. The world community of radiation biologists is in open and growing discord; some are saying that the human gene pool is being permanently polluted. When such doubts are being expressed it is inexcusable to allow a new wave of radioactive contamination; some environmental and criminal lawyers are of the opinion that those responsible may be liable to criminal prosecution for occasioning actual bodily harm. Radioactive waste should be stored in retrievable form, monitored, and repackaged as necessary to prevent it escaping into the biosphere. The Low Level Radiation Campaign, in consultation with Greenpeace, Friends of the Earth, the Campaign for Nuclear Disarmament and environmental and ethical organisations across Europe, is taking the lead in a campaign to prevent implementation of the Directive's worst aspects. (author)

  13. Effect of an allergy prevention programme on incidence of atopic symptoms in infancy. A prospective study of 159 "high-risk" infants

    DEFF Research Database (Denmark)

    Halken, S; Høst, A; Hansen, L G

    1992-01-01

    unrestricted diet. Avoidance of daily exposure to tobacco smoke, furred pets and dust-collecting materials in the bedroom were advised. This prevention group was compared with a control group consisting of 54 identically defined "high-risk" infants born in 1985 in the same area. All infants had either severe...... comparable. The parents were highly motivated and compliance was good. The rate of participation was 97%, and 85% followed the dietary measures strictly. The cumulative prevalence of atopic symptoms was significantly lower at 18 months in the prevention group (32%), as compared with the control group (74...... single atopic predisposition combined with cord blood IgE > or = 0.5 KU/l or biparental atopic predisposition. The control group had unrestricted diet and was not advised about environmental factors. Apart from the prevention programme and year of birth the prevention group and the control group were...

  14. CRED Subsurface Temperature Recorder (STR); PRIA, JAR; Long: -159.99661, Lat: -00.38210 (WGS84); Sensor Depth: 32.61m; Data Range: 20080327-20100403.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  15. Multibeam collection for TN159: Multibeam data collected aboard Thomas G. Thompson from 2003-07-28 to 2003-08-20, Victoria, Canada to Astoria, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  16. SU-F-J-159: Influence of the Elevated Posterior Position by Using the Customized Vacuum-Bag On the Abdominal MR Image Quality: A Quantitative Phantom Study

    Energy Technology Data Exchange (ETDEWEB)

    Wong, O; Yuan, J; Law, M; Ding, A; Yu, S; Cheung, K [Hong Kong Sanatorium & Hospital, Hong Kong, N/A (Hong Kong)

    2016-06-15

    Purpose: Signal-to-noise ratio(SNR) of MR abdominal imaging in diagnostic radiology is maximized by minimizing the coil-to-patient distance. However, for radiotherapy applications, customized vacuum-bag is needed for abdominal immobilization at the cost of the increasing distance to the posterior spine coil. This sub-optimized coil setting for RT applications may compromise image quality, such as SNR and homogeneity, thus potentially affect tissue delineation. In this study, we quantitatively evaluate the effect of the vertical position change on SNR and image quality change using an ACR MR phantom. Methods: An ACR MR phantom was placed on the flat couch top. Images were acquired using an 18-channel body array coil and spine coil on a dedicated 1.5T MR-simulator. The scan was repeated three times with the ACR phantom elevated up to 7.5cm from the couch top, with a step size of 2.5cm. All images were acquired using standard ACR test sequence protocol of 2D spin-echo T1-weighted(TR/TE=500/200ms) and T2-weighted(TR/TE1/TE2=2000/20/80) sequences. For all scans, pre-scan normalization was turned on, and the distance between the phantom and the anterior 18-channel body array coil was kept constant. SNR was calculated using the slice with a large water-only region of the phantom. Percent intensity uniformity(PIU) and low contrast object detectability(LCD) were assessed by following ACR test guidelines. Results: The decrease in image SNR(from 335.8 to 169.3) and LCD(T1: from 31 to 19 spokes, T2: 26 to 16 spokes) were observed with increasing vertical distance. After elevating the phantom by 2.5cm(approximately the thickness of standard vacuum-bag), SNR change(from 335.8 to 275.5) and LCD(T1: 31 to 26 spokes, T2: 26 to 21 spokes) change were noted. However, similar PIU was obtained for all choices of vertical distance (T1: 94.5%–95.0%, T2: 94.4%–96.8%). Conclusion: After elevating the scan object, reduction in SNR level and contrast detectability but no change in image homogeneity was observed.

  17. Pedagogia Salesiana: O Oratório festivo como princípio e fundamento da educação salesiana (p. 145-159)

    OpenAIRE

    de Souza, Rodrigo Tarcha Amaral

    2015-01-01

    Com a intenção de apresentar os conceitos referentes ao Oratório festivo como princípio e fundamento da Educação salesiana, o artigo, por meio de referencial teórico historicista e analítico, traz reflexões, conjecturas e hipóteses acerca dos pontos convergentes e divergentes entre a tradição salesiana e a atual operacionalização dos Oratórios festivos. Além de promover o diálogo da afirmação institucional, ou não, dos atuais Oratórios. O artigo apresenta ainda, já numa perspectiva conclusiva...

  18. CRED Subsurface Temperature Recorder (STR); PRIA, JAR; Long: -159.99113, Lat: -00.36327 (WGS84); Sensor Depth: 9.75m; Data Range: 20060321-20080327.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  19. Multibeam collection for KN159L7: Multibeam data collected aboard Knorr from 1998-11-17 to 1998-12-16, Recife, Brazil to Cape Verde

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  20. http://sjm06.com/SJM%20ISSN1452-4864/9_2_2014_November_145-292/9_2_2014_159_171.pdf

    Directory of Open Access Journals (Sweden)

    Ildikó Marosi

    2014-10-01

    Full Text Available There are explicit, as well as tacit expectations among skills and competencies that are demanded from those newly graduated. My main question of interest is the following: Where do young people learn these skills, knowledge and experience? Present paper is based on literature review and a quantitative research which was conducted among university students aged 18-33, in autumn 2013. The findings prove that a significant part of tacit knowledge is gained through family socialisation, during the process of informal learning rather than via formal education. Hence, family socialisation affects the competence portfolio of young graduates immensely. Present paper endeavours to investigate this influence.

  1. CRED Subsurface Temperature Recorder (STR); PRIA, JAR; Long: -159.97228, Lat: -00.37500 (WGS84); Sensor Depth: 30.70m; Data Range: 20060320-20080328.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  2. Study on Magnetic Responsibility of Rare Earth Ferrite/Polyacrylamide Magnetic Microsphere

    Institute of Scientific and Technical Information of China (English)

    Zhang Ming; Wang Zhifeng; Zhang Hong; Dai Shaojun; Qiu Guanming; Okamoto Hiroshi

    2005-01-01

    In inverse microemulsion, rare earth ferrite/polyacrylamide magnetic microsphere were prepared and their magnetic responsibility were studied by magnetic balance. Results indicate that the magnetic responsibility of microsphere relates to magnetic moment of rare earth ion, and it can be improved by the addition of dysprosium ion of high magnetic moment. Dysprosium content has an effect on magnetic responsibility of dysprosium ferrite/polyacrylamide magnetic microsphere. The microsphere displays strong magnetic responsibility when the molar ratio of Dy3+/iron is 0.20.

  3. Synthesis and X-ray structure of the dysprosium(III complex derived from the ligand 5-chloro-1,3-diformyl-2-hydroxybenzene-bis-(2-hydroxybenzoylhydrazone [Dy2(C22H16ClN4O53](SCN 3.(H2O.(CH3OH

    Directory of Open Access Journals (Sweden)

    Aliou H. Barry

    2003-12-01

    Full Text Available The title compound [Dy2(C22H16ClN4O53](SCN 3.(H2O.(CH3OH has been synthesized and its crystal structure determined by single X-ray diffraction at room temperature. The two nine coordinated Dy(III are bound to three macromolecules ligand through the phenolic oxygens of the p-chlorophenol moieties, the nitrogen atoms and the carbonyl functions of the hydrazonic moieties. The phenolic oxygen atoms of the 2-hydroxybenzoyl groups are not bonded to the metal ions. In the bases of the coordination polyhedra the six Dy-N bonds are in the range 2.563(13-2.656(13 Å and the twelve Dy-O bonds are in the range 2.281(10-2.406(10 Å.

  4. Synthesis and magneto-structural studies on a new family of carbonato bridged 3d-4f complexes featuring a [CoLn(CO3)] (Ln = La, Gd, Tb, Dy and Ho) core: slow magnetic relaxation displayed by the cobalt(ii)-dysprosium(iii) analogue.

    Science.gov (United States)

    Majee, Mithun Chandra; Towsif Abtab, Sk Md; Mondal, Dhrubajyoti; Maity, Manoranjan; Weselski, Marek; Witwicki, Maciej; Bieńko, Alina; Antkowiak, Michał; Kamieniarz, Grzegorz; Chaudhury, Muktimoy

    2018-03-06

    A new family of [3 + 3] hexanuclear 3d-4f complexes [(μ 3 -CO 3 ){Co II Ln III L(μ 3 -OH)(OH 2 )} 3 ]-(ClO 4 )·mC 2 H 5 OH·nH 2 O (1-5) [Ln = La (1), Gd (2), Tb (3), Dy (4), and Ho (5)] have been prepared in moderate to high yields (62-78%) following a self-assembly reaction between the ligand 6,6',6''-(nitrilotris(methylene))tris-(2-methoxy-4-methylphenol) (H 3 L), Co(OAc) 2 ·4H 2 O and the lanthanide ion precursors in the mandatory presence of tetrabutylammonium hydroxide. During the reaction, atmospheric carbon dioxide is fixed in the product molecule as a bridging carbonato ligand which connects all the three lanthanide centers of this molecular assembly through a rare η 2 :η 2 :η 2 -μ 3 mode of bridging as revealed from X-ray crystallography. The metal centers in all these compounds, except the Gd III analogue (2), are coupled in antiferromagnetic manner while the nature of coupling in the CoGd complex is ferromagnetic. DFT calculations revealed that this ferromagnetic interaction occurs most likely by the Co II -Gd III superexchange, mediated via the bridging oxygen atoms. Only the Co II -Dy III compound (4) displayed a slow relaxation of the magnetization at a very low temperature as established by AC susceptibility measurements. The data provides an estimation of the activation energy U/k B = 9.2 K and the relaxation time constant τ 0 = 1.0 × 10 -7 s.

  5. CRED Subsurface Temperature Recorder (STR); Jarvis Island, Pacific Remote Island Areas; Long: -159.99118, Lat: -00.36291 (WGS84); Sensor Depth: 29.30m; Data Date Range: 20100404-20120504.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  6. CRED Subsurface Temperature Recorder (STR); Jarvis Island, Pacific Remote Island Areas; Long: -159.97227, Lat: -00.37505 (WGS84); Sensor Depth: 33.20m; Data Date Range: 20100403-20120505.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  7. CRED Wave and Tide Recorder (WTR); MHI, KAU; Long: -159.77703, Lat: 22.12335 (WGS84); Sensor Depth: 25.30m; Data Range: 20050723-20060812.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Wave and Tide Recorders (WTR) provide a time series of...

  8. Síntese e caracterização de nanoestruturas de sílica SBA -16 contendo gadolinio-159 como potencial sistema nanoparticulado para o tratamento do câncer

    OpenAIRE

    André Felipe de Oliveira

    2013-01-01

    O câncer é uma das principais causas de morte em todo o mundo, sendo as neoplasias malignas de pulmão, estômago, fígado, cólon e mama em maior número. E, recentemente, observa-se na literatura um grande número de trabalhos onde novos materiais, especialmente nanoparticulados, vêm sendo estudados como carreadores de drogas e radioisótopos aplicados ao tratamento do câncer. Como materiais mesoporosos à base de sílica, graças a sua enorme área superficial e biocompatibilidade, têm sido estudados...

  9. Gilles Tondini, L’image obscène (The obscene image. Parisian hospital break room Graffitti, New York et Londres, Mark Batty publisher et Thames & Hudson, 2010, 159 p.

    Directory of Open Access Journals (Sweden)

    Christian Hottin

    2012-03-01

    Full Text Available Lors de la parution du livre de Gilles Tondini, le quotidien Libération consacra son « Grand angle » aux fresques des salles de garde des hôpitaux parisiens avec cette introduction : « Sur les murs des salles de garde, les réfectoires réservés aux Internes, s’étalent des peintures où le sexe est roi. Un livre de photos les révèle pour la première fois alors qu’elles sont menacées de disparition ». Comme souvent en feuilletant un journal, le lecteur un peu averti d’un sujet peut déceler d’embl...

  10. Proceedings: NATO CCMS (Committee on the Challenges of Modern Society) Seminar Blue Book 159, Preservation of Flora and Fauna in Military Training Areas Held in Soesterberg, Netherlands on 28-30 November 1984

    Science.gov (United States)

    1987-01-01

    CONSERVATION MEASURES AND CULTIVATION ON MILITARY TRAINING AREAS... .o...o......, ..... **.. 99 Ulrich V. Coler PROTECTION OF SPECIES AND BIOTOPES ON MTAs.o...stone cliffs. The climate is coastal and there are very few species of beast and bird of prey. Most of the land side is cultivated for agricultural or...experimentations, trainings, etc.) and the checks carried out and going on at present on waste waters from the ecotoxicological point of view, are

  11. Efeitos das cepas probioticas de Lactobacillus acidophilus ATCC 4356, Lactobacillus rhamnosus ATCC 1465 e ATCC 7469 sobre o crescimento planctonico e formação de biofilme de Streptococcus mutans UA 159

    OpenAIRE

    Carneiro, Tamara Rodrigues de Andrade [UNESP

    2015-01-01

    Most probiotic bacteria used in commercial products belong to the genus Lactobacillus. However, the effects of Lactobacillus probiotic strains in the oral health need to be further investigated. The objective of this study is to evaluate the effects of probiotic Lactobacillus strains, on Streptococcus mutans. Lactobacillus strains acidophilus ATCC 4356, Lactobacillus rhamnosus ATCC 1465, Lactobacillus rhamnosus ATCC 7469 were tested on planktonic and biofilm growth of Streptococcus mutans (UA...

  12. CRED Wave and Tide Recorder (WTR); MHI, KAU; Long: -159.55998, Lat: 22.22839 (WGS84); Sensor Depth: 2.13m; Data Range: 20070422-20070922.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Wave and Tide Recorders (WTR) provide a time series of...

  13. CRED Subsurface Temperature Recorder (STR); Jarvis Island, Pacific Remote Island Areas; Long: -159.99663, Lat: -00.38187 (WGS84); Sensor Depth: 10.10m; Data Date Range: 20100403-20120503.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  14. Measurement of the yields of residual nuclei in interactions 17.9 GeV/c α-particles with sup(159)Tb, sup(181)Ta and sup(207,2)Pb nuclei

    International Nuclear Information System (INIS)

    Butsev, V.S.; Butseva, G.L.; Kostin, V.Ya.; Migalenya, V.Ya.

    1984-01-01

    The results of investigations of 17.9 GeV/c α-particle interactions with Tb, Ta and Ph nuclei are presented. Measurements have been carried out of the relative yields of residual nuclei for the (α+Tb), (α+Ta) and (α+Pb) reactions in the 24 93 Tc, 133 Ce and 198 Tl the isomeric ratios are determined, that are compared with the isomeric ratios measured in reactions induced by 500 MeV protons and by 25.2 GeV 12 C ions

  15. Multibeam collection for KN159L5: Multibeam data collected aboard Knorr from 1998-10-06 to 1998-11-04, Rio de Janeiro, Brazil to Rio de Janeiro, Brazil

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  16. Why does informatics work? Compensation strategies of the actors in the implementation of a medical prescription writing software - DOI: 10.3395/reciis.v2i1.159en

    Directory of Open Access Journals (Sweden)

    Gloria Zarama-Vasquez

    2008-10-01

    Full Text Available The present article describes the informatization process of a hospital service, taking as an example the implementation of a prescription writing software. This tool allows doctors to prescribe via computer the pharmaceutical regimen to be prepared and dispensed by the nursing personnel. The ethnographic study in the hospital service describes the introduction process of this tool from the perspective of the daily activities of the nursing staff. The article highlights a number of difficulties the users are facing and describes the solutions they create, in particular the “compensation strategies” they develop for turning the tool operational, reliable and efficient. The article also shows that the compensation strategies the users are creating in situ are partly invisible for the designers of the software. Distant from the daily activities of the users, the software designers neither perceive the problems involved with the use of the product, nor do they perceive the locally created solutions. They ascribe the performance of the tool to the quality of its conception and possibilities of improvement. This article invites the readers to reflect about what turns an information system efficient and effective and about the lessons learned for the conception of these tools.

  17. Resorcinol ninhydrin complex: 1,5,9-trihydroxy-8-oxatetracyclo[7.7.0.02,7.010,15]hexadeca-2,4,6,10(15,11,13-hexaen-16-one

    Directory of Open Access Journals (Sweden)

    B. Sridhar

    2012-05-01

    Full Text Available In the title compound, C15H10O5, the cyclopentanone (r.m.s. deviation = 0.049 Å and oxolane (r.m.s. deviation = 0.048 Å rings make a dihedral angle of 67.91 (4°. An intramolecular O—H...O hydrogen bond is observed. In the crystal, molecules associate via O—H...O hydrogen bonds, forming a three-dimensional network.

  18. Cermet electrode

    Science.gov (United States)

    Maskalick, Nicholas J.

    1988-08-30

    Disclosed is a cermet electrode consisting of metal particles of nickel, cobalt, iron, or alloys or mixtures thereof immobilized by zirconia stabilized in cubic form which contains discrete deposits of about 0.1 to about 5% by weight of praseodymium, dysprosium, terbium, or a mixture thereof. The solid oxide electrode can be made by covering a substrate with particles of nickel, cobalt, iron, or mixtures thereof, growing a stabilized zirconia solid oxide skeleton around the particles thereby immobilizing them, contacting the skeleton with a compound of praseodymium, dysprosium, terbium, or a mixture thereof, and heating the skeleton to a temperature of at least 500.degree. C. The electrode can also be made by preparing a slurry of nickel, cobalt, iron, or mixture and a compound of praseodymium, dysprosium, terbium, or a mixture thereof, depositing the slurry on a substrate, heating the slurry to dryness, and growing a stabilized zirconia skeleton around the metal particles.

  19. Chemical composition and microstructure of magnetically melt-textured Bi2Sr2Ca0.8Dy0.2Cu2O8-y

    International Nuclear Information System (INIS)

    Stassen, S.; Rulmont, A.; Krekels, T.; Ausloos, M.; Cloots, R.

    1996-01-01

    Dysprosium-doped Bi-based 2212 materials have been synthesized in the presence of a magnetic field, applied perpendicularly to the lateral face of a cylinder, by a melt-textured growth process. Thick (well oriented) layers of different chemical composition have been observed. A dysprosium-doped 2212 phase (the expected D phase) and a dysprosium-free bismuth-rich and strontium-deficient 2212 phase have been found. It is argued that the latter is a so-called M phase. Other impurity phases have been observed, connected with both 2212-type layers. A novel aspect of this work is the calcium solubility at the strontium site in the 2201 structure, and inversely the strontium solubility at the calcium site in the 8250 structure. (orig.)

  20. Influence of a solvent on thermodynamics of electrolytic dissociation of simple and complex rare earth salts

    Energy Technology Data Exchange (ETDEWEB)

    Gorodyskij, A.V.; Fialkov, Yu.Ya.; Chernyj, D.B. (AN Ukrainskoj SSR, Kiev. Inst. Obshchej i Neorganicheskoj Khimii; Kievskij Politekhnicheskij Inst. (Ukrainian SSR))

    1982-03-01

    Influence of the double mixed solvent on thermodynamic characteristics of ionic migration of lanthanum, neodymium, europium and dysprosium chlorides as well as their phenanthroline complexes is considered. Decrease of lambdasub(c) of simple and complex rare earth salts in the lanthanum, neodymium-europium-dysprosium series as explained by increase of solvation degree, associated with lanthanum compression. It is shown that increase of methanol or propanol content results in exothermicity decrease of the ionic migration process. The temperature constituents of enthalpy and entropy of dissociation of the simple and complex rare earth salts are presented.

  1. Steric structure and thermodynamic aspects of Dy3+ complexes with aminobenzoic acids in aqueous solutions

    International Nuclear Information System (INIS)

    Kondrashina, Yu.G.; Mustafina, A.R.; Vul'fson, S.G.

    1994-01-01

    Stability and structure of dysprosium(3) aminobenzoate complexes with molar ratios Dy:L 1:1 and 1:2 (HL-aminobenzoic acid) in aqueous solutions are determined on the basis of pH-metric and paramagnetic birefringence data. The increase of conjugation effect in the series of benzoic, meta- ortho-, and para-aminobenzoic acid results in the increase of stability of 1:1 and 1:2 complexes. Features of the structure and coordination of ligands in dysprosium complexes with meta-, ortho-, and para-aminobenzoic acid are considered. 11 refs.; 4 figs.; 2 tabs

  2. Faraday effect in γ-Dy2S3 and c-Dy2O3 paramagnetic crystals

    International Nuclear Information System (INIS)

    Shelykh, A.I.

    1987-01-01

    Studies of spectral and temperature dependences of Faraday effect in γ-Dy 2 S 3 and C-Dy 2 O 3 paramagnetic crystals are conducted. Paramagnetism of these crystals is brought about by Dy 3+ ions. Estimation of the effect of such factors as the value of paramagnetic ion concentration, width of the forbidden band, crystallochemical composition on magnetooptical effect in the considered compounds of dysprosium is carried out on the basis of the obtained experimental data and theoretical analysis. It is shown, that the Faraday effect in the considered compounds of dysprosium as well as the value of paramagnetic moment may be regarded rather accurately in free ion approximation

  3. The change of the state of an endohedral fullerene by encapsulation into SWCNT: a Raman spectroelectrochemical study of Dy3N@C80 peapods

    Czech Academy of Sciences Publication Activity Database

    Kalbáč, Martin; Kavan, Ladislav; Zukalová, Markéta; Yang, S.; Čech, J.; Roth, S.; Dunsch, L.

    2007-01-01

    Roč. 13, - (2007), s. 8811-8817 ISSN 0947-6539 R&D Projects: GA AV ČR KJB400400601; GA MŠk LC510 Institutional research plan: CEZ:AV0Z40400503 Keywords : dysprosium * electrochemistry * fullerenes * nanotubes Subject RIV: CG - Electrochemistry Impact factor: 5.330, year: 2007

  4. Preparation, Structure Characterization and Thermal Decomposition ...

    African Journals Online (AJOL)

    NJD

    Decomposition Process of the Dysprosium(III) m-Methylbenzoate 1 ... A dinuclear complex [Dy(m-MBA)3phen]2·H2O was prepared by the reaction of DyCl3·6H2O, m-methylbenzoic acid and .... ing rate of 10 °C min–1 are illustrated in Fig. 4.

  5. Critical resources in clean energy technologies and waste flows

    DEFF Research Database (Denmark)

    Habib, Komal

    is fraught with the risk of shifting the supply security problem from one type of non‐renewable resources (fossil fuels) to another type (metals), in particular the specialty metals such as rare earth elements e.g. neodymium and dysprosium. This PhD work presented an in‐depth analysis of potential resource...

  6. Regulation of the growth and photosynthesis of cherry tomato ...

    African Journals Online (AJOL)

    The growth and photosynthetic characteristics of cherry tomato seedlings were investigated under seven light irradiations such as dysprosium lamps (white light; control, C), red light emitting diodes (LEDs) (R), blue LEDs (B), orange LEDs (O), green LEDs (G), red and blue LEDs (RB) and red, blue and green LEDs (RBG) ...

  7. Axial segregation in high intensity discharge lamps measured by laser absorption spectroscopy

    NARCIS (Netherlands)

    Flikweert, A.J.; Nimalasuriya, T.; Groothuis, C.H.J.M.; Kroesen, G.M.W.; Stoffels, W.W.

    2005-01-01

    High intensity discharge lamps have a high efficiency. These lamps contain rare-earth additives (in our case dysprosium iodide) which radiate very efficiently. A problem is color separation in the lamp because of axial segregation of the rare-earth additives, caused by diffusion and convection. Here

  8. Axial segregation in high intensity discharge lamps measured by laser absorption spectroscopy

    NARCIS (Netherlands)

    Stoffels, W.W.; Flikweert, A.J.; Nimalasuriya, T.; Groothuis, C.H.J.M.; Haverlag, M.; Kroesen, G.M.W.

    2005-01-01

    HID lamps containing rare earth additives (in our case dysprosium) show color separation because of axial segregation, caused by diffusion and convection. Two-dimensional atomic Dy density profiles are measured by means of laser absorption spectroscopy. The radially resolved atomic density

  9. Test plan for air monitoring during the Cryogenic Retrieval Demonstration

    International Nuclear Information System (INIS)

    Yokuda, E.

    1992-06-01

    This report presents a test plan for air monitoring during the Cryogenic Retrieval Demonstration (CRD). Air monitors will be used to sample for the tracer elements neodymium, terbium, and ytterbium, and dysprosium. The results from this air monitoring will be used to determine if the CRD is successful in controlling dust and minimizing contamination. Procedures and equipment specifications for the test are included

  10. Material flow analysis of NdFeB magnets for Denmark: a comprehensive waste flow sampling and analysis approach.

    Science.gov (United States)

    Habib, Komal; Schibye, Peter Klausen; Vestbø, Andreas Peter; Dall, Ole; Wenzel, Henrik

    2014-10-21

    Neodymium-iron-boron (NdFeB) magnets have become highly desirable for modern hi-tech applications. These magnets, in general, contain two key rare earth elements (REEs), i.e., neodymium (Nd) and dysprosium (Dy), which are responsible for the very high strength of these magnets, allowing for considerable size and weight reduction in modern applications. This study aims to explore the current and future potential of a secondary supply of neodymium and dysprosium from recycling of NdFeB magnets. For this purpose, material flow analysis (MFA) has been carried out to perform the detailed mapping of stocks and flows of NdFeB magnets in Denmark. A novel element of this study is the value added to the traditionally practiced MFAs at national and/or global levels by complementing them with a comprehensive sampling and elemental analysis of NdFeB magnets, taken out from a sample of 157 different products representing 18 various product types. The results show that the current amount of neodymium and dysprosium in NdFeB magnets present in the Danish waste stream is only 3 and 0.2 Mg, respectively. However, this number is estimated to increase to 175 Mg of neodymium and 11.4 Mg of dysprosium by 2035. Nevertheless, efficient recovery of these elements from a very diverse electronic waste stream remains a logistic and economic challenge.

  11. Scanning Electron Microscope-Cathodoluminescence Analysis of Rare-Earth Elements in Magnets.

    Science.gov (United States)

    Imashuku, Susumu; Wagatsuma, Kazuaki; Kawai, Jun

    2016-02-01

    Scanning electron microscope-cathodoluminescence (SEM-CL) analysis was performed for neodymium-iron-boron (NdFeB) and samarium-cobalt (Sm-Co) magnets to analyze the rare-earth elements present in the magnets. We examined the advantages of SEM-CL analysis over conventional analytical methods such as SEM-energy-dispersive X-ray (EDX) spectroscopy and SEM-wavelength-dispersive X-ray (WDX) spectroscopy for elemental analysis of rare-earth elements in NdFeB magnets. Luminescence spectra of chloride compounds of elements in the magnets were measured by the SEM-CL method. Chloride compounds were obtained by the dropwise addition of hydrochloric acid on the magnets followed by drying in vacuum. Neodymium, praseodymium, terbium, and dysprosium were separately detected in the NdFeB magnets, and samarium was detected in the Sm-Co magnet by the SEM-CL method. In contrast, it was difficult to distinguish terbium and dysprosium in the NdFeB magnet with a dysprosium concentration of 1.05 wt% by conventional SEM-EDX analysis. Terbium with a concentration of 0.02 wt% in an NdFeB magnet was detected by SEM-CL analysis, but not by conventional SEM-WDX analysis. SEM-CL analysis is advantageous over conventional SEM-EDX and SEM-WDX analyses for detecting trace rare-earth elements in NdFeB magnets, particularly dysprosium and terbium.

  12. Accumulation of weak optical signals and spectral memory in InSe single crystals

    International Nuclear Information System (INIS)

    Abdinov, A.Shj.; Babaeva, R.F.

    1995-01-01

    Dysprosium alloying effect on the electron and physico-chemical properties of InSe monocrystals is studied. Accumulation of low light signals and spectral or color memory is shown to be observed under certain conditions (temperature, content of admitted impurity, wave length and light intensity)

  13. Tuning the activity of Pt alloy electrocatalysts by means of the lanthanide contraction

    DEFF Research Database (Denmark)

    Escribano, Maria Escudero; Malacrida, Paolo; Hansen, Martin Hangaard

    2016-01-01

    is lanthanum, cerium, samarium, gadolinium, terbium, dysprosium, thulium, or calcium. The materials are among the most active polycrystalline Pt-based catalysts reported, presenting activity enhancement by a factor of 3 to 6 over Pt. The active phase consists of a Pt overlayer formed by acid leaching. The ORR...

  14. Influence of organic component on geometry and stability of the Dy(3) complexes with benzoic and aminobenzoic acids in water-80 vol.% DMSO(DMFA) mixtures

    International Nuclear Information System (INIS)

    Kondrashina, Yu.G.; Mustafina, A.R.; Devyatov, F.V.; Vul'fson, S.G.; Kazanskij Gosudarstvennyj Univ., Kazan

    1995-01-01

    Data of pH-metric and magnetooptical analyses were used to evaluate stability and structure of benzoate and aminobenzoate dysprosium (3) complexes in water and water - 80 vol.% DMSO (DMFA) mixtures. Factors, dictating change of complex structure and stability when passing from water to organic water solvents, are discussed. 19 refs.; 2 figs.; 1 tab

  15. Thermal characterization of (U, Dy)O2 pellets

    International Nuclear Information System (INIS)

    Pelloni, M; Bianchi, L; Pablovich, M.E; Kaufmann, F; Kempf, R

    2012-01-01

    The thermal diffusivity of (U,Dy)O 2 pellets were determined in the temperature range 250 K to 1600 K measured by the laser flash method. The dependence of thermal with temperature and dysprosium content was studied and found in good agreement with physical models available (author)

  16. Material Flow Analysis of NdFeB magnets for Denmark: A comprehensive waste flow sampling and analysis approach

    DEFF Research Database (Denmark)

    Habib, Komal; Schibye, Peter Klausen; Vestbø, Andreas Peter

    2014-01-01

    for considerable size and weight reduction in modern applications. This study aims to explore the current and future potential of secondary supply of neodymium and dysprosium from recycling of NdFeB magnets. For this purpose, Material Flow Analysis (MFA) has been carried out to perform the detailed mapping...

  17. Field dosimetry on sterilization area of medical-hospitable materials

    International Nuclear Information System (INIS)

    Mariano, C.S.T.P.; Campos, L.L.

    1992-01-01

    The calcium sulfate doped with dysprosium, used in high dose dosimetry by electron paramagnetic resonance (EPR), is studied on field dosimetry for medical-hospitable materials sterilization. The calibration curves of EPR signal in function of absorbed dose in air and the thermal decay of EPR signal at room temperature are also presented. (C.G.C)

  18. A Thermally Actuated Flux Pump for Energizing YBCO Pucks

    Science.gov (United States)

    2016-05-01

    a Hall sensor with an advertised active area of approximately 1.016 mm diameter supplied by Lakeshore was positioned in the centre of the YBCO as...top and the coldhead (green) along the bottom. The brown colour is the light green of the coldhead and the orange of the dysprosium centre

  19. Excited bands in even-even rare-earth nuclei

    International Nuclear Information System (INIS)

    Vargas, Carlos E.; Hirsch, Jorge G.

    2004-01-01

    The energetics of states belonging to normal parity bands in even-even dysprosium isotopes, and their B(E2) transition strengths, are studied using an extended pseudo-SU(3) shell model. States with pseudospin 1 are added to the standard pseudospin 0 space, allowing for a proper description of known excited normal parity bands

  20. Perovskite catalysts for oxidative coupling

    Science.gov (United States)

    Campbell, Kenneth D.

    1991-01-01

    Perovskites of the structure A.sub.2 B.sub.2 C.sub.3 O.sub.10 are useful as catalysts for the oxidative coupling of lower alkane to heavier hydrocarbons. A is alkali metal; B is lanthanide or lanthanum, cerium, neodymium, samarium, praseodymium, gadolinium or dysprosium; and C is titanium.

  1. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AMAKQRIIGKDNQMPWHLPADFAWFKRCTMGKPIVMGRKTYDSIGRPLPGRLNIV 60 ... Query: 123 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER... 159 ... GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER Sbjct: 121 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER 157

  2. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AAMAKQRIIGKDNQMPWHLPADFAWFKRCTMGKPVVMGRKTYDSIGRPLPGRLNIV 60 ... Query: 123 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER... 159 ... GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER Sbjct: 121 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER 157

  3. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 121 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 178 ... QVPVNAIASSGTSEQALFTGAGERD...KESISNMRTIAAAARKAGMEVTELIVPGAGHDW Sbjct: 159 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 216

  4. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 159 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARC...SILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

  5. ORF Alignment: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

  6. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

  7. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFL...QEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

  8. Marcoule and the tritium. Information by the CRIIRAD after the article published in 'La Provence' of September 6, 2008 and entitled: 'Gard: for an environmentalist militant, the outer Marcoule's ground water is polluted'. CRIIRAD Note N.08-159 October 2008

    International Nuclear Information System (INIS)

    2009-01-01

    This document recalls that nuclear installations are allowed to release some quantities of radioactive pollutants in the atmosphere and in surface waters. It also notes that the allowed level for radioactive tritium by the Marcoule nuclear site is much higher than that of nuclear power plants. It recalls and comments the results of investigations performed by the CRIIRAD which revealed the pollution of ground waters and of the whole food chain. It also notes that, even though theses release became less important, their level remained rather high, still higher than that of nuclear plants: exceeding levels of tritium have been detected in rain waters, ground waters, fruits and vegetables, and other farm productions

  9. Avaliação dos conhecimentos e atitudes de prevenção sobre a febre maculosa entre profissionais de saúde no BrasilKnowledge and attitudes of prevention evaluation of spotted fever among health care professionals in Brazildoi:10.12662/2317-3076jhbs.v4i3.851.p152-159.2016

    Directory of Open Access Journals (Sweden)

    Stefan Vilges de Oliveira

    2016-09-01

    Full Text Available Introdução: A febre maculosa (FM é uma doença transmitida por carrapatos, o que, no Brasil, preocupa as autoridades do Sistema Único de Saúde (SUS por apresentar elevados coeficientes de letalidade. Objetivo: Descrever os conhecimentos e as atitudes de prevenção sobre a FM entre profissionais do SUS. Métodos: Foi realizado entre os meses de outubro a dezembro de 2015, um inquérito sobre os conhecimentos e as atitudes de prevenção sobre a FM entre os profissionais da saúde. Um questionário na plataforma FormSUS foi submetido a 426 profissionais de todo o Brasil que previamente já haviam participado de capacitações e atividades que envolviam o tema em questão. Vinte unidades federadas foram respondedoras da pesquisa (112/426. Foi possível verificar que a maioria dos profissionais de saúde conhece as condutas de notificação e de investigação epidemiológica. As incorporações recentes no programa de vigilância epidemiológica são de conhecimento da maioria dos respondentes. A rotatividade dos profissionais foi mencionada como principal dificultador das ações de vigilância da doença. Ações de fortalecimento dos programas de vigilância são realizadas de forma esporádica, somente no momento da ocorrência de casos de FM e não ocorrem de forma integral no âmbito do SUS. Conclusão: Cabe a cada segmento do SUS buscar seguir as diretrizes do sistema de vigilância epidemiológica da FM para que, de forma integral, se consiga reverter o panorama de morbimortalidade desta importante doença no Brasil.

  10. O orçamento participativo digital e a democracia participativa: um estudo de caso a partir da experiência de Belo Horizonte http://dx.doi.org/10.15601/1983-7631/rt.v3n5p159-163

    Directory of Open Access Journals (Sweden)

    Joelma Fátima Alvarenga

    2011-04-01

    Full Text Available Em um contexto social complexo e globalizado e sob um regime constitucional democrático, o Poder Público tem buscado novas formas de participação dos cidadãos nos negócios públicos. A participação direta, mediante o acesso da sociedade ao processo de decisão sobre políticas públicas, tem constituído importante instrumento para a concretização, no Brasil, de uma democracia que alia instrumentos representativos e diretos. Entre as principais experiências verificadas no país encontra-se a adoção, pela Administração Pública, do Orçamento Participativo, estratégia que permite ao cidadão definir, em certa medida, a alocação de recursos públicos em um dado período. Este trabalho parte dessas premissas e avalia a implementação e execução do Orçamento Participativo Digital – OPD - no Município de Belo Horizonte no ano de 2006. No estudo realizado verificou-se que o OPD representa um aprofundamento, em qualidade e quantidade, do Orçamento Participativo, pois tanto expande a participação quanto resguarda mais a autonomia da vontade do eleitor. Apesar dos problemas apresentados, constatou-se que o OPD constitui um passo importante para a ampliação da democracia participativa.Palavras-chave: orçamento participativo; administração pública

  11. Radiative properties of ceramic metal-halide high intensity discharge lamps containing additives in argon plasma

    Science.gov (United States)

    Cressault, Yann; Teulet, Philippe; Zissis, Georges

    2016-07-01

    The lighting represents a consumption of about 19% of the world electricity production. We are thus searching new effective and environment-friendlier light sources. The ceramic metal-halide high intensity lamps (C-MHL) are one of the options for illuminating very high area. The new C-MHL lamps contain additives species that reduce mercury inside and lead to a richer spectrum in specific spectral intervals, a better colour temperature or colour rendering index. This work is particularly focused on the power radiated by these lamps, estimated using the net emission coefficient, and depending on several additives (calcium, sodium, tungsten, dysprosium, and thallium or strontium iodides). The results show the strong influence of the additives on the power radiated despite of their small quantity in the mixtures and the increase of visible radiation portion in presence of dysprosium.

  12. Dependence of ion - photon emission characteristics on the concentration of implanted atoms of the bombarding beam

    International Nuclear Information System (INIS)

    Belykh, S.F.; Evtukhov, R.N.; Redina, I.V.; Ferleger, V.Kh.

    1989-01-01

    Results of experiment, where Dy + beams, its spraying products emitting intensively optical radiation with continuous spectrum (CSR), are used for tantalum surface bombardment, are presented. The given experiment allowed one to separate the scattered particle CSR contribution and was conducted under controlled beam n atom concentration on the target surface. E 0 energy and j 0 dysprosium ion flux density made up respectively 3.5 keV and 3x10 5 Axcm -2 . The obtained result analysis has shown that a notable dependence of spectrum type on n value is detected. Dy scattered atoms to not emit CSR. The main contribution to CSR is made by sprayed particles, containing dysprosium atoms

  13. Paramagnetic metal complexes as potential relaxation agents for NMR imaging

    International Nuclear Information System (INIS)

    Coroiu, Ilioara; Demco, D. E.; Darabont, Al.; Bogdan, M.

    1997-01-01

    The development of nuclear magnetic resonance (NMR) imaging technique as a clinical diagnostic modality has prompted the need for a new class of pharmaceuticals. These drugs must be administered to a patient in order to enhance the image contrast between the normal and diseased tissue and/or indicate the status of organ function or blood flow. Paramagnetic compounds are presently undergoing extensive evaluation as contrast agents in magnetic resonance imaging (MRI). These agents increase contrast in MRI by differentially localizing in tissue where they increase the relaxation rates of nearby water protons. The longitudinal R 1 and transverse R 2 relaxivities were measured as a function of molar concentrations for some new paramagnetic complexes like the following: dysprosium, erbium and gadolinium citrates, gadolinium methylene diphosphonate, dysprosium and gadolinium iminodiacetate, manganese para-aminobenzoate and copper nicotinate. The available theoretical approaches for quantitative understanding are presented. (authors)

  14. Comparative examination of the fresh and spent nuclear TRIGA fuel by neutron radiography

    International Nuclear Information System (INIS)

    Dinca, M.

    2016-01-01

    At the Institute for Nuclear Research (INR) there is in operation an underwater (wet) neutron radiography facility (INUM) designed especially for nuclear fuel investigation. INUM was involved in CANDU experimental type and TRIGA type nuclear fuel investigations. In this paper are presented the results after investigation of the nuclear fuel TRIGA-HEU and TRIGA-LEU, fresh and spent, using transfer method with metallic foils of dysprosium and indium and radiographic films (38 cm x 10 cm). This method is the most suitable for spent fuel and offers a high geometrical resolution of the images that subsequently are digitalized with a professional scanner for films. From the images obtained for TRIGA-HEU and TRIGA-LEU with different degree of burn-up there are established the opportunities to use dysprosium or indium converter foils based on their response to thermal or epithermal neutrons to evaluate the degree of burn-up, dimensional measurements, defects etc. (authors)

  15. Extraction spectrophotometric determination of rare earth with trioctylethylammonium bromide and Xylenol Orange

    International Nuclear Information System (INIS)

    Shijo, Yoshio

    1976-01-01

    A spectrophotometric method of determination of the rare earth was studied by the solvent extraction of rare earth-Xylenol Orange chelate into xylene solution of trioctylethylammonium bromide(TOEA). The rare earth-XO-TOEA complexes are extracted into aromatic hydrocarbons such as benzene, toluene, and xylene, but not into polar solvents such as n-butanol ethylacetate, methylisobutylketone, and nitrobenzene. The optimum pH range for the extraction were 6.3 -- 6.7, 6.3 -- 6.5, 5.8 -- 6.9, 5.7 -- 6.9, and 5.5 -- 6.8 for lanthanum, praseodymium, cerium, gadolinium, and dysprosium, respectively. The absorption maximum of the complexes extracted into xylene were found at 605 nm for lanthanum, praseodymium, and cerium, 596 nm for gadolinium, and 590 nm for dysprosium. Beer's law held for about 0 -- 4.5 μg of rare earth per 5 ml of xylene. The molar absorptivity of the extracted species were 1.53x10 5 , 1.42x10 5 , 1.35x10 5 , 8.5x10 4 , 8.2x10 4 cm -1 mol -1 l for lanthanum, praseodymium, cerium, gadolinium, and dysprosium, respectively. The composition of the ternary complexes were estimated to be M:XO:TOEA=1:1:2 for gadolinium and dysprosium, whereas 1:2:n for lanthanum, praseodymium and cerium. Combination ratio n of TOEA to metal-XO chelates in the latters could not be estimated by the commonly available methods. Thorium, vanadium, uranium, bismuth, aluminum, zirconium, chromium, nitrate, perchlorate and iodide interfered when triethylenetetramine and 1,10-phenanthroline were added as masking agent. (auth.)

  16. Using T2-Exchange from Ln3+DOTA-Based Chelates for Contrast-Enhanced Molecular Imaging of Prostate Cancer with MRI

    Science.gov (United States)

    2016-04-01

    thereby performing disease staging entirely non-invasively. Also, in contrast to PET/CT or SPECT/CT, disease diagnostics and therapy monitoring would...2011;6.e27370. 11. Zhang SR, Sherry AD. Physical characteristics of lanthanide com- plexes that act as magnetization transfer (MT) contrast agents. J...reper- fused and nonreperfused myocardial infarctions - MR imaging with dysprosium-DTPA-BMA in the pig. Acta Radiol 1996;37:18–26. 28. Nilsson S

  17. The study of heat conductivity properties of GdS1.48 and DyS1.48

    International Nuclear Information System (INIS)

    Ahmadov, O.R.

    2009-01-01

    The heat conductivity properties of sulfides of gadolinium and dysprosium up to 900 K with use of the average speed of ultrasound distribution, a specific thermal capacity and Viderman-Frans law have been investigated. The value of Debay temperature, thermal extension coefficient and the temperature dependence are established. It is shown that the scattering on crystal lattice phonons plays the main role in lattice heat conductivity

  18. Energy dependence of thermoluminescent response of CaSO{sub 4}:Dy, LiF:Mg and micro LiF:Mg,Ti in clinical beams of electrons by using different simulator objects; Dependencia energetica da resposta TL de dosimetros de CaSO{sub 4}:Dy, LiF:Mg e microLiF:Mg,Ti em feixes clinicos de eletrons utilizando diferentes objetos simuladores

    Energy Technology Data Exchange (ETDEWEB)

    Bravim, Amanda; Campos, Leticia Lucente, E-mail: abravin@ipen.b, E-mail: rsakuraba@einstein.b, E-mail: lcrodri@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Sakuraba, Roberto K.; Cruz, Jose Carlos da, E-mail: rsakuraba@einstein.b, E-mail: josecarlosc@einstein.b [Hospital Israelita Albert Einstein (HIAE), Sao Paulo, SP (Brazil)

    2011-10-26

    Yet not so widely applied in radiotherapy, the calcium sulfate doped with dysprosium (CaSO{sub 4}:Dy) is used in radioprotection and studies has been demonstrated its great potential for the dosimetry in radiotherapy. This work evaluates the energy dependence of the thermoluminescent answer of the CaSO{sub 4}:D, LiF:Mg,Ti (TLD-100) and micro LiF:Mg,Ti in clinical beams of electrons by using water simulators, PMMA and solid water

  19. Phosphor for thermoluminescent type radiation dosimeter

    International Nuclear Information System (INIS)

    Nada, N.; Yamashita, T.

    1975-01-01

    This has the accumulation effect of radiation energy and is mainly used as the element for thermoluminescent type radiation dosimeters. It has as the principal constituent a phosphor consisting of calcium sulfate as the principal constituent and other impurity elements such as dysprosium, thulium and the like. It is more sensitive by the order of 1 to 2 or more figures than the conventional ones and is excellent in the retention of absorbed radiation energy. (U.S.)

  20. Role of hydrogen in Nd–Fe–B sintered magnets with DyH{sub x} addition

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Pan [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Ma, Tianyu, E-mail: maty@zju.edu.cn [Key Laboratory of Novel Materials for Information Technology of Zhejiang Province, Zhejiang University, Hangzhou 310027 (China); Wang, Xinhua, E-mail: xinhwang@zju.edu.cn [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Zhang, Yujing [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Yan, Mi [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Key Laboratory of Novel Materials for Information Technology of Zhejiang Province, Zhejiang University, Hangzhou 310027 (China)

    2015-04-15

    Highlights: • DyH{sub 2} and DyH{sub 3} fine powder were prepared. • Effect of DyH{sub x} on the magnetic properties of Nd–Fe–B sintered magnets was studied. • The effect mechanism of Dy hydrides was discussed. • The magnetic properties are greatly improved by DyH{sub 2} and DyH{sub 3} addition. - Abstract: In order to improve the coercivity of Nd–Fe–B sintered magnets, DyH{sub 2} and DyH{sub 3} fine powders were prepared and used as additive for preparing Nd–Fe–B sintered magnets. The effects of DyH{sub x} powders addition on the microstructures and the magnetic properties of the magnets have been investigated. It was found that hydrogen will react with oxygen of NdO{sub x} rich intergranular phases to form Nd rich phases by dysprosium hydride addition. The Nd-rich grain boundary phases are more homogenous and continuous because the volume fraction of Nd-rich grain boundary phases increases with respect to the Nd oxide phases. After desorption, fine dysprosium powders become more active and wrap matrix phases well so that the diffusion of dysprosium to the surface layer of matrix phases is convenient, so dysprosium decreases in grain boundary phases and aggregates in surface layer of matrix phases. Then, intrinsic coercivity of NdFeB sintered magnets is improved from 14.96 kOe to 20.5 kOe and 20.31 kOe by 2.0 wt.% DyH{sub 3} and 2.0 wt.% DyH{sub 2} addition, respectively. This study has shown that DyH{sub x} addition can reduce the content of oxygen in grain boundary phases. This can be an effective method for massive production.