WorldWideScience

Sample records for durissus cascavella brazilian

  1. Pulmonary mechanic and lung histology induced by Crotalus durissus cascavella snake venom.

    Science.gov (United States)

    Oliveira Neto, Joselito de; Silveira, João Alison de Moraes; Serra, Daniel Silveira; Viana, Daniel de Araújo; Borges-Nojosa, Diva Maria; Sampaio, Célia Maria Souza; Monteiro, Helena Serra Azul; Cavalcante, Francisco Sales Ávila; Evangelista, Janaina Serra Azul Monteiro

    2017-10-01

    This study have analyzed the pulmonary function in an experimental model of acute lung injury, induced by the Crotalus durissus cascavella venom (C. d. cascavella) (3.0 μg/kg - i.p), in pulmonary mechanic and histology at 1 h, 3 h, 6 h, 12 h and 24 h after inoculation. The C. d. cascavella venom led to an increase in Newtonian Resistance (R N ), Tissue Resistance (G) and Tissue Elastance (H) in all groups when compared to the control, particularly at 12 h and 24 h. The Histeresivity (η) increased 6 h, 12 h and 24 h after inoculation. There was a decrease in Static Compliance (C ST ) at 6 h, 12 h and 24 h and inspiratory capacity (IC) at 3 h, 6 h, 12 h and 24 h. C. d. cascavella venom showed significant morphological changes such as atelectasis, emphysema, hemorrhage, polymorphonuclear inflammatory infiltrate, edema and congestion. After a challenge with methacholine (MCh), R N demonstrated significant changes at 6, 12 and 24 h. This venom caused mechanical and histopathological changes in the lung tissue; however, its mechanisms of action need further studies in order to better elucidate the morphofunctional lesions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. NO production and potassium channels activation induced by Crotalus durissus cascavella underlie mesenteric artery relaxation.

    Science.gov (United States)

    Santos, S S; Jesus, R L C; Simões, L O; Vasconcelos, W P; Medeiros, I A; Veras, R C; Casais-E-Silva, L L; Silva, D F

    2017-07-01

    Animal toxins are natural resources for pharmacological studies. The venom of Crotalus durissus cascavella (C.d. cascavella) may be a source in the bio-prospecting of new anti-hypertensive agents. The aim of this study was to investigate vascular effects of the venom of C.d. cascavella in normotensive rats. Studies were performed using isolated mesenteric artery segments and aortic endothelial cells. The cumulative administration of the venom of C.d. cascavella (0.001-30 μg/mL) on phenylephrine (Phe; 10 μM) pre-contracted rings induced a concentration-dependent vasorelaxation in the presence of vascular endothelium (E max  = 47.9 ± 5.0% n = 8), and its effect was almost abolished in the absence of endothelium (E max  = 5.8± 2.4% n = 5 ( ∗∗∗ p stable radical scavenger for nitric oxide (E max  = 10.77± 3.6%, n = 6). Moreover, the venom induced the release of NO by isolated aortic endothelial cells through amperometric studies. When assessing the participation of K + channels on the vasodilatory response of the venom, tyrode solution with 20 mM of KCl caused a significant reduction in the relaxation response (p channels (4-amynopiridine 1 mM; E max  = 9.5 ± 1.3, %, n = 5, ***p channels. These data illustrate that C.d. cascavella is a source of bioactive molecules and therefore has therapeutic potential in the treatment of cardiovascular diseases such as hypertension. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Modulation of the Pharmacological Activities of Secretory Phospholipase A2 from Crotalus durissus cascavella Induced by Naringin

    Directory of Open Access Journals (Sweden)

    Marcos H. Toyama

    2011-01-01

    Full Text Available In this work we have characterized the action of the naringin, a flavonoid found in grapefruit and known for its various pharmacological effects, which include antioxidant blood lipid lowering and anticancer activity, on the structure and biochemical activities of a secretory phospholipase A (sPLA2 from Crotalus durissus cascavella, an important protein involved in the releasinge of arachidonic acid in phospholipid membranes. sPLA2 was incubated with naringin (mol:mol at 37 °C and a discrete reduction in the UV scanning signal and a modification of the circular dichroism spectra were observed after treatment with naringin, suggesting modifications of the secondary structure of the protein. This flavonoid was able to decrease enzymatic activity and some pharmacological effects, such as myonecrosis, platelet aggregation, and neurotoxic activity caused by sPLA2, however, the inflammatory effect was not affected by naringin. In addition, small angle X-ray scattering (SAXS data were collected for sPLA2 and naringin-treated sPLA2 to evaluate possible modifications of the protein structure. These structural investigations have shown that sPLA2 is an elongated dimer in solution and after treatment with naringin a conformational change in the dimeric configuration was observed. Our results suggest that structural modification may be correlated with the loss of enzymatic activity and alterations in pharmacological properties.

  4. Is the population of Crotalus durissus (Serpentes, Viperidae) expanding in Brazil?

    Science.gov (United States)

    2013-01-01

    Crotalus durissus are found from Mexico to northern Argentina in a highly disjunct distribution. According to some studies, this species is prone to occupy areas disturbed by human activities and floods comprise a plausible method of dispersal as inferred for some North American rattlesnakes. Based on the literature, it seems plausible that Crotalus durissus expanded their natural distribution in Brazil due to floods, but only in a few municipalities in Rio de Janeiro State. Data entries of Butantan Institute, in São Paulo, Brazil, from 1998 to 2012 show a declining tendency of snakes brought by donors. In addition, research shows no evidence of Crotalus durissus being an expanding species in the Brazilian territory. PMID:24314146

  5. Afibrinogenemia following snake bite (Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    C. F. S. Amaral

    1988-08-01

    Full Text Available This paper reports two cases of afibrinogenemia with normal platelet count following Crotalus durissus terrificus, snake bite Both patients presented high output acute renal failure and case two also had increased blood levels of CPK and LDH compatible with the diagnosis of rhabdomyolysis. Case one was given an unknown amount of antivenom and was treated with epsilonaminocaproic acid and a fresh whole blood transfusion and showed recovery of the coagulation disturbance 40 hours following these measures. Case two was given an adequate amount of crotalide antivenom and the coagulation tests performed 12 hours later showed a normal partial thromboplastin time and fibrinogen 86 mg/100ml. Case one presented no haemorrhagic disturbances. Case two presented persistent bleeding following venopuncture and after removal of impetigo crust in the legs. Acute renal failure was treated conservatively and both patients were discharged from the hospital with recovery of the renal function.

  6. Toxins from Crotalus durissus terrificus venom

    International Nuclear Information System (INIS)

    Rogero, J.R.

    1979-01-01

    Phospholipase A, crotapotin and crotamine were purified from the venom of crotalus durissus terrificus. Molecular weigths were respectively estimated in 13400, 8300 and 4880. By sephadex gel filtration, stable complex is formed by interaction (1:1 molar ratio) of Phospholipase A (LD=0,55mg/Kg, in mice) and crotapotin, obtaining an increase in the toxicity of Phospholipase A in 10 fold to LD 50 =0,05mg/Kg. These facts indicate crotoxin as a product of 1:1 molar ratio interaction of crotapotin and Phospholipase A. By sephadex gel filtration an unstable complex is formed by interaction of crotapotin and crotamine (LD 50 =0,8mg/Kg, in mice), increasing the toxicity of crotamine approximately 4 fold to LD 50 =0,2mg/Kg. In tritium-hydrogen exchange experiments, the back exchange kinetic of these tritium labelled proteins were measured in gel filtration columns of sephadex G 25 'coarse' showing for Phospholipase A two clearly distinguishable kinetic classes of exchangeable hydrogens. From the exchangeable hydrogens only 68% were rapidly exchanged and the occurrence of hydrogens envolved in alpha-helix was practically absent. Crotapotin has no hydrogens of alpha-helix and 83% of exchangeable hydrogens were rapidly exchanged with solvent. Crotamine, after a initial heating in tritiated water showed that 31% of exchangeable hydrogens were slowly exchanged with solvent. After 18 hours of heating, that number diminished for 11%. Crotoxin showed three exponential classes of exchangeable hydrogens and about 26 protons have alpha-helix characteristic exchange rate. A possible conformational change after Phospholipase A - crotapotin interaction is suggested. (Author) [pt

  7. Effects of gamma radiation on Crotalus durissus terrificus venom

    International Nuclear Information System (INIS)

    Murata, Y.

    1988-01-01

    A poll of crotomine positive Crotalus durissus terrificus venom was dissolved in 0.15 M NaCl and the supernatant irradiated using 60 CO. Doses of 100,250,750,1000,1500 and 2000 Cy were used at a dose rate of 1.190Gy/h. The presence of free SH, casein hydrolytic degradation, SDS-PAGE and molecular exclusion chromatography analysis together with LD 50 determination in mice were studied. The antigenic properties of samples were investigated by immunodiffision and immunoprecipitation. (M.A.C.) [pt

  8. Isolation and characterization of delta toxin from the venom of Crotalus durissus terrificus; Isolamento e caracterizacao da delta toxina do veneno de Crotalus durissus terrificus

    Energy Technology Data Exchange (ETDEWEB)

    Campos, Lucelia de Almeida

    2006-07-01

    The Crotalus durissus terrificus venom has been so far described as being of low complexity, with four major components described: convulxin, gyroxin, crotoxin and crotamine. In recent studies, other components of this venom were characterized as, for example, an analgesic factor. In 1980, Vital Brazil predicted the existence of a toxin which could be involved in platelet aggregation, and named it delta toxin. However, this toxin has never been isolated or characterized. The aim of the present work was to purify and characterize this toxin. After FPLC size exclusion chromatography followed by reverse phase HPLC, an homogeneous fraction was obtained, with a molecular weight of 14,074.92 Da. When analyzed by SOS-PAGE, this toxin presented an anomalous behavior, with a molecular weight of 14 kDa, while in 2D gels, spots around 40 kDa and with an isoelectrical point between 4 and 5 were observed suggesting isoforms with glicosilation microheterogeneity. After trypsin digestion, the fragments were submitted to the swissprot databank showing high homology (43% coverage, 15 matching peptides) with trocarin, a prothrombin activator from Tropidechis carinatus. These data were further confirmed by aminoacid analysis. The toxin was tested for its ability to activate factor II and X using synthetic substrates. Our data indicate a direct activation of factor X. The same toxin also behaved as a potent direct platelet aggregation activator on washed platelets. Assays with specific inhibitors indicate that neither metalloproteinase, nor serinoproteinase or t lectin domains are involved in the aggregating activity, since EDTA, benzamidin and D-galactose did not inhibit the toxin. In the present work, we were able to identify, purify and characterize a new toxin from the brazilian rattlesnake. It behaved as predicted by Vital-Brazil and displayed direct factor X activating properties, also inducing platelet aggregation, even at low concentrations. Our data also indicate that it is

  9. Isolation and characterization of delta toxin from the venom of Crotalus durissus terrificus

    International Nuclear Information System (INIS)

    Campos, Lucelia de Almeida

    2006-01-01

    The Crotalus durissus terrificus venom has been so far described as being of low complexity, with four major components described: convulxin, gyroxin, crotoxin and crotamine. In recent studies, other components of this venom were characterized as, for example, an analgesic factor. In 1980, Vital Brazil predicted the existence of a toxin which could be involved in platelet aggregation, and named it delta toxin. However, this toxin has never been isolated or characterized. The aim of the present work was to purify and characterize this toxin. After FPLC size exclusion chromatography followed by reverse phase HPLC, an homogeneous fraction was obtained, with a molecular weight of 14,074.92 Da. When analyzed by SOS-PAGE, this toxin presented an anomalous behavior, with a molecular weight of 14 kDa, while in 2D gels, spots around 40 kDa and with an isoelectrical point between 4 and 5 were observed suggesting isoforms with glicosilation microheterogeneity. After trypsin digestion, the fragments were submitted to the swissprot databank showing high homology (43% coverage, 15 matching peptides) with trocarin, a prothrombin activator from Tropidechis carinatus. These data were further confirmed by aminoacid analysis. The toxin was tested for its ability to activate factor II and X using synthetic substrates. Our data indicate a direct activation of factor X. The same toxin also behaved as a potent direct platelet aggregation activator on washed platelets. Assays with specific inhibitors indicate that neither metalloproteinase, nor serinoproteinase or t lectin domains are involved in the aggregating activity, since EDTA, benzamidin and D-galactose did not inhibit the toxin. In the present work, we were able to identify, purify and characterize a new toxin from the brazilian rattlesnake. It behaved as predicted by Vital-Brazil and displayed direct factor X activating properties, also inducing platelet aggregation, even at low concentrations. Our data also indicate that it is

  10. DSC analysis of irradiated proteins from Crotalus durissus terrificus

    International Nuclear Information System (INIS)

    Oliveira, Karina Corleto de; Silva, Monica Nascimento da; Goncalves, Karina de Oliveira; Spencer, Patrick Jack; Nascimento, Nanci do

    2011-01-01

    Full text: Snake bites are a serious public health problem, especially in subtropical countries. In Brazil, the serum, the only effective treatment in case of snake bites, is produced in horses which, despite the large size, have a reduced lifespan due to the high toxicity of the antigen. It is known that ionizing radiation effects - direct and indirect - can modify the molecular structure, affecting the biological properties of proteins. Ionizing radiation has been employed to attenuate the toxicity of snake venoms, aiming to generate an improved antigen with low toxicity. Two proteins, purified from Crotalus durissus terrificus (Cdt) venom were tested in this work: crotoxin and crotamine. Crotoxin, the main toxic compound of Cdt venom, is a heterodimeric protein composed of two subunits: crotapotin and phospholipase A2. Crotamine is a highly basic polypeptide (pI - 10.3), with myotoxic activity and molecular weight of 4882 Da. It is composed of 42 amino acids residues and reticulated by three disulfide bonds. This study aimed to investigate the effects of radiation on crotoxin and crotamine using Differential Scanning Calorimetry (DSC). After isolation of the toxins by chromatographic techniques, they were irradiated with 2.0 kGy from 60 Co source. The thermodynamics analysis, carried out in a METTLER TOLEDO, DSC 822e calorimeter, showed that irradiation promoted changes of the calorimetric profile. These changes suggest that, although radiation induced structural modifications of the protein, denaturation was only partial, since transition states could still be detected, suggesting that some structural elements were still present after irradiation. Taken together, our data suggest that following irradiation, the molecules underwent conformational changes, and that the remaining structural elements displayed a lower enthalpy, clearly indicating that the previously described loss of toxicity of irradiated toxins can be mostly ascribed to structural changes

  11. DSC analysis of irradiated proteins from Crotalus durissus terrificus

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Karina Corleto de; Silva, Monica Nascimento da; Goncalves, Karina de Oliveira; Spencer, Patrick Jack; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Full text: Snake bites are a serious public health problem, especially in subtropical countries. In Brazil, the serum, the only effective treatment in case of snake bites, is produced in horses which, despite the large size, have a reduced lifespan due to the high toxicity of the antigen. It is known that ionizing radiation effects - direct and indirect - can modify the molecular structure, affecting the biological properties of proteins. Ionizing radiation has been employed to attenuate the toxicity of snake venoms, aiming to generate an improved antigen with low toxicity. Two proteins, purified from Crotalus durissus terrificus (Cdt) venom were tested in this work: crotoxin and crotamine. Crotoxin, the main toxic compound of Cdt venom, is a heterodimeric protein composed of two subunits: crotapotin and phospholipase A2. Crotamine is a highly basic polypeptide (pI - 10.3), with myotoxic activity and molecular weight of 4882 Da. It is composed of 42 amino acids residues and reticulated by three disulfide bonds. This study aimed to investigate the effects of radiation on crotoxin and crotamine using Differential Scanning Calorimetry (DSC). After isolation of the toxins by chromatographic techniques, they were irradiated with 2.0 kGy from {sup 60}Co source. The thermodynamics analysis, carried out in a METTLER TOLEDO, DSC 822e calorimeter, showed that irradiation promoted changes of the calorimetric profile. These changes suggest that, although radiation induced structural modifications of the protein, denaturation was only partial, since transition states could still be detected, suggesting that some structural elements were still present after irradiation. Taken together, our data suggest that following irradiation, the molecules underwent conformational changes, and that the remaining structural elements displayed a lower enthalpy, clearly indicating that the previously described loss of toxicity of irradiated toxins can be mostly ascribed to structural changes

  12. Analysis of Brazilian snake venoms by neutron activation analysis

    International Nuclear Information System (INIS)

    Saiki, M.; Vasconcellos, M.B.A.; Rogero, J.R.; Cruz, M.C.G.

    1991-01-01

    Instrumental neutron activation analysis (INAA) has been applied to multielemental determinations of Brazilian snake venoms from the species: Bothrops jararacussu, Crotalus durissus terrificus and Bothrops jararaca. Concentrations of Br, Ca, Cl, Cs, K, Mg, Na, Rb, Sb, Se and Zn have been determined in lyophilized venoms by using short and long irradiations in the IEA-RI nuclear reactor under a thermal neutron flux of 10 11 to 10 13 n · cm -2 · s -1 . The reference materials NIST Bovine Liver 1577 and IUPAC Bowen's Kale were also analyzed simultaneously with the venoms to evaluate the accuracy and the reproducibility of the method. The concentrations of the elements found in snake venoms from different species were compared. The Crotalus durissus terrificus venoms presented high concentration of Se but low concentrations of Zn when these results are compared with those obtained from genera Bothrops venoms. (author) 9 refs.; 2 tabs

  13. Partial characterization of the venom of the Peruvian rattlesnake Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    César Remuzgo

    2014-06-01

    Full Text Available The venom of the rattlesnake Crotalus durissus terrificus from the region of Sandia, Puno, has been investigated for its protein content and some enzymatic activities, using for it the whole venom as well as the fractions obtained by gel filtration chromatography in Sephadex G-100. The protein percentage calculated by the method of Lowry was of 68,6% for the whole venom; 3 peaks were obtained during the fractionation; the first showed proteolytic activity, the second, amidolytic, clotting and phospholipase A2 activities, while the third, another proteolytic activity. Acetylcholinesterase activity was not found while L-aminoacid oxidase activity was found only in the whole venom.

  14. Studies of agregates produced during venom irradiation of Crotalus durissus terrificus with gamma ray

    International Nuclear Information System (INIS)

    Clissa, Patricia B.; Nascimento, Nanci do; Rogero, Jose R.

    1997-01-01

    Literature data show that 2.0 kGy dose of gamma radiation, generated by 60 Co source, reduces the toxic activity of Crotalus durissus terrificus venon, without altering its immunogenic capacity. When crotoxin, main toxin from crotalic venom, was irradiated with the same dose, toxicity was laos reduced and the immunogenicity was maintained. This fact was attributed to aggregates(compounds with high molecular weight generated during irradiation), that showed no toxicity but were able to induce the antibodies formation against native venom. Crotalus durissus terrificus venom was irradied with 2.0, 3.0, 5.0 and 10.0 kGy doses and submitted to molecular exclusion chromatography, in order to find an efficient dose that produces large amounts of non toxic but still immunogeneic aggregates. After being isolated, the products of irradiation were evaluated for the amount produced, molecular ateration, and toxic and immunogenic activities. The results from different doses irradiated venom were compared with native one, and 2.0 kGg dose was confirmed to be most efficient in the association of toxicity attenuation with maintenance of immunogenicity of the crotalic venom, while other doses, in spite of being efficient in the toxicity attenuation, they were not able to keep the immunogenicity property. So, the dose of 2.0 kGy could be used to immunize animals in order to improve anticrotalic sera production. (author). 14 refs., 6 figs., 4 tabs

  15. Gamma radiation effects on crotoxin (toxin of crotalus durissus terrificus venom)

    International Nuclear Information System (INIS)

    Souza Filho, J.N.; Rogero, J.R.

    1988-01-01

    The crotoxin is a great neurotoxin found on Crotalus durissus terrificus venom. This protein was isolated using molecular exclusion cromatography with Sephadex G-75 and irradiated in a source of 60 Co GAMMA-CELL in the concentration of 2 mg/ml 0.85% NaCl with dose rate of 1.19 x 10 3 Gy/hr. The doses used were 250, 500, 1000 and 2000 Gy. It was determinated for this samples, the proteic concentration, the diffusion immunoassay using crotalic antiserum and eletrophoresis (SDS-PAGE). The results showed some changes on the irradiated toxin. Preliminary results with doses of radiation of 100, 250, 500 and 1000 Gy showed that the letal dose 50% (LD50) in mice increase greatly with the increase of radiation's dose. (author) [pt

  16. Purification and radiodination of gyroxin, toxin like trombin, of crotalus durissus terrificus venom

    International Nuclear Information System (INIS)

    Camillo, Maria A.P.; Paes, Paulo C.A.; Ribela, Maria T.C.P.; Rogero, Jose R.

    1997-01-01

    Snake's venoms have attracted special interest in research because they are rich in bioactive compounds, which are scientific tools to study many physiological processes and are also important source of new therapeutic agents. Some thrombin-like enzymes are used as a reagent in laboratorial assays as well as in medical drugs. However, a neurotoxic syndrome called gyroxin syndrome or barrel rotation seems to be related to those enzymes. Pharmacokinetics and biodistribution studies of these toxins can contribute to clarifly this mechanisms and consequently, it will help to elaborate safer clinical prescriptions giving more information about possible nocive effects. This paper describes the first step of these studies with the thrombin-like enzyme (or gyroxin) from Crotalus durissus terrificus's venom. The purification and radioiodination methods as well as electrophoretic analysis and biological assay are presented. (author). 9 refs., 5 figs., 1 tab

  17. Interaction study of water radiolysis products with Crotalus durissus terrificus miotoxin

    International Nuclear Information System (INIS)

    Silva, Murilo Casare da

    2008-01-01

    Ionizing radiation has been satisfactorily employed for venoms detoxification. In this report, the radiation was employed to verify the effects caused by the radiolysis products of water on the Crotamine, toxin purified from Crotalus durissus terrificus venom. These effects were analyzed using some substances called 'scavengers', those substances competes for specific reactive species hindering them to act on the toxins molecules. In order to study the possible structural damages caused on the toxins, circular dichroism, fluorescence, nuclear magnetic resonance, amino acids analysis and intravital microscopy were employed. Our results indicate that ionizing radiation caused structure alterations, mainly, in secondary and tertiary structure of crotamine. In the irradiated crotamine, was not possible to determine tridimensional structure. And the crotamine toxic effect was removed by ionizing radiation. (author)

  18. Effects of radiolysis products on crotamine (toxin from Crotalus durissus terrificus venom)

    International Nuclear Information System (INIS)

    Costa, T.A. da; Rogero, J.R.

    1988-07-01

    Ionizing Radiations changes the molecular structure due to chemical bond destruction. These chemical alterations are able to change the biological properties of the biomolecules. Crotamine was obtained from Crotalus durissus terrificus venom by molecular exclusion cromatography and irradiated in a concentration of 1 mg/ml in aqueous solution with gamma radiation produced by a 60 Co source. We used doses of 100 Gy, 2000 Gy and 5000 Gy (dose rate = 1,14 x 10 3 Gy/h). We performed the following experiments: proteic concentration, SDS-PAGE and immunodiffusion. Preliminary results showed a reduction of 55% in proteic concentration; with dose of 5000 Gy; an increase of the number of bands in SDS-PAGE suggesting the appearance of protein aggregates that was proportional as the dose increases. The immunodifusion data showed a reduction of the immunochemical activity against the Butantan antisera. (author) [pt

  19. Effects of gamma radiation on crotoxin (toxin of Crotalus durissus terrificus venom)

    International Nuclear Information System (INIS)

    Souza Filho, J.N.; Rogero, J.R.

    1988-07-01

    The crotoxin in a great neurotoxin found on Crotalus durissus terrificus venom. This protein was isolated using molecular exclusion cromatrography with Sephadex G-75 and irradiated in a source of 60 Co GAMMACELL in the concentration of 2 mg/ml 0.85% NaCl with dose rate of 1.19 x 10 3 Gy/hr. The doses used were 250, 500, 1000 and 2000 Gy. It was determinated for this samples, the proteic concentration, the diffusion immunoassay using crotalic antiserum and eletrophoresis (SDS-PAGE). The results showed some changes on the irradiated toxin. Preliminary results with doses of radiation of 100, 250, 500 and 1000 Gy showed that the letal dose 50% (LD50) in mice increase greatly with the increase of radiation's dose. (author) [pt

  20. Ultrastructural description and cytochemical study of the spermatozoon of Crotallus durissus (Squamata, Serpentes).

    Science.gov (United States)

    Cunha, L D; Tavares-Bastos, L; Báo, S N

    2008-10-01

    The present study was undertaken to elucidate some aspects about the nature of the spermatozoon ultrastructure of Crotallus durissus using cytochemical methods. We also provide for the first time the ultrastructural description of this species spermatozoon. Cytochemical studies of spermatozoa have not been performed so far in the Serpentes, and species spermatozoon may prove helpful to better understand the reproductive biology of this group. Besides the synapomorphies of the Squamata and Serpentes, the C. durissus spermatozoon possess the following: circular acrosome tip; rounded perforatorium tip with a stopper-like basal modification; bilateral stratified laminar structures; central electron-dense structure within the proximal centriole; fibrous sheath extending until the level of the second mitochondrial ring; rounded mitochondria in cross-section, but with variable shape and organization in longitudinal and oblique sections, respectively; linear annulus; developed multilaminar membranes in the nuclear region and the midpiece. The formation of membrane filipin-sterol complexes occur sparsely along the head region, specially around the nucleus; the complexes were also present in the midpiece membrane and scarcely lining the flagellum. The complexes were present in the different layers of the multilaminar membranes. The ethanol-phosphotungstic acid (E-PTA) treatment relieved the presence of basic proteins in acrosome vesicle, pericentriolar material, peripheral fibers of the axoneme and fibrous sheath. The tannic acid technique revealed the microtubules of the centrioles and the axoneme; the extracellular tubules encircling the spermatozoa and those spread in the epididymal lumen were also observed. However, the immunocytochemistry assay using antibodies against alpha-tubulin and beta-tubulin, the primary microtubule monomers, does not support the existence of composition similarity between these tubular structures, since the extracellular tubules were not

  1. Isolation and characterization of a convulxin-like protein from Crotalus durissus collilineatus venom.

    Science.gov (United States)

    Toyama, M H; Carneiro, E M; Marangoni, S; Amaral MEC; Velloso, L A; Boschero, A C

    2001-10-01

    A convulxin (Cvx)-like protein was isolated from Crotalus durissus collilineatus venom by a combination of molecular exclusion and reversed-phase HPLC chromatographies. The molecular mass of the Cvx-like protein in the absence and presence of DTT was 78 kDa and 12-13 kDa, respectively. The Cvx-like protein consisted of two nonidentical polypeptide chains (alpha and beta). The N-terminal amino-acid sequences of the alpha and beta subunits were GLHCPSDWYAYDGHCYKIFNEEMNWED and GFCCPSHWSSYSRYCYKFFSQEMNWEDAEK, respectively, with both subunits having a high content of Glu, Ser, Cys, and Asp. The Cvx-like protein showed high homology with other venom C-type lectins, but had low hemagglutinating activity on intact and trypsinized erythrocytes. The Cvx-like protein stimulated insulin receptor phosphorylation and potentiated insulin secretion from isolated islets in the presence of sub- (2.8 mM) or supra-physiological (16.7 mM) glucose concentrations. These results suggest that the increase in insulin secretion induced by Cvx-like protein may be mediated by a protein tyrosine kinase-dependent pathway and may involve other membrane receptors, such as GP VI or Scr family proteins.

  2. Inflammatory Mediators Release in Urine from Mice Injected with Crotalus durissus terrificus Venom

    Science.gov (United States)

    Hernández Cruz, A.; Barbosa Navarro, L.; Mendonça, R. Z.; Petricevich, V. L.

    2011-01-01

    In this study, we investigated in groups of female BALB/c mice injected with Crotalus durissus terrificus venom (Cdt) the renal function based on creatinine clearance, percentage of fractional excretion cytokines and histological examination of renal tissue. Cdt caused renal alterations that induced proteinuria during the initial hours post-venom and reduced creatinine clearance 15 min. up to 2 hours post-venom administration. In urine from mice injected with Cdt induced a decrease in IL-4 levels. More pronounced increments of IL-5, IL-6 and IFN-γ were observed after 15 and 30 min, respectively. The highest levels of TNF and IL-10 were observed at 1 and 4 hs, respectively. The ratios of pro- and anti-inflammatory cytokines in animals injected with Cdt, which may be manifested in the inflammatory status during the envenoming. In groups of animals treated with Cdt were observed a decreasing in creatinine clearance and its effect on glomerular filtration rate was accompanied by decreased fractional excretion of cytokines and morphologic disturbances. This loss of change selectively in envenomation could thus explain why the relatively excretion of cytokines is reduced while of total proteins increases. In conclusion the fractional excretion of cytokines is significantly reduced in mice injected with Cdt, despite proteinuria. PMID:22174490

  3. Occurrence of Cryptosporidium (Apicomplexa, Cryptosporidiidae in Crotalus durissus terrificus (Serpentes, Viperidae in Brazil

    Directory of Open Access Journals (Sweden)

    Karasawa Andréa Satie Matsubara

    2002-01-01

    Full Text Available The objective of the present study was to investigate the prevalence of Cryptosporidium (Apicomplexa, Cryptosporidiidae in the snake Crotalus durissus terrificus (Serpentes, Viperidae. Fifty animals were evaluated for the presence of oocysts of Cryptosporidium sp. at the time of arrival and 30 and 60 days later. Intestinal washings with saline solution (1% body weight, fecal samples, and organ scrapings were collected during the study. Oocysts were concentrated by an ether-phosphate-buffered saline sedimentation technique and then separated by a density gradient centrifugation technique. Smears were made with the sediment and submitted to modified acid-fast and auramine-rhodamine staining. Cryptosporidium-positive smears were used as controls for the experimental findings. The overall prevalence of Cryptosporidium sp. oocysts was 14%. Among the positive snakes, oocysts were detected only in the intestinal washing in two specimens, only in the feces in four specimens, and in both materials at least once in one specimen. The positive snakes were predominantly from Santa Maria da Serra city State of São Paulo (57.1%. We also observed that all of the examinations that presented positive results were obtained at least 27 days after the capture of the animals.

  4. Pro- and Anti-Inflammatory Cytokines Release in Mice Injected with Crotalus durissus terrificus Venom

    Directory of Open Access Journals (Sweden)

    A. Hernández Cruz

    2008-01-01

    Full Text Available The effects of Crotalus durissus terrificus venom (Cdt were analyzed with respect to the susceptibility and the inflammatory mediators in an experimental model of severe envenomation. BALB/c female mice injected intraperitoneally presented sensibility to Cdt, with changes in specific signs, blood biochemical and inflammatory mediators. The venom induced reduction of glucose and urea levels and an increment of creatinine levels in serum from mice. Significant differences were observed in the time-course of mediator levels in sera from mice injected with Cdt. The maximum levels of IL-6, NO, IL-5, TNF, IL-4 and IL-10 were observed 15 min, 30 min, 1, 2 and 4 hours post-injection, respectively. No difference was observed for levels of IFN-γ. Taken together, these data indicate that the envenomation by Cdt is regulated both pro- and anti-inflammatory cytokine responses at time-dependent manner. In serum from mice injected with Cdt at the two first hours revealed of pro-inflammatory dominance. However, with an increment of time an increase of anti-inflammatory cytokines was observed and the balance toward to anti-inflammatory dominance. In conclusion, the observation that Cdt affects the production of pro- and anti-inflammatory cytokines provides further evidence for the role played by Cdt in modulating pro/anti-inflammatory cytokine balance.

  5. Biochemical and biological evaluation of gyroxin isolated from Crotalus durissus terrificus venom

    Directory of Open Access Journals (Sweden)

    LC Barros

    2011-01-01

    Full Text Available Gyroxin, a thrombin-like enzyme isolated from Crotalus durissus terrificus venom and capable of converting fibrinogen into fibrin, presents coagulant and neurotoxic activities. The aim of the present study was to evaluate such coagulant and toxic properties. Gyroxin was isolated using only two chromatographic steps - namely gel filtration (Sephadex G-75 and affinity (Benzamidine Sepharose 6B - resulting in a sample of high purity, as evaluated by RP-HPLC C2/C18 and electrophoretic analysis that showed a molecular mass of 30 kDa. Gyroxin hydrolyzed specific chromogenic substrates, which caused it to be classified as a serine proteinase and thrombin-like enzyme. It was stable from pH 5.5 to 8.5 and inhibited by Mn²+, Cu²+, PMSF and benzamidine. Human plasma coagulation was more efficient at pH 6.0. An in vivo toxicity test showed that only behavioral alterations occurred, with no barrel rotation. Gyroxin was not able to block neuromuscular contraction in vitro, which suggests that its action, at the studied concentrations, has no effect on the peripheral nervous system.

  6. Gross and histologic features of gastritis due to Ophidascaris arndti in tropical rattlesnakes ( Crotalus durissus

    Directory of Open Access Journals (Sweden)

    É.M. Mello

    Full Text Available ABSTRACT The tropical rattlesnake (Crotalus durissus is a snake of great importance for biomedical industry since its poison is used for the production of antiophidic serum and researches. Several conditions related to animal health, such as diseases and parasites, which can promote the reduction of poison production by these snakes should be investigated. Accordingly, the aim of this study was to characterize the gross and microscopic lesions related to the presence of Ophidascaris arndti in stomachs of tropical rattlesnakes. The gastrointestinal tract of thirty-five South American rattlesnakes captured in Southeastern region of Brazil were analyzed and nineteen animals showed infestation by the parasites, found in the small intestine and, especially, in the stomach of the hosts. Grossly, lesions were characterized by mucosal ulcers occasionally associated with hemorrhage. Microscopic alterations included histiocytic granulomas, fibrosis, necrosis, and hemorrhage. Based on these findings, the diagnosis of a parasitic granulomatous disease was made. The lesions may be related to the cause of death in captivity snakes, since the lesions can promote secondary infections by opportunistic bacteria. Moreover, the intense inflammatory response accompanied by fibrosis may be related to poor functioning of the gastric snakes, which it may exhibit frequent regurgitation of the food.

  7. Comprometimento respiratório secundário a acidente ofídico crotálico (Crotalus durissus Respiratory abnormalities following Crotalus durissus snakebite

    Directory of Open Access Journals (Sweden)

    Carlos Faria Santos Amaral

    1991-08-01

    Full Text Available São analisados três pacientes que apresentaram comprometimento da função respiratória após acidente por Crotalus durissus. As manifestações respiratórias surgiram nas primeiras 48 horas após a picada do ofídio e consistiram de dispnéia, taquipnéia, uso da musculatura acessória da respiração (casos 1 e 2 e batimento das aletas nasais (caso 2. Dois pacientes (casos 1 e 2 apresentaram insuficiência respiratória aguda. O diagnóstico desta complicação no caso 1 foi clínico pois o paciente apresentou apnéia. O paciente do caso 2, 24 horas após o acidente ofídico apresentou dificuldade respiratória intensa e períodos de apnéia sendo intubado, permanecendo em respiração espontânea. Houve agravamento dos sinais clínicos de insuficiência respiratória e a determinação de pH e gases do sangue arterial mostrou em relação ao exame inicial elevação da pressão parcial de gás carbônico (40 mmHg para 50,3 mm Hg caracterizando insuficiência ventilatória aguda. Ambos foram tratados com emprego de ventilação artificial mecânica, tendo o paciente do caso 1 permanecido no ventilador durante 33 dias e o do caso 2 durante 15 dias. Ambos desenvolveram insuficiência renal aguda, necessitaram de diálise peritoneal e recuperaram a função renal. A paciente do caso 3, apesar dos sintomas e sinais de comprometimento respiratório não apresentou alterações do pH e gases arteriais. Espirometria realizada 58 horas após o acidente mostrou capacidade vital forçada (CVF e volume espirado no primeiro segundo (VEF1 abaixo do previsto (60 e 67% respectivamente. As espirometrias realizadas nos dias subseqüentes evidenciaram melhora progressiva destes parâmetros. No 10º dia após o acidente constatou-se aumento de 20% da CVF e de 17% do VEF1 comparativamente ao exame inicial. A relação entre VEF1 e a CVF manteve-se praticamente inalterada e em valores próximos ao previsto, caracterizando distúrbio ventilatório do tipo

  8. Cloning of subunits of convulxin, a collagen-like platelet-aggregating protein from Crotalus durissus terrificus venom.

    OpenAIRE

    Leduc, M; Bon, C

    1998-01-01

    Convulxin (CVX) is a potent platelet-aggregating glycoprotein from the venom of the snake Crotalus durissus terrificus. It consists of two subunits, alpha and beta, joined by disulphide bridges in a hexameric structure. A cDNA library from venom gland was constructed in the vector pT3T7. The cloned cDNAs encoding the two chains of CVX were sequenced. Both are preceded by an identical 23-amino acid peptide signal sequence and encode sequences of 135 amino acids for the alpha chain and 125 amin...

  9. Laboratory evaluation of young ovines inoculated with natural or 60co-irradiated Crotalus durissus terrificus venom during hyperimmunization process

    Directory of Open Access Journals (Sweden)

    R. S. Ferreira Junior

    2006-01-01

    Full Text Available Laboratory profile of young ovines was studied in order to evaluate and compare their antiserum production from natural and Cobalt-60 irradiated Crotalus durissus terrificus (C.d.t. venoms. The parameters analyzed included complete blood count, and urea, creatinine, aspartate aminotransferase, total proteins, albumin and globulin serum measurements. Three groups of six animals each were used. Group 1 (G1 received natural C.d.t. venom; Group 2 (G2 received irradiated C.d.t. venom; and Group 3 (G3 was used as control and did not receive venom, only adjuvants, using seven venom inoculations. During the experimental period, animals were fortnightly weighed. According to clinical and weight evaluation, sheep in post-weaning phase showed no changes in their physiological profiles but had excellent weight gain. The parameters analyzed were not statistically different (p<5% among the groups tested. The hyperimmunization process was successfully accomplished with the production of specific antibodies against Crotalus durissus terrificus venom. Results bring a new possibility of utilizing ovines in the commercial production of anticrotalic serum, which may be used to treat human and animal envenomation. Its production cost may be reduced by subsequent use of hyperimmunized sheep for human consumption.

  10. Interaction study of water radiolysis products with Crotalus durissus terrificus miotoxin; Estudo das interacoes dos produtos de radiolise da agua com a miotoxina do veneno de Crotalus durissus terrificus

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Murilo Casare da

    2008-07-01

    Ionizing radiation has been satisfactorily employed for venoms detoxification. In this report, the radiation was employed to verify the effects caused by the radiolysis products of water on the Crotamine, toxin purified from Crotalus durissus terrificus venom. These effects were analyzed using some substances called 'scavengers', those substances competes for specific reactive species hindering them to act on the toxins molecules. In order to study the possible structural damages caused on the toxins, circular dichroism, fluorescence, nuclear magnetic resonance, amino acids analysis and intravital microscopy were employed. Our results indicate that ionizing radiation caused structure alterations, mainly, in secondary and tertiary structure of crotamine. In the irradiated crotamine, was not possible to determine tridimensional structure. And the crotamine toxic effect was removed by ionizing radiation. (author)

  11. The adrenergic retulation of the cardiovascular system in the South American rattlesnake, Crotalus durissus

    DEFF Research Database (Denmark)

    Galli, G.L.J.; Jensen, Nini Skovgaard; Abe, A.S.

    2007-01-01

    The present study investigates adrenergic regulation of the systemic and pulmonary circulations of the anaesthetised South American rattlesnake, Crotalus durissus. Haemodynamic measurements were made following bolus injections of adrenaline and adrenergic antagonists administered through a systemic...... arterial catheter. Adrenaline caused a marked systemic vasoconstriction that was abolished by phentolamine, indicating this response was mediated through α-adrenergic receptors. Injection of phentolamine gave rise to a pronounced vasodilatation (systemic conductance (Gsys) more than doubled), while...... injection of propranolol caused a systemic vasoconstriction, pointing to a potent α-adrenergic, and a weaker β-adrenergic tone in the systemic vasculature of Crotalus. Overall, the pulmonary vasculature was far less responsive to adrenergic stimulation than the systemic circulation. Adrenaline caused...

  12. Clinical and hematological alterations in dogs during experimental envenomation with Crotalus durissus terrificus venom and treated with antiophidic serum

    Directory of Open Access Journals (Sweden)

    R. M. B. Nogueira

    2006-04-01

    Full Text Available The present work aimed to evaluate the clinical and hematological aspects during experimental envenomation by Crotalus durissus terrificus in dogs treated with different antiophidic serum doses. Sixteen dogs were divided into two groups of eight animals each. Group I received 1mg/kg venom subcutaneously and 30mg antiophidic serum intravenously; Group II received 1mg/kg venom subcutaneously and 60mg antiophidic serum intravenously. In the clinical evaluation, we observed ataxia, moderate sedation, dilated pupils, sialorrhea, flaccid paralysis of mandibular muscles, and discreet edema at the site of venom inoculation. Evaluating red and white blood cells, we observed a decrease of hemoglobins, globular volume and erythrocytes, and an increase of plasmatic proteins, leukocytes, neutrophils, monocytes and lymphocytes. Clotting time increased and there was blood incoagulability with return to normal clotting time six hours after antiophidic serum administration. Animals treated with six antiophidic serum flasks had a faster recovery than the animals that received three serum flasks.

  13. Liver dysfunction in patients bitten by Crotalus durissus terrificus (Laurenti, 1768 snakes in Botucatu (State of São Paulo, Brazil Alterações hepáticas em doentes picados por serpentes Crotalus durissus terrificus (Laurenti, 1768 na região de Botucatu, Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Benedito Barra Viera

    1995-02-01

    Full Text Available Thirty-two patients bitten by venomous snakes sixteen by Bothrops spp. and sixteen by Crotalus durissus terrificus were studied. The group comprised thirty males and two females, aged eight to sixty-three years (mean 33±15. Bromsulphalein tests were increased in the majority of patients bitten by Crotalus durissus terrificus. The correlation coefficient of Spearman was positive between bromsulphalein tests and alanine aminotransferase levels, and between alanine aminotransferase and aspartate aminotransferase levels only in the Crotalus group. The only patient who died was bitten by Crotalus durissus terrificus and showed hydropic degeneration and mitochondrial injury in the liver. It was concluded that the hepatic damage might have been caused by at least two possible mechanisms: venom effect on liver mitochondria and cytokine effects on hepatocyte, specially interleukin-6.Os autores estudaram 32 doentes picados por serpentes venenosas, sendo 16 picados por Bothrops spp. e 16 por Crotalus durissus terrificus. Trinta doentes eram do sexo masculino e dois do feminino com idades variando entre 8 e 63 anos (méda 33±15. A prova da retenção da bromosulfaleína apresentou-se aumentada na maioria dos doentes picados por serpentes Crotalus durissus terrificus. Houve correlação positiva entre a retenção da bromosulfaleína e os níveis séricos de alanina aminotransferase e entre alanina e aspartato aminotransferase apenas nos doentes do grupo Crotalus. Um dos doentes evoluiu para o óbito e apresentou no exame anatomopatológico do fígado degeneração hidrópica e lesões mitocondriais. Os autores concluem que as alterações hepáticas são causadas por pelo menos dois mecanismos a saber: lesão mitocondrial por efeito do veneno crotálico; efeito das citoquinas, especialmente a interleucina-6.

  14. Comparison of wildlife and captivity rattlesnakes (Crotalus durissus terrificus microbiota Comparação da microbiota de cascavéis (Crotalus durissus terrificus de vida-livre e cativeiro

    Directory of Open Access Journals (Sweden)

    Rui S. Ferreira Junior

    2009-12-01

    Full Text Available The study evaluated and compared the aerobic microbiota from the oral cavity, cloaca and venom of Crotalus durissus terrificus snakes, recently caught from the wild and kept under quarantine (WQ, individual captivity (IC and collective captivity (CC. Antimicrobial drug effectiveness on isolated agents also was assayed. From group I, II and III were isolated, respectively, 29 (63.04%, 38 (90.48% and 21 (42.86% microorganisms from the cloaca; 15 (32.61%, 3 (7.14% and 25 (51.02% microorganisms from the oral cavity; and, 2 (4.35%, 1 (2.38% and 3 (6.12% microorganisms from venom. The most frequent bacteria were Pseudomonas aeruginosa, Proteus vulgaris and Morganella morganii, with sensitivity to amikacin, gentamicin, norfloxacin, sulfazotrin and tobramycin. Snakes kept in semi-open captivity exhibited the fewest microorganisms in oral cavities, perhaps due to the environment in captivity, with different temperature gradients, running water, absence of daily handling, circulating air, possibility of moving around, daily cleaning, and sunlight access.Este estudo avaliou e comparou a microflora aeróbica da cavidade oral, cloaca e veneno de serpentes Crotalus durissus terrificus recém-capturadas da natureza e mantidas sob quarentena (WQ, mantidas em cativeiro coletivo (CC e em cativeiro individual (IC. A eficácia de drogas antimicrobianas de agentes isolados foi também avaliada. Foram isolados microorganismos dos grupos I, II e III respectivamente: 29 (63.04%, 38 (90.48% e 21 (42.86% da cloaca; 15 (32.61%, 3 (7.14% e 25 (51.02% da cavidade oral, e finalmente 2 (4.35%, 1 (2.38% e 3 (6.12% do veneno. As bactérias mais frequentes foram Pseudomonas aeruginosa, Proteus vulgaris e Morganella morganii, com sensibilidade para amikacina, gentamicina, norfloxacina, sulfazotrina e tobramicina. Serpentes mantidas no cativeiro semi-aberto mostraram menor número de agentes infecciosos em cavidade oral, talvez devido ao ambiente de cativeiro com diferentes

  15. Allopurinol reduces the lethality associated with acute renal failure induced by Crotalus durissus terrificus snake venom: comparison with probenecid.

    Science.gov (United States)

    Frezzatti, Rodrigo; Silveira, Paulo Flavio

    2011-09-01

    Acute renal failure is one of the most serious complications of envenoming resulting from Crotalus durissus terrificus bites. This study evaluated the relevance of hyperuricemia and oxidative stress and the effects of allopurinol and probenecid in renal dysfunction caused by direct nephrotoxicity of C. d. terrificus venom. Hematocrit, protein, renal function and redox status were assessed in mice. High ratio of oxidized/reduced glutathione and hyperuricemia induced by C. d. terrificus venom were ameliorated by both, allopurinol or probenecid, but only allopurinol significantly reduced the lethality caused by C. d. terrificus venom. The effectiveness of probenecid is compromised probably because it promoted hypercreatinemia and hypocreatinuria and worsed the urinary hypo-osmolality in envenomed mice. In turn, the highest effectiveness of allopurinol might be due to its ability to diminish the intracellular formation of uric acid. Data provide consistent evidences linking uric acid with the acute renal failure induced by C. d. terrificus venom, as well as that this envenoming in mice constitutes an attractive animal model suitable for studying the hyperuricemia and that the allopurinol deserves to be clinically evaluated as an approach complementary to anti-snake venom serotherapy.

  16. Allopurinol reduces the lethality associated with acute renal failure induced by Crotalus durissus terrificus snake venom: comparison with probenecid.

    Directory of Open Access Journals (Sweden)

    Rodrigo Frezzatti

    2011-09-01

    Full Text Available BACKGROUND: Acute renal failure is one of the most serious complications of envenoming resulting from Crotalus durissus terrificus bites. This study evaluated the relevance of hyperuricemia and oxidative stress and the effects of allopurinol and probenecid in renal dysfunction caused by direct nephrotoxicity of C. d. terrificus venom. METHODOLOGY/PRINCIPAL FINDINGS: Hematocrit, protein, renal function and redox status were assessed in mice. High ratio of oxidized/reduced glutathione and hyperuricemia induced by C. d. terrificus venom were ameliorated by both, allopurinol or probenecid, but only allopurinol significantly reduced the lethality caused by C. d. terrificus venom. The effectiveness of probenecid is compromised probably because it promoted hypercreatinemia and hypocreatinuria and worsed the urinary hypo-osmolality in envenomed mice. In turn, the highest effectiveness of allopurinol might be due to its ability to diminish the intracellular formation of uric acid. CONCLUSIONS/SIGNIFICANCE: Data provide consistent evidences linking uric acid with the acute renal failure induced by C. d. terrificus venom, as well as that this envenoming in mice constitutes an attractive animal model suitable for studying the hyperuricemia and that the allopurinol deserves to be clinically evaluated as an approach complementary to anti-snake venom serotherapy.

  17. Cloning of subunits of convulxin, a collagen-like platelet-aggregating protein from Crotalus durissus terrificus venom.

    Science.gov (United States)

    Leduc, M; Bon, C

    1998-07-15

    Convulxin (CVX) is a potent platelet-aggregating glycoprotein from the venom of the snake Crotalus durissus terrificus. It consists of two subunits, alpha and beta, joined by disulphide bridges in a hexameric structure. A cDNA library from venom gland was constructed in the vector pT3T7. The cloned cDNAs encoding the two chains of CVX were sequenced. Both are preceded by an identical 23-amino acid peptide signal sequence and encode sequences of 135 amino acids for the alpha chain and 125 amino acids for the beta chain. These polypeptides include a carbohydrate-recognition domain (CRD) in which some of the specific amino acids required for binding Ca2+ and galactose or mannose are absent. The presence of such a domain means that CVX can be included in the family of C-type lectins along with other snake venom proteins, although it is not a true lectin. Assuming that the localization of intracatenary disulphide bridges of each CVX chain is similar to that of the CRD and that an intercatenary bridge between the alpha and beta chains is similar to that of the C-type lectin botrocetin, we postulate the existence of an additional intercatenary bridge, which explains the tridimeric structure (alphabeta)3 of CVX.

  18. Crotoxin, the major toxin from the rattlesnake Crotalus durissus terrificus, inhibits ³H-choline uptake in guinea pig ileum

    Directory of Open Access Journals (Sweden)

    L.S. Kattah

    2000-09-01

    Full Text Available We examined the effect of crotoxin, the neurotoxic complex from the venom of the South American rattlesnake Crotalus durissus terrificus, on the uptake of ³H-choline in minces of smooth muscle myenteric plexus from guinea pig ileum. In the concentration range used (0.03-1 µM and up to 10 min of treatment, crotoxin decreased ³H-choline uptake by 50-75% compared to control. This inhibition was time dependent and did not seem to be associated with the disruption of the neuronal membrane, because at least for the first 20 min of tissue exposure to the toxin (up to 1 µM the levels of lactate dehydrogenase (LDH released into the supernatant were similar to those of controls. Higher concentrations of crotoxin or more extensive incubation times with this toxin resulted in elevation of LDH activity detected in the assay supernatant. The inhibitory effect of crotoxin on ³H-choline uptake seems to be associated with its phospholipase activity since the equimolar substitution of Sr2+ for Ca2+ in the incubation medium or the modification of the toxin with p-bromophenacyl bromide substantially decreased this effect. Our results show that crotoxin inhibits ³H-choline uptake with high affinity (EC25 = 10 ± 5 nM. We suggest that this inhibition could explain, at least in part, the blocking effect of crotoxin on neurotransmission.

  19. Perfil eletroforético das proteínas séricas de serpentes Crotalus durissus terrificus (cascavel criadas em cativeiro Serum protein electrophoresis profile of the rattlesnake Crotalus durissus terrificus kept in captivity

    Directory of Open Access Journals (Sweden)

    Joandes Henrique Fonteque

    2009-06-01

    Full Text Available As serpentes peçonhentas dos gêneros Bothrops e Crotalus têm sido mantidas em cativeiro visando à extração de venenos para a produção de imunobiológicos. O conhecimento da fisiologia desses animais e as alterações na concentração de proteínas e suas frações séricas são importantes para a identificação precoce de importantes enfermidades que cursam com estados de hipoproteinemia e hiperproteinemia. O objetivo do trabalho foi determinar a concentração de proteína total e o perfil eletroforético das proteínas séricas de serpentes Crotalus durissus terrificus (cascavel criadas em cativeiro. Foram colhidas amostras de sangue da veia coccígea ventral de 21 serpentes adultas e sadias, divididas em dois grupos: Grupo 1 de 12 machos com peso médio de 588,89±193,55g, e Grupo 2 de nove fêmeas com peso médio de 708,33±194,04g. A proteína total sérica foi determinada pelo método de refratometria e a eletroforese em gel de agarose. Obtiveram-se valores da proteína total sérica (g/dL de 4,51±0,50 para machos e de 4,82±0,72 para fêmeas, e para machos e fêmeas de 4,64±0,61. Foram identificadas pela eletroforese quatro frações protéicas (g/dL: albumina, a, b, g-globulinas e calculada a relação albumina:globulina. As serpentes fêmeas apresentaram maiores valores para as variáveis, albumina e para a relação albumina/globulina (AG diferindo significativamente (PThe poisonous snakes of the genera Crotalus and Bothrops have been kept in captivity with the purpose of extracting poison for the production of immunobiological. Knowledge of the physiology of these animals and serum proteins concentration changes are important for early identification of major diseases which lead to states of hypoproteinemia and hyperproteinemia. The objective was to determine the concentration of total protein and serum protein electrophoresis profile of Crotalus durissus terrificus (rattlesnake in captivity. Blood samples were taken from

  20. Influência da temperatura corporal de cascavéis (Crotalus durissus submetidas à anestesia com cetamina Influence of body temperature on rattlesnakes (Crotalus durissus anesthetized with ketamine

    Directory of Open Access Journals (Sweden)

    Adriano B. Carregaro

    2009-12-01

    Full Text Available O estudo objetivou verificar a influência da temperatura corporal nos parâmetros fisiológicos e nos períodos de indução e recuperação anestésicos de cascavéis (Crotalus durissus anestesiadas com cetamina. Os animais foram previamente submetidos à hipotermia (HIPO (The aim of the study was to verify the influence of the body temperature under physiological values and latency and recovery times on rattlesnakes anesthetized with ketamine. The animals were previously submitted to hypothermia (HYPO (<22°C and normothermia (30°C (NORMO and then, anesthetized with 80 mg/kg IM of ketamine. Latency and recovery times were evaluated by head tonus, muscular tonus and righting reflex. Heart rate (HR, time of apnea and body temperature were measured before and 5, 10, 15, 30, 60, 90 and 120 minutes after ketamine administration. Blood gases parameters were measured before, 30 and 60 minutes. It was not observed difference on latency time in both groups. The recovery time was higher on HYPO (5,5 hours compared to NORMO (3,5 hours. HR was higher on NORMO compared to HYPO. Time of apnea was the same pattern on both groups. Compared to basal levels, time of apnea was shorter between 5 to 30 min on both groups. Respiratory acidosis was observed only at 0 min in NORMO. SvO2 was higher after 30 min, the same as with PvO2 in both groups. PvCO2 reduced after 30 min in both groups. It was evident that body temperature exerts intense influence on the recovery time on rattlesnakes anesthetized with ketamine.

  1. Aspectos morfológicos e ultraestruturais de células sanguíneas de Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    Lívia M. Kindlovits

    Full Text Available RESUMO: A avaliação hematológica, de importância comprovada como um meio auxiliar de diagnóstico ao clínico de pequenos animais domésticos, vem se tornando comum em animais selvagens não apenas para a clínica, mas para a avaliação do manejo e como estudo auxiliar para a fisiologia das várias espécies. Tendo em vista o aumento da demanda para a produção de várias drogas de importância farmacêutica, a criação de serpentes peçonhentas vem se tornando comum a ponto destes animais já serem reconhecidos como sendo de produção. O conhecimento do manejo e da clínica destes animais ainda é escasso e a mortalidade é elevada nos criatórios, tornando urgente a ampliação destes. Embora alguns estudos hematológicos já tenham sido realizados em cascavéis (Crotalus durissus os dados analisados ainda são insipientes, notadamente em relação à caracterização das células do sangue e poucos estudos em microscopia eletrônica foram realizados em serpentes. Com o objetivo de caracterizar as células sanguíneas morfologicamente, sob microscopia óptica e ultraestrutural, foram coletadas amostras de sangue de 52 de indivíduos da subespécie Crotalus durissus terrificus para a realização de esfregaços sanguíneos e avaliação ultraestrutural. Concluiu-se que a coloração hematológica de Giemsa permite a avaliação morfológica e a diferenciação das células sanguíneas em serpentes assim como a visualização de hemoparasitos. A avaliação ultraestrutural permite evidenciar as organelas celulares e a diferenciação entre as células, inclusive entre os tipos leucocitários, porém ainda são necessários outros estudos para que seja elucidada a hipótese da existência dos eosinófilos na espécie estudada assim como é necessária melhor caracterização dos grânulos dos azurófilos para que se confirme uma possível diferença entre os monócitos típicos e os azurófilos.

  2. Flow cytometric characterization of peripheral blood leukocyte populations of 3 neotropical snake species: Boa constrictor, Bothrops jararaca, and Crotalus durissus.

    Science.gov (United States)

    Carvalho, Marcelo P N; Queiroz-Hazarbassanov, Nicolle G T; Massoco, Cristina O; Rossi, Silmara; Sant'Anna, Sávio S; Catão-Dias, José L; Grego, Kathleen F

    2016-06-01

    The reptilian immune system is represented by innate, humoral, and cell-mediated mechanisms, involving different types of blood leukocytes. The development of optimized methods for the advanced study of origin and function of reptilian blood leukocytes is needed. The purpose of the study was to optimize leukocyte density gradient isolation protocols from snake peripheral blood samples, and characterize recovered cells by flow cytometry based on size and internal complexity for a qualitative and semi-quantitative assessment of leukocyte populations in one boa (Boa constrictor), and 2 viper species (Bothrops jararaca, Crotalus durissus). Blood samples from 30 snakes (10 from each species, 5 males and 5 females) were collected in tubes with sodium heparin. Fresh blood was centrifuged with either ficoll-paque PLUS or percoll density gradients for leukocyte isolation. Flow cytometric leukocyte gates were defined based on size (forward scatter [FSC]) and internal complexity (side scatter [SSC]). Relative leukocyte differential counts after sorting the cells in these gates in one snake for each species were compared to conventional light microscopic differential counts on unsorted isolated leukocytes. There was no statistical difference in the relative leukocyte populations, including heterophils, azurophils, and small and large lymphocytes between samples isolated by ficoll or percoll. Four leukocyte gates were identified based on their location in FSC/SSC cytograms. The relative leukocyte differential counts after sorting in single animals showed some agreement with the light microscopy differential count on unsorted cells. Based on FSC and SSC, 4 distinct leukocyte populations were found in ficoll or percoll density gradient isolated leukocytes from peripheral blood from boa and viper species. Further optimization of the technique should allow the performance of functional assays. © 2016 American Society for Veterinary Clinical Pathology.

  3. Hematological changes in sheep inoculated with natural and Cobalt60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    International Nuclear Information System (INIS)

    Netto, D.P.; Alfieri, A.A.; Balarim, M.R.S.; Chiacchio, S.B.; Bicudo, P.L.; Nascimento, N.

    2004-01-01

    Natural (NV) and Cobalt 60 -irradiated (IrV) Crotalus durissus terrificus venom were used to evaluate serum production capacity of sheep and possible hematological and biochemical effects. Freeze-dried venom aliquots were diluted in acidified saline solution (NaCl 150 m M, p H 3.0) and irradiated by a Cobalt 60 source at a dose of 5.54 x 102 Gy/h and a concentration of 2.000 Gy. Twelve sheep were divided into two groups of six animals. One group received irradiated venom (IrV) and the other natural venom (NV). Three antigen doses (venom) were administered at monthly intervals. Blood samples were collected weekly for analysis of serum neutralization potency and capacity, complete blood count, total plasma protein, fibrinogen, albumin, and globulin. At the end of the experiment, the animals were challenged with a LD 50 for sheep and showed no signs of envenoming. The two groups did not present clinical alterations. Results of the total leukocyte count did not present interaction or time factor effect for both groups, but there was a different action between them, with the NV group presenting more cells than the IrV group. The leukocyte increase to 13,000/μl indicates that slight leucocytosis occurred in the week after the first inoculation in the NV group. There was no statistically significant difference between groups in the absolute count of segmented neutrophils, eosinophils, and lymphocytes but there were statistically significant oscillations in values at the different collecting times. The NV group presented an increase in the absolute neutrophil count after the first inoculation that persisted for 5 weeks. In the IrV group, the increase in neutrophils occurred only in the first week returning to normal in the following weeks. The alterations in the neutrophil count are indicative of systemic inflammatory response related to cytokine release; response was more marked in the N V group, showing its greater toxicity. (author)

  4. Hematological changes in sheep inoculated with natural and Cobalt60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768

    Directory of Open Access Journals (Sweden)

    D. P. Netto

    2004-01-01

    Full Text Available Natural (NV and Cobalto60-irradiated (IrV Crotalus durissus terrificus venom were used to evaluate serum production capacity of sheep and possible hematological and biochemical effects. Freeze-dried venom aliquots were diluted in acidified saline solution (NaCl 150 mM, pH 3.0 and irradiated by a Cobalt 60 source at a dose of 5.54 x 102 Gy/h and a concentration of 2.000 Gy. Twelve sheep were divided into two groups of six animals. One group received irradiated venom (IrV and the other natural venom (NV. Three antigen doses (venom were administered at monthly intervals. Blood samples were collected weekly for analysis of serum neutralization potency and capacity, complete blood count (CBC, total plasma protein, fibrinogen, albumin, and globulin. At the end of the experiment, the animals were challenged with a LD50 for sheep and showed no signs of envenoming. The two groups did not present clinical alterations. Results of the total leukocyte count did not present interaction or time factor effect for both groups, but there was a different action between them, with the NV group presenting more cells than the IrV group. The leukocyte increase to 13,000/ml indicates that slight leukocytosis occurred in the week after the first inoculation in the NV group. There was no statistically significant difference between groups in the absolute count of segmented neutrophils, eosinophils, and lymphocytes but there were statistically significant oscillations in values at the different collecting times. The NV group presented an increase in the absolute neutrophil count after the first inoculation that persisted for 5 weeks. In the IrV group, the increase in neutrophils occurred only in the first week returning to normal in the following weeks. The alterations in the neutrophil count are indicative of systemic inflammatory response related to cytokine release; response was more marked in the NV group, showing its greater toxicity.

  5. Hepatozoon spp. (Apicomplexa: Hepatozoidae) infection and selected hematological values of the neotropical rattlesnake, Crotalus durissus collilineatus (Linnaeus, 1758) (Serpentes: Viperidae), from Brazil.

    Science.gov (United States)

    Motta, Rafael Otávio Cançado; Cunha, Lucas Maciel; Leite, Romário Cerqueira; da Silva, Israel José; Pinto, Ana Cristina Araújo; Braga, Erika Martins; da Cunha, Arildo Pinto; de Oliveira, Paulo Roberto

    2011-09-01

    This study aims to establish the hematological values of Crotalus durissus collilineatus snakes captured in Brazil as well as to verify the effects of hematozoan infection on these snakes. Eighty-three blood samples were drawn from C. d. collilineatus specimens for analysis. The sample set was composed of 30 males and 30 females, recently caught from the wild, and 11 males and 12 females bred in captivity. Blood samples were used to determine red blood cell counts, white blood cell counts, thrombocyte counts, hematocrit values, hemoglobin concentration, and total plasma protein. Blood smears were used to diagnose Hepatozoon spp. infection and to calculate the parasitic load in the sample as well as the percentage of immature red cells. Results obtained for the wild-caught animals, with and without parasites, were compared among themselves and with the values obtained for the captive-bred animals. Hematological values for C. durissus were established. Wild-caught snakes had an infection rate of 38.3%, while no Hepatozoon sp. infection was detected in the captive-bred animals. The snakes which were not infected by the Hepatozoon sp. exhibited average weight, length, and weight-length ratios higher than those of the infected animals. An increase in immature red cells was noted in the Hepatozoon-infected snakes.

  6. Hematological changes in sheep inoculated with natural and Cobalt{sub 60}-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    Energy Technology Data Exchange (ETDEWEB)

    Netto, D.P.; Alfieri, A.A.; Balarim, M.R.S. [Universidade Estadual de Londrina, PR (Brazil). Faculdade de Medicina Veterinaria e Zootecnia. Dept. de Medicina Veterinaria Preventiva]. E-mail: rnetto@uel.br; Chiacchio, S.B.; Bicudo, P.L. [UNESP, Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia; Nascimento, N. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Supervisao de Radiobiologia

    2004-07-01

    Natural (NV) and Cobalt{sub 60}-irradiated (IrV) Crotalus durissus terrificus venom were used to evaluate serum production capacity of sheep and possible hematological and biochemical effects. Freeze-dried venom aliquots were diluted in acidified saline solution (NaCl 150 m M, p H 3.0) and irradiated by a Cobalt 60 source at a dose of 5.54 x 102 Gy/h and a concentration of 2.000 Gy. Twelve sheep were divided into two groups of six animals. One group received irradiated venom (IrV) and the other natural venom (NV). Three antigen doses (venom) were administered at monthly intervals. Blood samples were collected weekly for analysis of serum neutralization potency and capacity, complete blood count, total plasma protein, fibrinogen, albumin, and globulin. At the end of the experiment, the animals were challenged with a LD{sub 50} for sheep and showed no signs of envenoming. The two groups did not present clinical alterations. Results of the total leukocyte count did not present interaction or time factor effect for both groups, but there was a different action between them, with the NV group presenting more cells than the IrV group. The leukocyte increase to 13,000/{mu}l indicates that slight leucocytosis occurred in the week after the first inoculation in the NV group. There was no statistically significant difference between groups in the absolute count of segmented neutrophils, eosinophils, and lymphocytes but there were statistically significant oscillations in values at the different collecting times. The NV group presented an increase in the absolute neutrophil count after the first inoculation that persisted for 5 weeks. In the IrV group, the increase in neutrophils occurred only in the first week returning to normal in the following weeks. The alterations in the neutrophil count are indicative of systemic inflammatory response related to cytokine release; response was more marked in the N V group, showing its greater toxicity. (author)

  7. Crotoxin from Crotalus durissus terrificus is able to down-modulate the acute intestinal inflammation in mice.

    Directory of Open Access Journals (Sweden)

    Caroline de Souza Almeida

    Full Text Available Inflammatory bowel diseases (IBD is the result of dysregulation of mucosal innate and adaptive immune responses. Factors such as genetic, microbial and environmental are involved in the development of these disorders. Accordingly, animal models that mimic human diseases are tools for the understanding the immunological processes of the IBD as well as to evaluate new therapeutic strategies. Crotoxin (CTX is the main component of Crotalus durissus terrificus snake venom and has an immunomodulatory effect. Thus, we aimed to evaluate the modulatory effect of CTX in a murine model of colitis induced by 2,4,6- trinitrobenzene sulfonic acid (TNBS. The CTX was administered intraperitoneally 18 hours after the TNBS intrarectal instillation in BALB/c mice. The CTX administration resulted in decreased weight loss, disease activity index (DAI, macroscopic tissue damage, histopathological score and myeloperoxidase (MPO activity analyzed after 4 days of acute TNBS colitis. Furthermore, the levels of TNF-α, IL-1β and IL-6 were lower in colon tissue homogenates of TNBS-mice that received the CTX when compared with untreated TNBS mice. The analysis of distinct cell populations obtained from the intestinal lamina propria showed that CTX reduced the number of group 3 innate lymphoid cells (ILC3 and Th17 population; CTX decreased IL-17 secretion but did not alter the frequency of CD4+Tbet+ T cells induced by TNBS instillation in mice. In contrast, increased CD4+FoxP3+ cell population as well as secretion of TGF-β, prostaglandin E2 (PGE2 and lipoxin A4 (LXA4 was observed in TNBS-colitis mice treated with CTX compared with untreated TNBS-colitis mice. In conclusion, the CTX is able to modulate the intestinal acute inflammatory response induced by TNBS, resulting in the improvement of clinical status of the mice. This effect of CTX is complex and involves the suppression of the pro-inflammatory environment elicited by intrarectal instillation of TNBS due to the

  8. Avaliação da resposta inflamatória hematológica em cascavéis (Crotalus durissus Linnaeus, 1758 inoculadas com BCG Assessment of blood inflammatory response in BCG stimulated rattlesnakes (Crotalus durissus Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Wellington Bandeira da Silva

    2009-12-01

    Full Text Available A criação de serpentes peçonhentas em cativeiro para produção de soros antipeçonhas possui crescente importância para a saúde pública devido ao aumento do número de notificações de acidentes ofídicos a cada ano no Brasil. Iniciado no século XX, ainda hoje essa atividade apresenta alguns desafios como a instalação de doenças no plantel. O hemograma é um exame de triagem clínica que auxilia no diagnóstico de diversas moléstias que acometem diferentes espécies de animais, no entanto ainda pouco estudado em serpentes. A caracterização das alterações hematológicas em cascavéis inoculadas experimentalmente com BCG pode servir de base na utilização deste exame no auxílio ao diagnóstico de infecções bacterianas na espécie. Dessa forma, foram realizados exames hematológicos em 10 serpentes da espécie Crotalus durissus pertencentes ao plantel da Divisão de Herpetologia do Instituto Vital Brazil. Os animais foram divididos em dois grupos (Grupos 1 e 2, homogêneos entre si em relação ao peso e proporção sexual. Os dois grupos foram inoculados com BCG e submetidos à coleta de sangue antes da inoculação e em três momentos pós-inoculação (3º, 5º, e 7º dias para o Grupo 1 e 11º, 17º e 21º dias para o Grupo 2. O hemograma foi realizado por método semidireto pela utilização de líquido de Natt e Herrick e as lâminas foram coradas pelo Giemsa. Observou-se anemia discreta, com redução dos valores de concentração de hemoglobina corpuscular média e da hemoglobina globular média no Grupo 1 que foi relacionada à doença inflamatória. A trombocitopenia observada no Grupo 2 sugeriu a atuação deste tipo celular em processos inflamatórios. Um único animal do Grupo 1 apresentou granulocitose e alguns animais apresentaram discreta azurofilia. Observaram-se alterações morfológicas nos leucócitos. Os granulócitos apresentaram granulações grosseiras e os azurófilos apresentaram aumento de tamanho e

  9. Brazilian energy

    International Nuclear Information System (INIS)

    O'Shaughnessy, H.

    1997-04-01

    Brazilian Energy provides all the information necessary for energy companies to invest and operate in Brazil, including: a review of Brazil's natural resources; an assessment of privatisation strategies at the federal, state and regional level; an analysis of the electricity industry and the future for Electrobras; an analysis of the oil industry and, in particular, Petrobras; a discussion of the fuel alcohol industry; the discovery of local natural gas, its prospects and the involvement of the auto industry; an assessment of the problems facing the coal industry and its future; a discussion of the regulatory framework for the newly privatised companies; the importance of intra-regional energy links and the booming membership of Mercosur; the difficulties experienced by foreign investors doing business in Brazil; brief profiles of the key energy companies; profiles of key people influencing the privatisation process in Brazil. Brazilian energy is essential reading for those wishing to advise and assist Brazil in this period of change and development, as well as those who wish to invest or become key players in the Brazilian energy sector. (author)

  10. Crystal structure of the platelet activator convulxin, a disulfide-linked alpha4beta4 cyclic tetramer from the venom of Crotalus durissus terrificus.

    Science.gov (United States)

    Murakami, M T; Zela, S P; Gava, L M; Michelan-Duarte, S; Cintra, A C O; Arni, R K

    2003-10-17

    Convulxin (CVX), a C-type lectin, isolated from the venom of the South American rattlesnake Crotalus durissus terrificus, causes cardiovascular and respiratory disturbances and is a potent platelet activator which binds to platelet glycoprotein GPVI. The structure of CVX has been solved at 2.4A resolution to a crystallographic residual of 18.6% (R(free)=26.4%). CVX is a disulfide linked heterodimer consisting of homologous alpha and beta chains. The heterodimers are additionally linked by disulfide bridges to form cyclic alpha(4)beta(4)heterotetramers. These domains exhibit significant homology to the carbohydrate-binding domains of C-type lectins, to the factor IX-binding protein (IX-bp), and to flavocetin-A (Fl-A) but sequence and structural differences are observed in both the domains in the putative Ca(2+)and carbohydrate binding regions.

  11. Cytoskeleton, endoplasmic reticulum and nucleus alterations in CHO-K1 cell line after Crotalus durissus terrificus (South American rattlesnake venom treatment

    Directory of Open Access Journals (Sweden)

    B. P. Tamieti

    2007-01-01

    Full Text Available Snake venoms are toxic to a variety of cell types. However, the intracellular damages and the cell death fate induced by venom are unclear. In the present work, the action of the South American rattlesnake Crotalus durissus terrificus venom on CHO-K1 cell line was analyzed. The cells CHO-K1 were incubated with C. d. terrificus venom (10, 50 and 100g/ml for 1 and 24 hours, and structural alterations of actin filaments, endoplasmic reticulum and nucleus were assessed using specific fluorescent probes and agarose gel electrophoresis for DNA fragmentation. Significant structural changes were observed in all analyzed structures. DNA fragmentation was detected suggesting that, at the concentrations used, the venom induced apoptosis.

  12. The comparison between the humoral response and the neutralizing capacity of sheep serum inoculated with natural venom and Co60 irradiated venom from Crotalus durissus terrificus (Laurenti, 1768)

    International Nuclear Information System (INIS)

    Netto, D.P.

    2000-01-01

    Crotalus durissus terrificus venom was irradiated with Co 60 to investigate the effects of antigen-irradiation on antivenom production in sheep. Twelve sheep were divided in two groups of 6. One group received irradiated, while the other received natural venom. Three doses of antigen were given at monthly intervals. The toxic activity of the venom was assessed by LD 50 in mice. Weekly blood samples were obtained to evaluate anti-crotalic serum titers by indirect ELISA, neutralization capacity, and serum potency. A complete blood count, plasma protein and fibrinogen concentration, and serum albumin and globulin were also determined. At end of the experiment, the animals were challenged with ovine LD 50 , without clinical abnormalities. (author)

  13. Inhibition of proteases and phospholipases A2 from Bothrops atrox and Crotalus durissus terrificus snake venoms by ascorbic acid, vitamin E, and B-complex vitamins.

    Science.gov (United States)

    Oliveira, Carlos H M; Simão, Anderson A; Trento, Marcus V C; César, Pedro H S; Marcussi, Silvana

    2016-01-01

    The enzyme inhibition by natural and/ or low-cost compounds may represent a valuable adjunct to traditional serotherapy performed in cases of snakebite, mainly with a view to mitigate the local effects of envenoming. The objective of this study was to evaluate possible interactions between vitamins and enzymes that comprise Bothrops atrox and Crotalus durissus terrificus venoms, in vitro. Proteolysis inhibition assays (substrates: azocasein, collagen, gelatin and fibrinogen), hemolysis, coagulation, hemagglutination were carried out using different proportions of vitamins in face of to inhibit minimum effective dose of each venom. The vitamins were responsible for reducing 100% of breaking azocasein by C.d.t. venom, thrombolysis induced by B. atrox and fibrinogenolysis induced by both venoms. It is suggested the presence of interactions between vitamin and the active site of enzymes, for example the interactions between hydrophobic regions present in the enzymes and vitamin E, as well as the inhibitions exercised by antioxidant mechanism.

  14. Internal dosimetry of radiopharmaceuticals derived of antitumor polypeptide isolated from venoms: Crotalus durissus terrifucus and Scorpaena plumieri;Dosimetria interna de radiofarmacos derivados de polipeptideos antitumorais isolados dos venenos de: Crotalus durissus terrificus e Scorpaena plumieri

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Henrique Martins de

    2009-07-01

    The identification of new diagnostic and therapeutic agents capable of inhibiting tumor growth is essential for improving the prognosis of patients suffering from malignant tumors (glioma, breast and others). In this context, natural products (plants and animals) are a rich source of substances with potential antitumor. Despite knowledge of the etiology and pathology of tumors little progress has been observed in the area of diagnosis. Molecules of snake venoms have been shown to play an important role not only in the survival and proliferation of tumor cells but also in the process of tumor cell adhesion, migration and angiogenesis. Polypeptides isolated from the venom of the snake, Crotalus durissus terrificus, Crtx, and Scorpaena plumieri fish, SPGP, have antitumor activity against malignant tumors. It was shown that similar radio iodines Crtx and SPGP, {sup 125}I-Crtx and {sup 125}I-SPGP, can interact specifically with malignant tumors and induce cell death. Prototype-based radiopharmaceuticals Crtx and SPGP containing radioiodine 1311 were able to produce diagnostic images to accumulate specifically in the tumor site. The present study aimed at evaluating the potential radiological safety and diagnostic/therapeutic efficacy of {sup 131}I-Crtx {sup l31}I-SPGP and (evaluated from the biokinetic data in mice bearing Ehrlich tumor) were treated by the MIRD formalism to carry out internal dosimetry studies. Absorbed doses due to the uptake of {sup 131}I-Crtx and {sup 131}I-SPGP were determined in various organs of mice and implanted into the tumor. The results obtained for the animal model were extrapolated to humans by assuming a similar concentration ratio among the various tissues between mice and humans. In extrapolation, we used the masses of human organs of the phantom of Cristy/Eckerman. Both radiation penetrating and non penetrating of {sup 131}I on the tissue were considered in dose calculations. The absorbed dose in the bone marrow due to the

  15. Internal dosimetry of radiopharmaceuticals derived of antitumor polypeptide isolated from venoms: Crotalus durissus terrifucus and Scorpaena plumieri

    International Nuclear Information System (INIS)

    Andrade, Henrique Martins de

    2009-01-01

    The identification of new diagnostic and therapeutic agents capable of inhibiting tumor growth is essential for improving the prognosis of patients suffering from malignant tumors (glioma, breast and others). In this context, natural products (plants and animals) are a rich source of substances with potential antitumor. Despite knowledge of the etiology and pathology of tumors little progress has been observed in the area of diagnosis. Molecules of snake venoms have been shown to play an important role not only in the survival and proliferation of tumor cells but also in the process of tumor cell adhesion, migration and angiogenesis. Polypeptides isolated from the venom of the snake, Crotalus durissus terrificus, Crtx, and Scorpaena plumieri fish, SPGP, have antitumor activity against malignant tumors. It was shown that similar radio iodines Crtx and SPGP, 125 I-Crtx and 125 I-SPGP, can interact specifically with malignant tumors and induce cell death. Prototype-based radiopharmaceuticals Crtx and SPGP containing radioiodine 1311 were able to produce diagnostic images to accumulate specifically in the tumor site. The present study aimed at evaluating the potential radiological safety and diagnostic/therapeutic efficacy of 131 I-Crtx l31 I-SPGP and (evaluated from the biokinetic data in mice bearing Ehrlich tumor) were treated by the MIRD formalism to carry out internal dosimetry studies. Absorbed doses due to the uptake of 131 I-Crtx and 131 I-SPGP were determined in various organs of mice and implanted into the tumor. The results obtained for the animal model were extrapolated to humans by assuming a similar concentration ratio among the various tissues between mice and humans. In extrapolation, we used the masses of human organs of the phantom of Cristy/Eckerman. Both radiation penetrating and non penetrating of 131 I on the tissue were considered in dose calculations. The absorbed dose in the bone marrow due to the administration of 131 I-Crtx was 0.01 mGy/370

  16. Avaliação da interação de compostos ativos hidratantes com modelo de biomembrana de Crotalus durissus por meio de calorimetria exploratória diferencial e espectroscopia RAMAN

    Directory of Open Access Journals (Sweden)

    MICHELE TAKAOKA

    2010-06-01

    Full Text Available O objetivo foi verificar as alterações no estrato córneo em modelos alternativos de membrana após a aplicação de ativos hidratantes envolvendo métodos biofísicos. O modelo de biomembrana utilizado foi a muda de pele de Crotalus durissus e os ativos hidratantes foram: uréia, silício orgânico, extrato vegetal de Imperata cylindrica, reação de xilitol e glicose e componentes de NMF. Os resultados da avaliação das alterações do modelo por meio de Espectroscopia Raman com Transformada de Fourier sugerem que os ativos hidratantes confirmam segurança necessária, pois não alteraram de forma acentuada a estrutura do estrato córneo. Utilizando-se Calorimetria Exploratória Diferencial pode-se indicar que a solução de silício orgânico e o gel hidrofílico com uréia apresentaram melhor poder hidratante. Palavras-chave: Estrato córneo. Hidratação. Métodos biofísicos. Crotalus durissus. FT-Raman, DSC. ABSTRACT Study of the interaction of moisturizers with a Crotalus durissus biomembrane by differential scanning calorimetry and RAMAN spectroscopy The objective of this research was to use biophysical techniques to investigate the alterations induced in a biomembrane model of the stratum corneum by the application of moisturizers. The biomembrane was obtained from the skin shed by the rattlesnake Crotalus durissus and the active moisturizing compounds were: urea, dimethylsilanol hyaluronate, Imperata cylindrical plant extract, carbohydrates and natural moisturizing factors (NMF components. Results from FT-Raman spectroscopy suggested that the moisturizers were safe, since they did not promote modifications in the structure of the stratum corneum. Differential scanning calorimetry results indicated that the solution containing the organic silicon compound and the gel with urea showed the best hydrating effects on the stratum corneum. Keywords: Stratum corneum. Hydration. Biophysical techniques. Crotalus durissus

  17. Pulmonary, microbiological and hematological changes in Crotalus durissus terrificus (Serpentes, Viperidae parasitized by nematodes of the genus Rhabdias (Nematoda, Rhabdiasidae Alterações Pulmonares, microbiológicas e hematológicas em Crotalus durissus terrificus (Serpentes, Viperidae parasitadas pelos nematódeos do gênero Rhabdias (Nematoda, Rhabdiasidae

    Directory of Open Access Journals (Sweden)

    K.R. Santos

    2008-06-01

    Full Text Available This study reported the pulmonary, microbiological, and hematological alterations in Crotalus durissus terrificus parasitized by nematodes of the genus Rhabdias. Histological, microbiological, and hematological analysis were performed on parasitized (n=6 and non-parasitized (n=6 snakes. Granulocytic and mononuclear cell infiltrates in the pulmonary parenchyma and epithelium were also observed during the histological analysis of parasitized snakes. Microbiological analysis of parasitized animals revealed the following Gram-negative bacteria: Citrobacter divergens, Burkholderia cepacia, Stenotrophomonas maltophilia, Proteus vulgaris, Enterobacter sakazakii, Enterobacter ammnigenus, Pseudomonas aeruginosa, Pantoea sp. and Providencia rettgeri. In non-parasitized snakes, the following species were identified: B. cepacia, Pseudomonas fluorescens, and Acinetobacter baumanii. Increased levels of plasmatic protein, decreased lymphocyte counts, and normal red blood cell values were observed in parasitized animals.Este trabalho relata as alterações pulmonares, microbiológicas e hematológicas em Crotalus durissus terrificus parasitadas pelo nematódeo do gênero Rhabdias. As análises histológicas, microbiológicas e hematológicas foram realizadas em serpentes parasitadas (n=6 e não parasitadas (n=6. Foram observados infiltrados de células granulocíticas e mononucleares no parênquima pulmonar durante a análise histopatológica das serpentes parasitadas. A análise microbiológica revelou as seguintes bactérias Gram-negativas; Citrobacter divergens, Burkholderia cepacia, Stenotrophomonas maltophilia, Proteus vulgaris, Enterobacter sakazakii, Enterobacter ammnigenus, Pseudomonas aeruginosa, Pantoea sp. e Providencia rettgeri. Nas serpentes não parasitadas foram identificadas: B. cepacia, Pseudomonas fluorescens e Acinetobacter baumanii. Nos animais parasitados observaram-se: aumento da concentração de proteína plasmática, diminuição da

  18. Humoral response and neutralization capacity of sheep serum inoculated with natural and Cobalt 60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    Energy Technology Data Exchange (ETDEWEB)

    Netto, D.P.; Alfieri, A.A. [Universidade Estadual de Londrina, PR (Brazil). Centro de Ciencias Agrarias, Dept. de Medicina Veterinaria Preventiva; Chiacchio, S.B.; Bicudo, P.L. [UNESP, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia; Nascimento, N. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Supervisao de Radiobiologia]. E-mail: rnetto@uel.br

    2002-07-01

    The aim of this work was to investigate antigen irradiation on crotalic antivenom and the capacity of sheep as serum producers. Twelve sheep in two groups of six were inoculated with Crotalus durissus terrificus venom. One group was inoculated with natural venom (N V) and the other with Cobalt 60 gamma-irradiated venom (Ir V). Three antigen doses were given to the animals at monthly intervals for immunization. The toxic activity of the venom was assessed by LD 50 determination in mice. Blood samples were collected weekly analyses of serum neutralization capacity and potency. At the end of the experiment, the animals were challenged with a LD 50 for sheep showed no signs of envenoming. These results showed that toxicity of the irradiated venom was 4.4 times less than the natural venom. The sera from the irradiated group neutralized LD 50 14.6 times, and the sera from the natural group 4.4 times. Sera from the irradiated group were five times more potent. The two groups did not present clinical alterations. The results of this study show the potential for using sheep in crotalic antivenom production. The use of irradiated venom in sheep immunization induces a powerful and lasting humoral immune response shown by both the in vitro neutralization and potency tests and by the indirect ELISA antibody level detection technique. (author)

  19. cDNA and deduced primary structure of basic phospholipase A2 with neurotoxic activity from the venom secretion of the Crotalus durissus collilineatus rattlesnake

    Directory of Open Access Journals (Sweden)

    F.H.R. Fagundes

    2010-03-01

    Full Text Available To illustrate the construction of precursor complementary DNAs, we isolated mRNAs from whole venom samples. After reverse transcription polymerase chain reaction (RT-PCR, we amplified the cDNA coding for a neurotoxic protein, phospholipase A2 D49 (PLA2 D49, from the venom of Crotalus durissus collilineatus (Cdc PLA2. The cDNA encoding Cdc PLA2 from whole venom was sequenced. The deduced amino acid sequence of this cDNA has high overall sequence identity with the group II PLA2 protein family. Cdc PLA2 has 14 cysteine residues capable of forming seven disulfide bonds that characterize this group of PLA2 enzymes. Cdc PLA2 was isolated using conventional Sephadex G75 column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC. The molecular mass was estimated using matrix-assisted laser desorption ionization-time-of-flight (MALDI-TOF mass spectrometry. We tested the neuromuscular blocking activities on chick biventer cervicis neuromuscular tissue. Phylogenetic analysis of Cdc PLA2 showed the existence of two lines of N6-PLA2, denominated F24 and S24. Apparently, the sequences of the New World’s N6-F24-PLA2 are similar to those of the agkistrodotoxin from the Asian genus Gloydius. The sequences of N6-S24-PLA2 are similar to the sequence of trimucrotoxin from the genus Protobothrops, found in the Old World.

  20. Phospholipase A2 isolated from the venom of Crotalus durissus terrificus inactivates dengue virus and other enveloped viruses by disrupting the viral envelope.

    Directory of Open Access Journals (Sweden)

    Vanessa Danielle Muller

    Full Text Available The Flaviviridae family includes several virus pathogens associated with human diseases worldwide. Within this family, Dengue virus is the most serious threat to public health, especially in tropical and sub-tropical regions of the world. Currently, there are no vaccines or specific antiviral drugs against Dengue virus or against most of the viruses of this family. Therefore, the development of vaccines and the discovery of therapeutic compounds against the medically most important flaviviruses remain a global public health priority. We previously showed that phospholipase A2 isolated from the venom of Crotalus durissus terrificus was able to inhibit Dengue virus and Yellow fever virus infection in Vero cells. Here, we present evidence that phospholipase A2 has a direct effect on Dengue virus particles, inducing a partial exposure of genomic RNA, which strongly suggests inhibition via the cleavage of glycerophospholipids at the virus lipid bilayer envelope. This cleavage might induce a disruption of the lipid bilayer that causes a destabilization of the E proteins on the virus surface, resulting in inactivation. We show by computational analysis that phospholipase A2 might gain access to the Dengue virus lipid bilayer through the pores found on each of the twenty 3-fold vertices of the E protein shell on the virus surface. In addition, phospholipase A2 is able to inactivate other enveloped viruses, highlighting its potential as a natural product lead for developing broad-spectrum antiviral drugs.

  1. Rabdomióilise secundária a acidente ofídico crotálico (Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    Renato Almeida Magalhães

    1986-08-01

    Full Text Available Relatam-se dois casos de rabdomiólise secundária a envenenamento produzido por Crotalus durissus terrificus. O diagnóstico da rabdomiólise baseou-se na mialgia intensa e generalizada apresentada pelos pacientes e na constatação de níveis séricos elevados de CPK, TGO e DHL. A confirmação do diagnóstico foi obtida no caso n.° 2 pela detecção de mioglobina no soro através de imunoeletroforese contra soro antimioglobina humana e por biópsia muscular. Esse paciente desenvolveu também, como complicação do envenenamento ofídico, quadro clínico e laboratorial de insuficiência renal aguda. Essa complicação foi atribuída à ação nefrotóxica e hemolítica do veneno crotálico e à hipotensão arterial apresentada pelo paciente, não se afastando a possibilidade de que a rabdomiólise tenha sido um fator contribuinte para a sua instalação. Foram constatadas hipocalcemla, hiperuricemia e hiperfosfatemia grave na fase oligúria da insuficiência renal aguda, alterações peculiares quando essa condição está associada à rabdomiólise.

  2. Humoral response and neutralization capacity of sheep serum inoculated with natural and Cobalt 60-irradiated Crotalus durissus terrificus venom (Laurenti, 1768)

    International Nuclear Information System (INIS)

    Netto, D.P.; Alfieri, A.A.; Chiacchio, S.B.; Bicudo, P.L.; Nascimento, N.

    2002-01-01

    The aim of this work was to investigate antigen irradiation on crotalic antivenom and the capacity of sheep as serum producers. Twelve sheep in two groups of six were inoculated with Crotalus durissus terrificus venom. One group was inoculated with natural venom (N V) and the other with Cobalt 60 gamma-irradiated venom (Ir V). Three antigen doses were given to the animals at monthly intervals for immunization. The toxic activity of the venom was assessed by LD 50 determination in mice. Blood samples were collected weekly analyses of serum neutralization capacity and potency. At the end of the experiment, the animals were challenged with a LD 50 for sheep showed no signs of envenoming. These results showed that toxicity of the irradiated venom was 4.4 times less than the natural venom. The sera from the irradiated group neutralized LD 50 14.6 times, and the sera from the natural group 4.4 times. Sera from the irradiated group were five times more potent. The two groups did not present clinical alterations. The results of this study show the potential for using sheep in crotalic antivenom production. The use of irradiated venom in sheep immunization induces a powerful and lasting humoral immune response shown by both the in vitro neutralization and potency tests and by the indirect ELISA antibody level detection technique. (author)

  3. Effect of Mikania glomerata (Asteraceae leaf extract combined with anti-venom serum on experimental Crotalus durissus (Squamata: Viperidae envenomation in rats

    Directory of Open Access Journals (Sweden)

    Rafael Stuani Floriano

    2009-12-01

    Full Text Available Crotalic envenomation represents the highest number of deaths when compared to other snakebite envenomations of medical interest. Crotalic venom has important characteristics such as neurotoxicity, myotoxicity, nephrotoxicity, and clotting and hemolytic action. We evaluated the clinical and laboratory aspects of Crotalus durissus terrificus experimental envenomation in Wistar rats treated with antivenom and the aqueous extract of the plant Mikania glomerata. The animals were divided into three groups: Group C (control; Group VS-venom and antivenom; Group VSM-venom, antivenom and aqueous extract of M. glomerata. Crotalic poison caused clinical and laboratory alterations in Wistar mice. Significant linical alterations were: temperature decrease, edema in the venom inoculated member, sedation and a locomotion decrease in groups VS and VSM when compared with group C. A faster recovery from sedation was observed only for animals of group VSM when compared to VS. There was an increase in the number of leukocytes, neutrophils and creatine kinase in the VS and VSM groups, compared to group C. Wistar rats showed a high resistance to crotalic venom. Additional studies with different doses, time of treatment, different administration methods and histopathological and immunological studies are necessary to understand the action of M. glomerata in crotalic accidents. Rev. Biol. Trop. 57 (4: 929-937. Epub 2009 December 01.El envenamiento crotálico representa el número más alto de muertes cuando es comparado con envenenamientos por mordeduras de otras serpientes de interés médico. El veneno crotálico tiene importantes características de acción neurotóxica, miotoxicidad, nefrotoxicidad, coagulación y acción hemolítica. Este trabajo evaluó los aspectos clínicos y de laboratorio del envenenamiento experimental con el veneno de la serpiente Crotalus durissus terrificus en las ratas Wistar tratadas con suero antiofídico y extracto acuoso de M

  4. Comparison of the effect of Crotalus simus and Crotalus durissus ruruima venoms on the equine antibody response towards Bothrops asper venom: implications for the production of polyspecific snake antivenoms.

    Science.gov (United States)

    Dos-Santos, Maria Cristina; Arroyo, Cynthia; Solano, Sergio; Herrera, María; Villalta, Mauren; Segura, Alvaro; Estrada, Ricardo; Gutiérrez, José María; León, Guillermo

    2011-02-01

    Antivenoms are preparations of immunoglobulins purified from the plasma of animals immunized with snake venoms. Depending on the number of venoms used during the immunization, antivenoms can be monospecific (if venom from a single species is used) or polyspecific (if venoms from several species are used). In turn, polyspecific antivenoms can be prepared by purifying antibodies from the plasma of animals immunized with a mixture of venoms, or by mixing antibodies purified from the plasma of animals immunized separately with single venom. The suitability of these strategies to produce polyspecific antibothropic-crotalic antivenoms was assessed using as models the venoms of Bothrops asper, Crotalus simus and Crotalus durissus ruruima. It was demonstrated that, when used as co-immunogen, C. simus and C. durissus ruruima venoms exert a deleterious effect on the antibody response towards different components of B. asper venom and in the neutralization of hemorrhagic and coagulant effect of this venom when compared with a monospecific B. asper antivenom. Polyspecific antivenoms produced by purifying immunoglobulins from the plasma of animals immunized with venom mixtures showed higher antibody titers and neutralizing capacity than those produced by mixing antibodies purified from the plasma of animals immunized separately with single venom. Thus, despite the deleterious effect of Crotalus sp venoms on the immune response against B. asper venom, the use of venom mixtures is more effective than the immunization with separate venoms for the preparation of polyspecific bothropic-crotalic antivenoms. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. Crotacetin, a novel snake venom C-type lectin, is homolog of convulxin

    Directory of Open Access Journals (Sweden)

    G. Rádis-Baptista

    2005-12-01

    Full Text Available Snake venom (sv C-type lectins encompass a group of hemorrhagic toxins, which are able to interfere with hemostasis. They share significant similarity in their primary structures with C-type lectins of other animals, and also present a conserved carbohydrate recognition domain (CRD. A very well studied sv C-type lectin is the heterodimeric toxin, convulxin (CVX, from the venoms of South American rattlesnakes, Crotalus durissus terrificus and C. d. cascavella. It consists of two subunits, alfa (CVXalpha , 13.9 kDa and beta (CVXbeta , 12.6 kDa, joined by inter and intra-chain disulfide bounds, and is arranged in a tetrameric alpha4beta4 conformation. Convulxin is able to activate platelet and induce their aggregation by acting via p62/GPVI collagen receptor. Several cDNA precursors, homolog of CVX subunits, were cloned by PCR homology screening. As determined by computational analysis, one of them, named crotacetin beta subunit, was predicted as a polypeptide with a tridimensional conformation very similar to other subunits of convulxin-like snake toxins. Crotacetin was purified from C. durissus venoms by gel permeation and reverse phase high performance liquid chromatography. The heterodimeric crotacetin is expressed in the venoms of several C. durissus subspecies, but it is prevalent in the venom of C. durissus cascavella. As inferred from homology modeling, crotacetin induces platelet aggregation but noticeably exhibits antimicrobial activity against Gram-positive and Gram-negative bacteria.

  6. Brazilian Library Literature

    Science.gov (United States)

    Leipziger, Fabia T.

    1976-01-01

    This comprehensive study of Brazilian library literature illuminates the important step towards a national plan through the creation in 1954 of the Brazilian Institute of Bibliography and Documentation with the support of UNESCO, the National Research Council, and other agencies. (Author)

  7. Brazilian Consensus on Photoprotection

    Science.gov (United States)

    Schalka, Sérgio; Steiner, Denise; Ravelli, Flávia Naranjo; Steiner, Tatiana; Terena, Aripuanã Cobério; Marçon, Carolina Reato; Ayres, Eloisa Leis; Addor, Flávia Alvim Sant'anna; Miot, Helio Amante; Ponzio, Humberto; Duarte, Ida; Neffá, Jane; da Cunha, José Antônio Jabur; Boza, Juliana Catucci; Samorano, Luciana de Paula; Corrêa, Marcelo de Paula; Maia, Marcus; Nasser, Nilton; Leite, Olga Maria Rodrigues Ribeiro; Lopes, Otávio Sergio; Oliveira, Pedro Dantas; Meyer, Renata Leal Bregunci; Cestari, Tânia; dos Reis, Vitor Manoel Silva; Rego, Vitória Regina Pedreira de Almeida

    2014-01-01

    Brazil is a country of continental dimensions with a large heterogeneity of climates and massive mixing of the population. Almost the entire national territory is located between the Equator and the Tropic of Capricorn, and the Earth axial tilt to the south certainly makes Brazil one of the countries of the world with greater extent of land in proximity to the sun. The Brazilian coastline, where most of its population lives, is more than 8,500 km long. Due to geographic characteristics and cultural trends, Brazilians are among the peoples with the highest annual exposure to the sun. Epidemiological data show a continuing increase in the incidence of non-melanoma and melanoma skin cancers. Photoprotection can be understood as a set of measures aimed at reducing sun exposure and at preventing the development of acute and chronic actinic damage. Due to the peculiarities of Brazilian territory and culture, it would not be advisable to replicate the concepts of photoprotection from other developed countries, places with completely different climates and populations. Thus the Brazilian Society of Dermatology has developed the Brazilian Consensus on Photoprotection, the first official document on photoprotection developed in Brazil for Brazilians, with recommendations on matters involving photoprotection. PMID:25761256

  8. Rabbit IgG antibodies against Phospholipase A2 from Crotalus durissus terrificus neutralize the lethal activity of the venom Los anticuerpos IgG de conejos anti-fosfolipasa A2 de Crotalus durissus terrificus neutralizan la actividad letal del veneno

    Directory of Open Access Journals (Sweden)

    Juan P. Rodríguez

    2006-12-01

    Full Text Available Crotalus durissus terrificus (C.d.t. (South American rattlesnake venom possesses myotoxic and neurotoxic activities, both of which are also expressed by crotoxin, the principal toxin of this venom. Crotoxin contains a basic phospholipase A2 (PLA2 and a non toxic acidic protein, crotapotin. We have produced and investigated the ability of IgG antibodies raised in rabbits against PLA2 to neutralize the lethality of the whole venom. PLA2 was isolated by gel filtration chromatography (Sephadex G-75. Specific antibodies were obtained by subcutaneous and intramuscular inoculation of PLA2 (700 µg with Freund adjuvant. Groups of six mice (20 + 2 g were inoculated with 0.5 ml i.p. of C. d. t. venom (4 µg or a mixture of venom that had been preincubated with the desired volume of IgG antibodies. Mortality, recorded 24 and 48 h after inoculation, showed that IgG anti-PLA2 were more effective than anticrotalic serum in neutralizing the lethal activity. These results demonstrate that it could be possible to obtain an anti-venom made by specific antibodies with a high level of protection against the lethal component of C.d.t. venom, and/or the inclusion of these antibodies as a supplement in heterologous anti-venoms.El veneno de Crotalus durissus terrificus (C.d.t. (Cascabel de Sud América posee actividad miotóxica y neurotóxica, actividades que también exhibe el complejo crotoxina, principal componente tóxico de este veneno. El complejo crotoxina está constituido por una fosfolipasa A2 básica (PLA2 y una proteína acídica no tóxica, el crotapotín. En este trabajo se estudió la capacidad neutralizante de anticuerpos IgG anti-PLA2 sobre la letalidad inducida por el veneno entero. El antígeno PLA2, fue aislado por cromatografía de filtración en gel (Sephadex G-75. Se inocularon conejos machos por vía subcutánea e intramuscular, con 700 µg de PLA2 y adyuvante para la obtención de anticuerpos específicos. La capacidad neutralizante del

  9. The comparison between the humoral response and the neutralizing capacity of sheep serum inoculated with natural venom and Co{sup 60} irradiated venom from Crotalus durissus terrificus (Laurenti, 1768)

    Energy Technology Data Exchange (ETDEWEB)

    Netto, D.P. [Universidade Estadual de Londrina, PR (Brazil). Centro de Ciencias Agrarias. Dept. de Medicina Veterinaria Preventiva]. E-mail: mnetto@uel.br

    2000-07-01

    Crotalus durissus terrificus venom was irradiated with Co{sup 60} to investigate the effects of antigen-irradiation on antivenom production in sheep. Twelve sheep were divided in two groups of 6. One group received irradiated, while the other received natural venom. Three doses of antigen were given at monthly intervals. The toxic activity of the venom was assessed by LD{sub 50} in mice. Weekly blood samples were obtained to evaluate anti-crotalic serum titers by indirect ELISA, neutralization capacity, and serum potency. A complete blood count, plasma protein and fibrinogen concentration, and serum albumin and globulin were also determined. At end of the experiment, the animals were challenged with ovine LD{sub 50}, without clinical abnormalities. (author)

  10. Quadros clínico-patológicos do envenenamento ofídico por Crotalus durissus terrificus e Bothrops spp. em animais de produção

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    2014-04-01

    Full Text Available Foi realizada uma revisão dos quadros clínico-patológicos causados pelos venenos de Crotalus durissus terrificus e Bothrops spp. em bovinos, búfalos, ovinos equinos e suínos. Foram compilados os dados obtidos pela experimentação em animais de produção encontrados na literatura e os obtidos através de experimentação realizada por nossa equipe. Também foram revisados os casos naturais de envenenamento ofídico comunicados. Em dois Quadros foram lançados os mais importantes dados dessas revisões, que revelou diversos aspectos interessantes: 1 em nossos experimentos, o veneno de Crotalus durissus terrificus, quando injetado por via subcutânea em cavalos, causou um edema acentuado no local da aplicação, ao contrário do que tem sido observado em todas as outras espécies animais, aspecto não relatado na literatura; 2 em nossos experimentos, o veneno de diversas espécies de Bothrops, quando injetado por via subcutânea em bovinos, ovinos e equinos, não causou edema como em geral é relatado na literatura, e sim hemorragias subcutâneas acentuadas no local da aplicação. Nos casos não fatais este sangue era reabsorvido em poucos dias sem deixar sequelas. Exceção foi a reação ao veneno de Bothrops jararacussu, que causou edema nos ovinos experimentais, e tumefação acentuada que resultou em fístula com eliminação de líquido seroso nos equinos experimentais. O objetivo do presente estudo visa contribuir para o aperfeiçoamento do diagnóstico de acidentes ofídicos em animais de produção.

  11. Indigenous Brazilian Management Practices

    Directory of Open Access Journals (Sweden)

    Zandra Balbinot

    2012-12-01

    Full Text Available The present research seeks to understand to what extent companies in emerging countries, specifically, Brazilian, adopt dominant management practices, the so-called Euro-American practices, possess their one, or show a syncretism between the two. Methods: Mixed research. One phase was to collect data using a survey about cultural dimensions adopted from GLOBE (House 1998 management practices and also from Brazilian academy. Another was to collect data through interviews, which were analyzed in parallel. Results: Of the seven dominant cultural dimensions, indigenous practices influenced two. Another three were influenced by dominant management practices. Two of the local dimensions, even with internationalization, merged practices with Brazilian cultural traits. Even so, the practices derived from Jeitinho diminished relative to the international relations and experience of managers. Conclusions: The paper shows the existence of powerful Brazilian Indigenous Managerial Practices such as personalism and formalism. These practices have great influence on international business negotiations. On the other hand, it also shows that there are still dominant managerial practices specially in the case of more internationalized Brazilian managers

  12. The Brazilian Nuclear Energy Program

    International Nuclear Information System (INIS)

    Carvalho, H.G. de

    1980-01-01

    A survey is initially of the international-and national situation regarding energetic resources. The Brazilian Nuclear Energy Policy and the Brazilian Nuclear Program are dealt with, as well as the Nuclear Cooperation agreement signed with the Federal Republic of Germany. The situation of Brazil regarding Uranium and the main activities of the Brazilian Nuclear Energy Commission are also discussed [pt

  13. Brazilian laboratory indicators program.

    Science.gov (United States)

    Shcolnik, Wilson; de Oliveira, Carla Albuquerque; de São José, Adriana Sá; de Oliveira Galoro, César Alex; Plebani, Mario; Burnett, David

    2012-11-01

    This paper describes the evolution, structure, operation and some outcomes of the Brazilian Laboratory Indicators Program created by the Brazilian Society of Clinical Pathology/Laboratory Medicine (Sociedade Brasileira de Patologia Clínica/Medicina Laboratorial, or SBPC/ML), in partnership with ControlLab, a Brazilian Company that provides services for proficiency testing, internal control, calibration, and training indicators for clinical laboratories. This web-based program is confidential for all participants. It contains 61 indicators categorized into three groups. Program operation and data analysis methods are described and indicators are reported in box plot format, with grouping varying in accordance with the profiles of the participating laboratories. Three indicators were selected as examples of program effectiveness in 2011: hemolysis, blood re-collection and productivity. Participants profile, examples of three indicators for the year 2011 (hemolysis, blood re-collection and productivity) and exploratory research conducted in 2012 on the implementation of the program are presented. Data related to laboratories participating in the program from 2006 to 2011 were collected and graphically represented. The Brazilian Laboratory Indicators Program brings important benefits for participants, contributing to the improvement of existing health systems in Brazil.

  14. A Brazilian Oz?

    Science.gov (United States)

    Aiex, Nola Kortner

    Both the American author, L. Frank Baum, and his Brazilian counterpart, Jose Monteiro Lobato, created children's books that featured alternative worlds, peopled by characters who fascinated many generations of young readers. The authors were both born in the second half of the nineteenth century into families of privilege, and both enjoyed idyllic…

  15. Brazilian women in politics.

    Science.gov (United States)

    Sanders, T G

    1987-01-01

    Women are gradually gaining influence in Brazilian politics, especially since recent advances in the women's movement, but they still play a limited role. There have been journals devoted to feminism and some notable feminists since 1850. In 1932 suffragettes in Brazil gained women the right to vote. Women's associations burgeoned in the 1940s and 1950s, culminating in a peak in number of women in national elected positions in 1965. A repressive military regime reversed the process, which resumed in 1975. 1975 was also significant for the Brazilian women's movement because of the U.N. Women's Year. Several large, influential feminist political action groups were formed, typically by upper class women with leftist views, although some church and union groups from lower classes also appeared. In 1979-1981, the coherence of these groups fell into schism and fragmentation, because of disagreements over the feminist political doctrines and roles, views on legality of abortion, and special interest groups such as lesbians. Another bitter dispute is opposition by leftist women to BEMFAM, the Brazilian Society of Family Welfare, which provides family planning for the poor: leftists oppose BEMFAM because it is supported by funds from "imperialist" countries such as the U.S. There are several types of feminists groups: those that emphasize health, sexuality and violence; those composed of lesbians; those originating from lower classes and unions; publicly instituted organizations. Brazilian law forbids discrimination against women holding public office, but in reality very few women actually do hold office, except for mayors of small towns and a few administrators of the Education and Social Security ministries. Political office in Brazil is gained by clientism, and since women rarely hold powerful positions in business, they are outsiders of the system. Brazilian women have achieved much, considering the low female literacy rate and traditional power system, but their

  16. Isolation, characterization and screening of the in vitro cytotoxic activity of a novel L-amino acid oxidase (LAAOcdt) from Crotalus durissus terrificus venom on human cancer cell lines.

    Science.gov (United States)

    Teixeira, Tuila Leveghim; Oliveira Silva, Viviane Aline; da Cunha, Daniel Batista; Polettini, Flávia Lino; Thomaz, Camila Daniele; Pianca, Ariana Aparecida; Zambom, Fabiana Letícia; da Silva Leitão Mazzi, Denise Pimenta; Reis, Rui Manuel; Mazzi, Maurício Ventura

    2016-09-01

    An L-amino acid oxidase (LAAOcdt) from Crotalus durissus terrificus venom was purified to homogeneity in a two-step procedure using molecular exclusion on Sephadex G-75, followed by Phenyl Sepharose FF chromatography. The molecular mass of the purified enzyme was 113 kDa, as determined by SDS-PAGE under reducing conditions. LAAOcdt showed amino acid homology to other L-amino acid oxidases isolated from different snake venoms. The comparative analysis of the internal peptide sequences of the NNPGILEYPVKPSEEGK fragments by LC-MS/MS spectrometry revealed 100% identity with C. durissus cumanensis LAAO. The purified protein catalyzed the oxidative deamination of L-amino acids, and the most specific substrates were L-Tyr and L-Phe. The enzyme presented optimum activity at pH 7.4 and at 44 °C. LAAOcdt also showed hemolytic activity (0.6-20 μg/μL) and induced both the formation plasma clots (5-100 μg/μL) and platelet aggregation (2.5 × 10(-3), 5.0 × 10(-3) and 10 × 10(-3) μg/mL), as well as bactericidal activity (2.5-10 μg/μL) against Staphylococcus aureus. Moreover, LAAOcdt exhibited cytotoxicity in distinct cancer cell lines, which presented a heterogeneous response profile. The mean IC50 value was 10.5 μg/mL. Glioma and pancreatic carcinoma cells were the most sensitive cell lines; they showed mean IC50 values of 7.2 μg/mL and 7.4 μg/mL, respectively. The exposure of the drug-sensitive cells to LAAOcdt for 24 h upregulated activated p-H2AX and efficiently decreased P42/P44 (ERK) activation in glioma cells (HCB151), which suggested an anti-proliferative effect. In addition, increased p21 expression was observed in SiHa cells, which showed a resistant phenotype. On the other hand, the flow cytometry and immunoblotting analyses showed that the enzyme did not induce cancer cell apoptosis. These results suggest that another cell death mechanism might contribute to the LAAOcdt-induced cytotoxicity. Taken together, this work may help to elucidate

  17. Brazilian Trichoptera Checklist II

    Science.gov (United States)

    2014-01-01

    Abstract A second assessment of Brazilian Trichoptera species records is presented here. A total of 625 species were recorded for Brazil. This represents an increase of 65.34% new species recorded during the last decade. The Hydropsychidae (124 spp.), followed by the Hydroptilidae (102 spp.) and Polycentropodidae (97 spp.), are the families with the greatest richness recorded for Brazil. The knowledge on Trichoptera biodiversity in Brazil is geographically unequal. The majority of the species is recorded for the southeastern region. PMID:25349524

  18. Brazilian Scientific Policy

    International Nuclear Information System (INIS)

    Voi, Dante Luiz; Borges, Jose Carlos

    1996-01-01

    This work aimed to make an analysis of the Brazilian Scientific Policy, considering its multi ways of approaching, and was settled on several author's points of view, working on different scientific areas. The world scientific development panorama and its influence on science made in Brazil, including problems, conditions and consequences, are presented in an historical sequence. Central and peripherical (dependent) capitalist nations are defined and identified, and influences on the scientific, economical, political and cultural developments of the peripherical are remarked. (author)

  19. Brazilian news portals characteristics

    Directory of Open Access Journals (Sweden)

    Heloiza G. Herckovitz

    2009-06-01

    Full Text Available A content analysis of four Brazilian news media portals found that economic news dominated the top headlines with little attention paid to education, the environment and welfare. Other trends included a focus on local events and national news sources, reliance on few sources, mostly official ones, and a low percentage of news that fitted the concept of newsworthiness (a combination of both social significance and deviance concepts. Other findings of a study of 432 top news stories published by UOL, Estadão, iG and Terra during a 15-day period between February and March 2008 indicate that the top portions of the portals’ front pages carry news that lacks story depth, editorial branding, and multimedia applications. The results suggest that online news portals are in their infancy although Brazil has the largest online population of Latin America. This study hopes to shed light on the gatekeeping process in Brazilian news portals. Brazilian media portals have yet to become a significant editorial force able to provide knowledge about social issues and public affairs in a socially responsible fashione.

  20. BRAZILIAN NEWS PORTALS CHARACTERISTICS

    Directory of Open Access Journals (Sweden)

    Heloiza G. Herckovitz

    2011-02-01

    Full Text Available A content analysis of four Brazilian news media portals found that economic news dominated the top headlines with little attention paid to education, the environment and welfare. Other trends included a focus on local events and national news sources, reliance on few sources, mostly official ones, and a low percentage of news that fitted the concept of newsworthiness (a combination of both social significance and deviance concepts. Other findings of a study of 432 top news stories published by UOL, Estadão, iG and Terra during a 15-day period between February and March 2008 indicate that the top portions of the portals’ front pages carry news that lacks story depth, editorial branding, and multimedia applications. The results suggest that online news portals are in their infancy although Brazil has the largest online population of Latin America. This study hopes to shed light on the gatekeeping process in Brazilian news portals. Brazilian media portals have yet to become a significant editorial force able to provide knowledge about social issues and public affairs in a socially responsible fashione.

  1. Contribuição à biologia de serpentes da Bahia, Brasil: I. vivíparas Contribution to reproductive biology of snakes in Bahia, Brazil: I. viviparous

    Directory of Open Access Journals (Sweden)

    Rejane Maria Lira-da-Silva

    1994-01-01

    Full Text Available Great part of lhe avaiable data about snakes reprodution refers to species coming from subtropical and temperate regions. In Brazil, the data is rather rare and can be found in various works where information is restricted. Results from studies developed with five viviparous snakes - Crotalus durissus cascavella (Wagler, 1824. Bothrops erythromelas(Amaral, 1923, B. leucurus (Wagler, 1824, Helicops leopardinus (Schlegel, 1873 and Thamnodynastes strigilis (Thiinberg, 1787 - which come from the Northeast of Brazil (Bahia are described. Data about pregnancy and birth, number, sex ratio, length and weight of neonates is given and discussed.

  2. Estabilidad de la actividad neutralizante del antiveneno ofídico conservado a 4°C y a 16°C contra el veneno de Cascabel (Crotalus durissus cumanensis de Colombia

    Directory of Open Access Journals (Sweden)

    Jaime Ramírez

    1995-12-01

    Full Text Available Se determinó la actividad neutralizante de la letalidad de varios lotes de antiveneno polivalente (no liofilizado, producidos por el Instituto Nacional de Salud, los cuales fueron retados contra una mezcla de venenos de cascabel (Crotalus durissus cumanensis de Colombia. Se compara la actividad de los diferentes lotes almacenados en oscuridad a las temperaturas de 4°C y 16°C. Se estableció el porcentaje remanente de la potencia de cada lote para cada temperatura en los diferentes años a lo largo del período del estudio. Se concluye que el antiveneno almacenando en las condiciones recomendadas, mantiene casi la totalidad de la capacidad de neutralización (97.9% luego de tres años de almacenamiento, lo quecorresponde a lafechade expiración del producto. En cambio, el antiveneno almacenado a 16°C y oscuridad, luego de dos años de almacenamiento, mantiene el 87.9% de su capacidad protectora contra veneno de cascabel, protección similara la encontrada bajo las mismas condiciones de almacenamiento, paraveneno de Taya X, pasados dos años de almacenamiento (l, sustentando la recomendación de descartar el producto, transcurridos dos años de almacenamiento en estas condiciones.

  3. Brazilian Portuguese Ethnonymy and Europeanisms.

    Science.gov (United States)

    Stephens, Thomas M.

    1994-01-01

    Delineates the incorporation and analyzes the impact of European borrowings in Brazilian racio-ethnic terminology. This overview covers French, Italian, Spanish, and English influences. Borrowings from European languages have had a small impact on the calculus of Brazilian racio-ethnic terms. (43 references) (Author/CK)

  4. Managing migration: the Brazilian case

    OpenAIRE

    Eduardo L. G. Rios-Neto

    2005-01-01

    The objective of this paper is to present the Brazilian migration experience and its relationship with migration management. The article is divided into three parts. First, it reviews some basic facts regarding Brazilian immigration and emigration processes. Second, it focuses on some policy and legal issues related to migration. Finally, it addresses five issues regarding migration management in Brazil.

  5. Radioprotection in Brazilian universities

    International Nuclear Information System (INIS)

    Caballero, K.C.; Borges, J.C.

    1992-01-01

    The purpose of this work was to obtain a broad knowledge of the circumstances under which activities involving ionizing radiations are held at brazilian academic institutions. Around 90 institutions (universities and isolated schools of both public and private sectors) were invited, by mail, to answer an inquiry with questions from technical to legal aspects of their activities with radiations. Information received from 2/3 of institutions contacted, permitted conclusions as: there is a wide ignorance about radioprotection procedures and legislation, although few universities maintain some efficient radioprotection staff; there is a need for the establishment of a standard radioprotection text dedicated to those specific activities of the sector. (author)

  6. Brazilian energy overview

    International Nuclear Information System (INIS)

    Souza, J.A.M. de.

    1975-01-01

    The Brazilian energy overview compared with the rest of the world is presented, as well as the current situation and prospects for the future. In a first part, the evalution from the past through the present time is considered, and in a second part, attention is given on the future prospects for Brazil and the different countries in connection with the energy field. It is expected that the current per capita energy consumption in Brazil, in all of its various forms, now totalling 6 million kcal/inh, will reach at least 22 million kcal/inh toward the end of this century

  7. The Brazilian Bolsa Escola

    Directory of Open Access Journals (Sweden)

    Rachel Cassidy

    2008-12-01

    Full Text Available The Bolsa Escola (‘school stipend’ and its successor the Bolsa Familia (‘family stipend’ schemes have formed a crucial and successful part of Brazil’s welfare program. Bolsa Escola provided aid to Brazil’s poorest families on the condition that their children attended school, and Bolsa Familia has extended this idea, giving aid on the condition that children both attend school and receive vaccinations. Bolsa Familia is currently the largest Conditional Cash Transfer Program (CCTP in the world, costing roughly 0.5% of Brazilian GDP and helping around 11.2 million families (around 44 million Brazilians, constituting roughly one fifth of the population. Multilateral institutions have praised the schemes, and they are setting a leading example to other developing nations. In 2005, Paul Wolfowitz (former president of the World Bank said, ‘Bolsa Familia has already become a highly praised model of effective social policy. Countries around the world are drawing lessons from Brazil’s experience and are trying to produce the same results for their own people’.

  8. Brazilian Nanotechnology Initiative

    Science.gov (United States)

    Fazzio, Adalberto

    2015-03-01

    In Brazil there is intense research activity in nanotechnology, most of these developed in universities and research institutes. The Brazilian Nanotechnology Initiative (BNI) aims to integrate government actions to promote the competitiveness of the Brazilian industry. This initiative is founded on support for research and development in the laboratories of the National Laboratories for Nanotechnology (SisNANO), starting from an improvement in infrastructure and opening of laboratories for users of academia and business, promoting interaction and transfer knowledge between academia and business. Country currently has 26 thematic networks of nanotechnology, 16 -Virtual-National Institutes of Technology, seven National- Laboratories and 18 Associate Laboratories, which comprise the SisNANO. Seeking to expand and share governance with other government actors, the Interministries Committee for Nanotechnology was set up, composed of 10 ministries, and has the task of coordinating the entire program of the Federal Government Nanotechnology.Cooperation activities are an important part of BNI. Currently Brazil has cooperation programs with U.S., China, Canada and European Union among others. Recently, Brazil decided to join the European NanoReg program where 60 research groups are joining efforts to provide protocols and standards that can help regulatory agencies and governments.

  9. Pharmacogenetics in the Brazilian population

    Directory of Open Access Journals (Sweden)

    Guilherme eSuarez-Kurtz

    2010-10-01

    Full Text Available Brazil is the 5th largest country in the world and its present population, in excess of 190 million, is highly heterogeneous, as a result of centuries of admixture between Amerindians, Europeans and Sub-Saharan Africans. The estimated individual proportions of biogeographical ancestry vary widely and continuously among Brazilians, most individuals - irrespective of self-identification as White, Brown or Black, the major categories of the Brazilian Census race/color system - having significant degrees of European and African ancestry, while a sizeable number display also Amerindian ancestry. These features have important pharmacogenetic (PGx implications: first, extrapolation of PGx data from relatively well-defined ethnic groups is clearly not applicable to the majority of Brazilians; second, the frequency distribution of polymorphisms in pharmacogenes (e.g. CYP3A5, CYP2C9, GSTM1, ABCB1, GSTM3, VKORC, etc varies continuously among Brazilians and is not captured by race/color self-identification; third, the intrinsic heterogeneity of the Brazilian population must be acknowledged in the design and interpretation of PGx studies in order to avoid spurious conclusions based on improper matching of study cohorts. The peculiarities of PGx in Brazilians are illustrated with data for different therapeutic groups, such as anticoagulants, HIV-protease inhibitors and nonsteroidal antinflammatory drugs, and the challenges and advantages created by population admixture for the study and implementation of PGx are discussed. PGx data for Amerindian groups and Brazilian-born, first generation Japanese are presented to illustrate the rich diversity of the Brazilian population. Finally, I introduce the reader to the Brazilian Pharmacogenetic Network or Refargen (www.refargen.org.br, a nationwide consortium of research groups, with the mission to provide leadership in PGx research and education in Brazil, with a population health impact.

  10. Pharmacogenetics in the brazilian population.

    Science.gov (United States)

    Suarez-Kurtz, Guilherme

    2010-01-01

    Brazil is the fifth largest country in the world and its present population, in excess of 190;million, is highly heterogeneous, as a result of centuries of admixture between Amerindians, Europeans, and Sub-Saharan Africans. The estimated individual proportions of biogeographical ancestry vary widely and continuously among Brazilians: most individuals, irrespective of self-identification as White, Brown or Black - the major categories of the Brazilian Census "race/color" system - have significant degrees of European and African ancestry, while a sizeable number display also Amerindian ancestry. These features have important pharmacogenetic (PGx) implications: first, extrapolation of PGx data from relatively well-defined ethnic groups is clearly not applicable to the majority of Brazilians; second, the frequency distribution of polymorphisms in pharmacogenes (e.g., CYP3A5, CYP2C9, GSTM1, ABCB1, GSTM3, VKORC, etc) varies continuously among Brazilians and is not captured by race/color self-identification; third, the intrinsic heterogeneity of the Brazilian population must be acknowledged in the design and interpretation of PGx studies in order to avoid spurious conclusions based on improper matching of study cohorts. The peculiarities of PGx in Brazilians are illustrated with data for different therapeutic groups, such as anticoagulants, HIV protease inhibitors and non-steroidal antinflammatory drugs, and the challenges and advantages created by population admixture for the study and implementation of PGx are discussed. PGx data for Amerindian groups and Brazilian-born, first-generation Japanese are presented to illustrate the rich diversity of the Brazilian population. Finally, I introduce the reader to the Brazilian Pharmacogenetic Network or Refargen, a nation-wide consortium of research groups, with the mission to provide leadership in PGx research and education in Brazil, with a population health impact.

  11. The rise of Brazilian agriculture

    DEFF Research Database (Denmark)

    Jensen, Hans Grinsted; Vink, Nick; Sandrey, Ron

    2014-01-01

    The purpose of this article is to explore some of the possible lessons for South African agriculture from the Brazilian experience. To this end, the article discusses the performance of Brazilian agriculture in terms of land and labour use, production, and exports. This is followed by aspects...... of Brazilian agricultural policies, namely farmer support, the research and technology transfer system and land issues. The implications for South African agriculture can be summarized as the recognition that history, geography, the development path and agricultural policies all matter. The article...... then identifies five important lessons for agricultural development in South Africa....

  12. Brazilian readers and contextual reference Brazilian readers and contextual reference

    Directory of Open Access Journals (Sweden)

    Lilia M. O. Carioni

    2008-04-01

    Full Text Available This article describes an experiment carried out using Brazilian university students at UFSC, the purpose being to check comprehension relationships between two types of contextual reference and two languages, Portuguese and English. A major stimulus for the research was the question: are Brazilian students' difficulties in reading English related more to English language difficulties or to difficulties in processing text in general?

  13. The Brazilian mineral resources

    Science.gov (United States)

    Beurlen, Hartmut; Cassedanne, Jacques Pierre

    1981-04-01

    The activity of the first generation of Brazilian geologists began in the early sixties. Systematic exploration work since then has evidenced some important new mineral reserves in Brazil. The most important examples are the 18 × 10 9 tons of high-grade iron ore (Carajás District), formed by supergene enrichment on iron formations older than 1800 m.y., the 2.5 × 10 9 tons of bauxite and similar reserves of kaolinite as residual enrichment in Cenozoic sediments in the Amazonas Basin (Oriximina, Capim); the potash and magnesium-rich evaporites near Aracajú(Sergipe); the large residual concentrations of phosphate, anatase, pyrochlore and rare earths related to Cretaceous alkaline complexes with carbonatites; and some garnierite and asbestos deposits related to ultramafic rocks in the states of Goiás and Piauí.

  14. Secretory phospholipases A(2) isolated from Bothrops asper and from Crotalus durissus terrificus snake venoms induce distinct mechanisms for biosynthesis of prostaglandins E2 and D2 and expression of cyclooxygenases.

    Science.gov (United States)

    Moreira, Vanessa; Gutiérrez, José Maria; Soares, Andreimar Martins; Zamunér, Stella Regina; Purgatto, Eduardo; Teixeira, Catarina de Fátima Pereira

    2008-09-01

    The effects of myotoxin III (MT-III), a phospholipase A(2) (sPLA2) from Bothrops asper snake venom, and crotoxin B (CB), a neurotoxic and myotoxic sPLA2 from the venom of Crotalus durissus terrificus, on cyclooxygenases (COXs) expression and biosynthesis of prostaglandins (PGs) were evaluated, together with the mechanisms involved in these effects. Upon intraperitoneal injection in mice, both sPLA(2)s promoted the synthesis of PGD2 and PGE2, with a different time-course. MT-III, but not CB, induced COX-2 expression by peritoneal leukocytes without modification on COX-1 constitutive expression, whereas CB increased the constitutive activity of COX-1. MT-III increased the enzymatic activity of COX-1 and COX-2. Similar effects were observed when these sPLA(2)s were incubated with isolated macrophages, evidencing a direct effect on these inflammatory cells. Moreover, both toxins elicited the release of arachidonic acid from macrophages in vitro. Inhibition of cPLA2 by AACOCF3, but not of iPLA2 by PACOCF3 or BEL, significantly reduced PGD2, PGE2 and arachidonic acid (AA) release promoted by MT-III. These inhibitors did not affect MT-III-induced COX-2 expression. In contrast, cPLA2 inhibition did not modify the effects of CB, whereas iPLA2 inhibition reduced PGD2 and AA production induced by CB. These findings imply that distinct regulatory mechanisms leading to PGs' synthesis are triggered by these snake venom sPLA(2)s. Such differences are likely to explain the dissimilar patterns of inflammatory reaction elicited by these sPLA(2)s in vivo.

  15. Comparison of humoral immune response, neutralization capacity of anticrotalic serum in young ovines, clinical and weight evaluation between animals inoculated with Crotalus durissus terrificus venom, natural or Cobalt-60-irradiated

    International Nuclear Information System (INIS)

    Ferreira Junior, R.S.

    2005-01-01

    The Elisa technique was used to evaluate and compare the humoral immune response of young ovine to anticrotalic serum production. During serum production, the clinical and weight evaluation of the animals was performed. The parameters utilized were complete blood count, and dosage of urea, creatinine, aspartate aminotransferase, total proteins, albumin and globulin. The animals weight was verified fortnightly during the experiment. The neutralization capacity of the serum produced from the snake Crotalus durissus terrificus natural (NV) and Cobalt-60-irradiated venom (IrV) was evaluated by in vitro challenges. One group of six animals received natural venom, the second group received irradiated venom, and the third was the control group. The animals received six immunizations during 84 days with an interval of 14 days. There was a significant difference (p<5%) in the ELISA test for the profile of the antibodies produced by the experimental groups (NV< IrV). There was no significant difference (p<5%) for biochemical tests, complete blood count, and animals weight between the three groups tested. The group immunized with irradiated venom showed antibodies profile higher than the group immunized with natural venom. The neutralization capacity of the serum produced from the IrV was fivefold higher when compared to the serum produced with NV. The clinical and weight evaluation showed that the o vines in post-weaning phase did not have their physiological profiles altered, and showed an excellent increase in weight during the experimental period. These results indicate a new perspective for the utilization of o vines, aiming the commercial production of anticrotalic serum, which may be applied in the treatment of human and animal envenomation. The cost for its production may be reduced by the posterior utilization of hyperimmunized ovine in human feeding. (author)

  16. Neuromuscular paralysis by the basic phospholipase A2 subunit of crotoxin from Crotalus durissus terrificus snake venom needs its acid chaperone to concurrently inhibit acetylcholine release and produce muscle blockage.

    Science.gov (United States)

    Cavalcante, Walter L G; Noronha-Matos, José B; Timóteo, Maria A; Fontes, Marcos R M; Gallacci, Márcia; Correia-de-Sá, Paulo

    2017-11-01

    Crotoxin (CTX), a heterodimeric phospholipase A 2 (PLA 2 ) neurotoxin from Crotalus durissus terrificus snake venom, promotes irreversible blockade of neuromuscular transmission. Indirect electrophysiological evidence suggests that CTX exerts a primary inhibitory action on transmitter exocytosis, yet contribution of a postsynaptic action of the toxin resulting from nicotinic receptor desensitization cannot be excluded. Here, we examined the blocking effect of CTX on nerve-evoked transmitter release measured directly using radioisotope neurochemistry and video microscopy with the FM4-64 fluorescent dye. Experiments were conducted using mice phrenic-diaphragm preparations. Real-time fluorescence video microscopy and liquid scintillation spectrometry techniques were used to detect transmitter exocytosis and nerve-evoked [ 3 H]-acetylcholine ([ 3 H]ACh) release, respectively. Nerve-evoked myographic recordings were also carried out for comparison purposes. Both CTX (5μg/mL) and its basic PLA 2 subunit (CB, 20μg/mL) had biphasic effects on nerve-evoked transmitter exocytosis characterized by a transient initial facilitation followed by a sustained decay. CTX and CB reduced nerve-evoked [ 3 H]ACh release by 60% and 69%, respectively, but only the heterodimer, CTX, decreased the amplitude of nerve-evoked muscle twitches. Data show that CTX exerts a presynaptic inhibitory action on ACh release that is highly dependent on its intrinsic PLA 2 activity. Given the high safety margin of the neuromuscular transmission, one may argue that the presynaptic block caused by the toxin is not enough to produce muscle paralysis unless a concurrent postsynaptic inhibitory action is also exerted by the CTX heterodimer. Copyright © 2017. Published by Elsevier Inc.

  17. Comparison of humoral immune response, neutralization capacity of anticrotalic serum in young ovines, clinical and weight evaluation between animals inoculated with Crotalus durissus terrificus venom, natural or Cobalt-60-irradiated

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira Junior, R.S. E-mail: rseabra@cevap.org.br

    2005-07-01

    The Elisa technique was used to evaluate and compare the humoral immune response of young ovine to anticrotalic serum production. During serum production, the clinical and weight evaluation of the animals was performed. The parameters utilized were complete blood count, and dosage of urea, creatinine, aspartate aminotransferase, total proteins, albumin and globulin. The animals weight was verified fortnightly during the experiment. The neutralization capacity of the serum produced from the snake Crotalus durissus terrificus natural (NV) and Cobalt-60-irradiated venom (IrV) was evaluated by in vitro challenges. One group of six animals received natural venom, the second group received irradiated venom, and the third was the control group. The animals received six immunizations during 84 days with an interval of 14 days. There was a significant difference (p<5%) in the ELISA test for the profile of the antibodies produced by the experimental groups (NV

  18. Brazilian Eratosthenes Project

    Science.gov (United States)

    Langhi, R.; Vilaça, J.

    2014-10-01

    The objective of Brazilian Eratosthenes Project is the development and application of teaching training actions according the ``docent autonomy" concept to basic Astronomy Education. Argentina coordinates the project in South America, but Brazil works in this project since 2010 with the theme ``Projeto Eratóstenes Brasil" in the homepage: http://sites.google.com/site/projetoerato. Two schools measure a sticks shadow and communicate their results. After, they calculate an average radius of Earth. The stick (gnomon) should stay in vertical position in the leveled ground. Since 2010, the project received hundreds of Brazilian schools with different experiments that were constructed with autonomy, because our site doesn't show some itinerary pre-ready to elaborate the experiments. To collect data for our research, we will use interviews via Skype with the teachers. These data are useful to researches about Science Education area and the Teaching Formation. Teaching professional practice could change and we see modifications in the teachers work, what depends of their realities and context. This project intents to respect the docent autonomy. This autonomy to responsible modifications during continued formation is called ``activist formative model" according Langhi & Nardi (Educação em Astronomia: repensando a formação de professores. São Paulo: Escrituras Editora, 2012). This project discusses about researches in Astronomy Education - still extreme rare in Brazil, when we compare with other areas in Science Education. We believe that actions like this could motivate the students to learn more Astronomy. Furthermore, this national action can be a rich source of data to investigations about teaching formation and scientific divulgation.

  19. Insights from Brazilian medical journals

    OpenAIRE

    Caramelli, Bruno

    2009-01-01

    This brand-new series of articles aims at delivering to national and international readers some of the cutting-edge contributions from the Brazilian medical literature. Recently papers published in the main Brazilian medical journals are carefully selected and analyzed by skilled medical editors. In addition we asked editors to choose keywords to be highlighted in order to claim for reader's attention. Articles are organized by area of interest to facilitate reading. To get the most of the li...

  20. Free software: Some Brazilian translations

    OpenAIRE

    Pinheiro, Alexandre; Cukierman, Henrique

    2004-01-01

    We examine two histories in this paper. First, we briefly look at a North American history, in which we look at the relationship of free software with the founding principles of democracy. Second, we examine recent Brazilian history, especially the most policy decision to adopt free software, affirming technological autonomy. Democratic ideals, defended by the free software movement, are transformed in Brazilian politics, leading both to further free software development and a stronger democr...

  1. Brazilian multipurpose reactor

    International Nuclear Information System (INIS)

    2014-01-01

    The Brazilian Multipurpose Reactor (RMB) Project is an action of the Federal Government, through the Ministry of Science Technology and Innovation (MCTI) and has its execution under the responsibility of the Brazilian National Nuclear Energy Commission (CNEN). Within the CNEN, the project is coordinated by the Research and Development Directorate (DPD) and developed through research units of this board: Institute of Nuclear Energy Research (IPEN); Nuclear Engineering Institute (IEN); Centre for Development of Nuclear Technology (CDTN); Regional Center of Nuclear Sciences (CRCN-NE); and Institute of Radiation Protection and Dosimetry (IRD). The Navy Technological Center in Sao Paulo (CTMSP) and also the participation of other research centers, universities, laboratories and companies in the nuclear sector are important and strategic partnerships. The conceptual design and the safety analysis of the reactor and main facilities, related to nuclear and environmental licensing, are performed by technicians of the research units of DPD / CNEN. The basic design was contracted to engineering companies as INTERTHECNE from Brazil and INVAP from Argentine. The research units from DPD/CNEN are also responsible for the design verification on all engineering documents developed by the contracted companies. The construction and installation should be performed by specific national companies and international partnerships. The Nuclear Reactor RMB will be a open pool type reactor with maximum power of 30 MW and have the OPAL nuclear reactor of 20 MW, built in Australia and designed by INVAP, as reference. The RMB reactor core will have a 5x5 configuration, consisting of 23 elements fuels (EC) of U 3 Si 2 dispersion-type Al having a density of up to 3.5 gU/cm 3 and enrichment of 19.75% by weight of 23 5 U. Two positions will be available in the core for materials irradiation devices. The main objectives of the RMB Reactor and the other nuclear and radioactive facilities are

  2. Assessing Brazilian educational inequalities

    Directory of Open Access Journals (Sweden)

    Benoit Lorel

    2008-03-01

    Full Text Available This paper provides an evaluation of schooling inequality in Brazil using different indicators such as the Education Gini coefficient, the Education Standard Deviation and the Average number of Years of Schooling. We draw up a statistical description of Brazilian human capital dispersion in time over the last half century, across regions and states. Our analysis suggests several conclusions: 1 Strong reduction of educational inequalities measured by Education Gini index. 2 A three parts picture of Brazil seems to emerge, reflecting initial conditions. 3 High increase of the Average number of Years of Schooling. 4 A significant link between Education Gini and the average education length. 5 Education Standard Deviation leads to inverted results compared to Education Gini. 6 Brazilian data are consistent with an Education Kuznets curve if we consider Education Standard Deviation.Esse trababalho busca avaliar o grau de desigualdade educacional no Brasil baseado-se em diferentes indicatores tais como: o índice de Gini educacional, os anos médios de escolaridade e no desvio padrão educacional. Tenta-se colocar uma descrição estatistica da distribuição do capital humano no Brasil, incluindo as diferenças estaduais e regionais observadas durante a ultima metade do século. As conclusões da nossa análise são as seguintes: 1 Forte reduç ão das desigualdades educativas calculadas com o Gini educacional. 2 Um retrato tripartido do Brasil parece se formar refletindo as condições iniciais. 3 Um forte aumento dos níveis de escolarização. 4 Uma relação significativa entre o Gini educacional e os anos médios de estudos. 5 O desvio padrão educacional leva aos resultados inversos do Gini educacional. 6 Os dados brasileiros admitem uma curva de Kuznets educacional se considerarmos o desvio padrão educacional.

  3. Brazilian Literature in African Descent Scenarios

    OpenAIRE

    Soares Fonseca, Maria Nazareth

    2016-01-01

    The essay argues about the meanings given to the terms "black literature," African-Brazilian literature", "Afro-descendant literature" and "black-Brazilian literature" present in anthologies of black African-Brazilian poetry in Brazil. It also discusses the ways these directions are presented in the writers' texts published in the anthologies highlighted in this study.

  4. Brazilian medical publications: citation patterns for Brazilian-edited and non-Brazilian literature

    Directory of Open Access Journals (Sweden)

    J.R. Cunha-Melo

    2006-08-01

    Full Text Available Today, the quality of a scientific article depends on the periodical in which it is published and on the number of times the article is cited in the literature. In Brazil, the criteria for the evaluation of this scientific production are improving. However, there is still some resistance, with authors arguing that Brazilian publications must be preferentially addressed to the national readers and, therefore, they should ideally be written in Portuguese. In order to determine the kind of scientific journals cited in the reference lists of articles published in medical periodicals edited in Brazil, in the present study we determine the rate of Portuguese/English citations. Three issues of 43 periodicals (19 indexed in SciELO, 10 in PubMed, 10 in LILACS, and 4 in the ISI-Thompson base of different medical specialties were analyzed, and the number of both Portuguese and English citations in the reference list of each article was recorded. The results showed that in Brazilian-edited journals the mean number of citations/article was 20.9 ± 6.9 and the percentage of citations of international non-Brazilian periodicals was 86.0 ± 11.2%. Of the latter, 94.4 ± 7.0 are indexed by ISI-Thompson. Therefore, we conclude that Brazilian medical scientists cite the international non-Brazilian periodicals more than the national journals, and most of the cited papers are indexed by ISI-Thompson.

  5. Brazilian medical publications: citation patterns for Brazilian-edited and non-Brazilian literature.

    Science.gov (United States)

    Cunha-Melo, J R; Santos, G C; Andrade, M V

    2006-08-01

    Today, the quality of a scientific article depends on the periodical in which it is published and on the number of times the article is cited in the literature. In Brazil, the criteria for the evaluation of this scientific production are improving. However, there is still some resistance, with authors arguing that Brazilian publications must be preferentially addressed to the national readers and, therefore, they should ideally be written in Portuguese. In order to determine the kind of scientific journals cited in the reference lists of articles published in medical periodicals edited in Brazil, in the present study we determine the rate of Portuguese/English citations. Three issues of 43 periodicals (19 indexed in SciELO, 10 in PubMed, 10 in LILACS, and 4 in the ISI-Thompson base) of different medical specialties were analyzed, and the number of both Portuguese and English citations in the reference list of each article was recorded. The results showed that in Brazilian-edited journals the mean number of citations/article was 20.9 +/- 6.9 and the percentage of citations of international non-Brazilian periodicals was 86.0 +/- 11.2%. Of the latter, 94.4 +/- 7.0 are indexed by ISI-Thompson. Therefore, we conclude that Brazilian medical scientists cite the international non-Brazilian periodicals more than the national journals, and most of the cited papers are indexed by ISI-Thompson.

  6. Brazilian Mothers' Socialization Goals: Intracultural Differences in Seven Brazilian Cities

    Science.gov (United States)

    Seidl-de-Moura, Maria Lucia; Lordelo, Eulina; Vieira, Mauro Luis; Piccinini, Cesar Augusto; Siqueira, Jose de Oliveira; Magalhaes, Celina Maria Colino; Pontes, Fernando Augusto Ramos; Salomao, Nadia Maria; Rimoli, Adriana

    2008-01-01

    The present study aimed to investigate Brazilian mothers' socialization goals. The participants in the study were 349 primiparous mothers, whose ages ranged from 17 to 47 years (mean = 26.6 years), who had children aged between 1 and 48 months (mean = 16.4 months). The families were living in seven different cities representing each of the five…

  7. Crotacetin, a novel snake venom C-type lectin homolog of convulxin, exhibits an unpredictable antimicrobial activity.

    Science.gov (United States)

    Rádis-Baptista, Gandhi; Moreno, Frederico Bruno Mendes Batista; de Lima Nogueira, Lucas; Martins, Alice M C; de Oliveira Toyama, Daniela; Toyama, Marcos Hikari; Cavada, Benildo Sousa; de Azevedo, Walter Filgueira; Yamane, Tetsuo

    2006-01-01

    Snake venom (sv) C-type lectins encompass a group of hemorrhagic toxins that are capable of interfering with blood stasis. A very well-studied svC-type lectin is the heterodimeric toxin, convulxin (CVX), from the venom of South American rattlesnake Crotalus durissus terrificus. CVX is able to activate platelets and induce their aggregation by acting via p62/GPVI collagen receptor. By using polymerase chain reaction homology screening, we have cloned several cDNA precursors of CVX subunit homologs. One of them, named crotacetin (CTC) beta-subunit, predicts a polypeptide with a topology very similar to the tridimensional conformations of other subunits of CVX-like snake toxins, as determined by computational analysis. Using gel permeation and reverse-phase high-performance liquid chromatography, CTC was purified from C. durissus venoms. CTC can be isolated from the venom of several C. durissus subspecies, but its quantitative predominance is in the venom of C. durissus cascavella. Functional analysis indicates that CTC induces platelet aggregation, and, importantly, exhibits an antimicrobial activity against Gram-positive and -negative bacteria, comparable with CVX.

  8. Comparison of frailty among Japanese, Brazilian Japanese descendants and Brazilian community-dwelling older women.

    Science.gov (United States)

    Sampaio, Priscila Yukari Sewo; Sampaio, Ricardo Aurélio Carvalho; Yamada, Minoru; Ogita, Mihoko; Arai, Hidenori

    2015-06-01

    To investigate frailty in Japanese, Brazilian Japanese descendants and Brazilian older women. The collected data included sociodemographic and health-related characteristics, and the frailty index Kihon Checklist. We analyzed the differences between the mean scores of Kihon Checklist domains (using ancova) and the percentage of frail women (using χ(2)-test). We carried out a binary logistic regression with Kihon Checklist domains. A total of 211 participants (Japanese n = 84, Brazilian Japanese descendants n = 55, Brazilian n = 72) participated in this research. The Brazilian participants had the highest total Kihon Checklist scores (more frail), whereas the Brazilian Japanese descendants had the lowest scores (P Brazilian group had more participants with oral dysfunction (P Brazilian women were likely to be more frail than the participants in other groups. More than the environment itself, the lifestyle and sociodemographic conditions could affect the frailty of older Brazilian women. © 2014 Japan Geriatrics Society.

  9. Snakebites by Crotalus durissus ssp in children in Campinas, São Paulo, Brazil Acidentes por serpentes Crotalus durisssus ssp em crianças em Campinas, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Fábio BUCARETCHI

    2002-01-01

    Full Text Available From January, 1984 to March, 1999, 31 children under 15 y old (ages 1-14 y, median 8 y were admitted after being bitten by rattlesnakes (Crotalus durissus ssp. One patient was classified as "dry-bite", 3 as mild envenoming, 9 as moderate envenoming and 18 as severe envenoming. Most patients had neuromuscular manifestations, such as palpebral ptosis (27/31, myalgia (23/31 and weakness (20/31. Laboratory tests suggesting rhabdomyolysis included an increase in total blood creatine kinase (CK, 28/29 and lactate dehydrogenase (LDH, 25/25 levels and myoglobinuria (14/15. The main local signs and symptoms were slight edema (20/31 and erythema (19/31. Before antivenom (AV administration, blood coagulation disorders were observed in 20/25 children that received AV only at our hospital (incoagulable blood in 17/25. AV early reactions were observed in 20 of these 25 cases (9/9 patients not pretreated and 11/16 patients pretreated with hydrocortisone and histamine H1 and H2 antagonists. There were no significant differences in the frequency of patients with AV early reactions between the groups that were and were not pretreated (Fisher's exact test, p = 0.12. Patients admitted less than and more than 6 h after the bite showed the same risk of developing severe envenoming (Fisher's exact test, p = 1. No children of the first group (De janeiro de 1984 a março de 1999, 31 crianças com menos de 15 anos de idade (1 a 14 anos, mediana = 8 anos foram admitidas após terem sido picadas por Crotalus durissus ssp. Uma criança não apresentou manifestações clínicas de envenenamento, enquanto 3 foram classificadas como acidente leve, 9 como moderado e 18 como grave. A maioria das crianças apresentou envolvimento neuromuscular, tais como ptose palpebral (27/31, mialgia (23/31 e fraqueza (20/31. Alterações laboratoriais sugerindo rabdomiólise também foram observadas, como aumento das enzimas séricas CK (28/29 e LDH (25/25 e mioglobinúria (14/15. As

  10. BRAZILIAN EXPORTS OF MANUFACTURED WOOD

    Directory of Open Access Journals (Sweden)

    Rafael de Azevedo Calderon

    2010-08-01

    Full Text Available The present work deals with the Brazilian exports of sawnwood of non-coniferous, veneer sheets and plywood, from 1961 to 2002. The data regarding the three studied products, sawnwood of non-coniferous, veneer sheets and plywood, were joined through the method of Fisher so that an econometric evaluation of the market of the three products could be carried out. Supply and demand models of the Brazilian exports were specified. The results were satisfactory and they match with the literature. The supply of exports presented a positive answer in relation to the exporter's remuneration, to the production, to the use of the installed capacity (cycles of domestic economical activity and to the tendency, and negative in relation to the internal demand. The demand for the Brazilian exports was influenced positively by the world income, participation index and tendency, and negatively for the relative price. The low elasticity-price of the found demand can have implications in the conservation of the Brazilian forest resources because the exporters can increase the prices, reduce the amounts and still increase the incomes.

  11. Trace elements in brazilian soils

    International Nuclear Information System (INIS)

    Rocha, Geraldo Cesar

    1995-01-01

    A literature revision on trace elements (Zn, B, Mn, Mo, Cu, Fe, and Cl) in Brazilian soils was prepared, with special attention to the chemical form and range in the soil, extraction methods and correlation of the amount in soils with soil properties

  12. The Brazilian sugarcane innovation system

    International Nuclear Information System (INIS)

    Tosi Furtado, Andre; Gaya Scandiffio, Mirna Ivonne; Barbosa Cortez, Luis Augusto

    2011-01-01

    Ethanol has recently been of great interest worldwide because it is a viable economic alternative to petroleum products and it is a renewable source of energy that mitigates the emission of greenhouse gases. Brazilian bioethanol from sugarcane is the most successful case at the world level because of its low cost and low level of greenhouse gas emissions. Brazil's success with sugarcane cannot be understood as based solely on a natural comparative advantage, but as a result of efforts that culminated in a positive trajectory of technological learning, relying mostly on incremental innovations. The purpose of this article is to analyze the key aspects of the innovation system built around the Brazilian sugarcane industry. It is based on the national innovation systems approach according to which innovation results from the interaction of different institutional actors. Institutional arrangements are analyzed as the basis for the innovative process, in particular R and D and the innovation policies and strategies of the main players in the sugarcane sector, including sugar and ethanol mills, industrial goods suppliers, public and private research institutions, and governmental agencies. - Research Highlights: → The Brazilian success in bioethanol is due to the sugarcane innovation system. → Private funds for R and D became central after IAA closure. → Nowadays Brazilian innovation system is transforming to keep its leadership. → Public funds for research in the second generation bioethanol.

  13. Jorge de Lima: Brazilian Poet

    Science.gov (United States)

    Kennedy, James H.

    1973-01-01

    Discusses Jorge de Lima--born in Uniao dos Palmares, Brazil on April 23, 1893, died in Rio de Janeiro on November 15, 1953--who during the Twenties became an important member of the literary movement known as Modernism and wrote both religious and regional poetry constituting the beginnings of a Afro-Brazilian poetry. (Author/JM)

  14. Sustainability in Brazilian Federal Universities

    Science.gov (United States)

    Palma, Lisiane Celia; de Oliveira, Lessandra M.; Viacava, Keitiline R.

    2011-01-01

    Purpose: The purpose of this paper is to identify the number of courses related to sustainability offered in bachelor degree programs of business administration in Brazilian federal universities. Design/methodology/approach: An exploratory research was carried out based on a descriptive scope. The process of mapping federal universities in Brazil…

  15. Deforestation in the Brazilian Amazon

    NARCIS (Netherlands)

    Boekhout van Solinge, T.

    2015-01-01

    This essay takes a (green) criminological and multidisciplinary perspective on deforestation in the Brazilian Amazon, by focusing on the crimes and damages that are associated with Amazonian deforestation. The analysis and results are partly based on longer ethnographic stays in North Brazil (Amazon

  16. Oral microbiota of Brazilian captive snakes

    Directory of Open Access Journals (Sweden)

    MG Fonseca

    2009-01-01

    Full Text Available The present work aimed to determine the oral microbiotic composition of snakes from São José do Rio Preto city, São Paulo State, Brazil. Ten snake species, comprising the families Boidae, Colubridae, Elapidae and Viperidae, were submitted to microbiological examination of their oral cavity, which indicated positivity for all buccal samples. Gram-negative bacilli, gram-negative cocci bacilli, gram-positive bacilli and gram-positive cocci were isolated from the snakes. Among isolated bacterium species, the occurrence of coagulase-negative staphylococci in the buccal cavity of Crotalus durissus (Viperiade, Eunectes murinus (Boidae, Mastigodryas bifossatus (Colubridae and Bacillus subtilis, common to oral cavity of Bothrops alternatus (Viperidae and Phalotris mertensi (Colubridae, was detected. It was observed higher diversity of isolated bacteria from the oral cavity of Micrurus frontalis (Elapidae and Philodryas nattereri (Colubridae, as well as the prevalence of gram-positive baccillus and gram-positive cocci. The composition of the oral microbiota of the studied snakes, with or without inoculating fangs, is diverse and also related to the formation of abscesses at the bite site in the victims of the ophidian accidents, and to pathogenic processes in the snakes that host these microorganisms.

  17. Radon in Brazilian underground mines.

    Science.gov (United States)

    Ayres da Silva, Anna Luiza Marques; Eston, Sérgio Médici; Iramina, Wilson Siguemasa; Francisca, Diego Diegues

    2018-02-14

    Radon is a chemically inert noble radioactive gas found in several radioactive decay chains. In underground mines, especially those that contain or have contained ores associated with uranium-bearing minerals, workers might be exposed to high levels of radon and its decay products (RDP). This work aimed to investigate whether the exposure of workers to radon gas and its progeny has been evaluated in Brazilian non-uranium and non-thorium underground mines. If so, the results and control measures undertaken or recommended to maintain the concentrations under Brazilian occupational exposure limits (OELs) were documented. The adopted methodology consisted of three main phases. The first was an extensive bibliographical survey of the concentration levels of radon and RDP, and the radiation dose estimates, considering measurements made heretofore by various Brazilian researchers and exhibiting original measurement work undertaken by the one of the authors (mine O). In the second phase, the values obtained were compared with OELs. In the third phase, it was verified whether any control measures were undertaken in the mines with high exposure of workers to radon and its progeny, and if so, the adopted controls were determined. Data of radon concentration obtained from 52 campaigns in 40 underground mines were analyzed. The results showed that the assessment of the exposure of workers to radon and its progeny was undertaken in many mines at least once, and that in 62.5% of the mines, when visited for the first time, the radon levels throughout them were below the Brazilian OELs. As expected, the main control measure adopted or recommended was the improvement of the ventilation system. © 2018 IOP Publishing Ltd.

  18. Cost Stickiness in Brazilian Firms

    OpenAIRE

    Otavio Ribeiro De Medeiros; Patricia de Souza Costa

    2004-01-01

    Conventional cost accounting assumes that the relation between cost and volume is symmetric for volume increases and decreases. We test an alternative model where costs increase more when activity rises than they decrease when activity falls by an equivalent amount. We find, for a sample of Brazilian firms that selling, general, and administrative costs increase 0.59% per 1% increase in sales but decrease only 0.32% per 1% decrease in sales. We test several hypotheses about the properties of ...

  19. Brazilian Participation in World War II

    Science.gov (United States)

    2006-12-15

    internal rebellions and secessionist movements such as the Canudos rebellion in 1897 and 1898 in Bahia province. As a 2 result, the Brazilian Army...Brazilian Army would play an important role in ending this dictatorship. Brazil had accepted large numbers of Italian and German immigrants for more than...including the Brazilian Armed Forces. They had a significant influence on decision makers. In the 1930s, German immigrants numbered more than 900,000 and

  20. Brazilian Studies Then and Now

    Directory of Open Access Journals (Sweden)

    Anthony Pereira

    2012-09-01

    Full Text Available In 1912 the Brazilian diplomat and scholar Manuel de Oliveira Lima gave six lectures at Stanford University that encapsulated his views of what we now call Brazilian Studies. This article summarizes Oliveira Lima’s lectures. It then points out three aspects of Oliveira Lima’s worldview that are problematic from the perspective of the twenty-first century: his Eurocentrism; the unproblematic nature of the nation-state in his thinking; and his largely negative view of Brazil’s racial heritage. The third part of the essay analyzes three aspects of Oliveira Lima’s lectures that are still contemporary. These are the need to establish an adequate comparative context for the study of Brazil; the difficulty of justifying an academic discipline that revolves around the study of a single country; and the challenge of uniting disparate and specialized disciplines in order to appreciate Brazil’s complexity and trajectory in the modern world. In the conclusion, some guidelines for maintaining Brazilian Studies as a vibrant field are suggested.

  1. Brazilian medical publications: citation patterns for Brazilian-edited and non-Brazilian literature

    OpenAIRE

    Cunha-Melo, J.R.; Santos, G.C.; Andrade, M.V.

    2006-01-01

    Today, the quality of a scientific article depends on the periodical in which it is published and on the number of times the article is cited in the literature. In Brazil, the criteria for the evaluation of this scientific production are improving. However, there is still some resistance, with authors arguing that Brazilian publications must be preferentially addressed to the national readers and, therefore, they should ideally be written in Portuguese. In order to determine the kind of scien...

  2. Competitiveness in the Brazilian oil industry. The Brazilian 'oil diamond'

    International Nuclear Information System (INIS)

    Zamith, R.; Moutinho Dos Santos, E.

    2000-01-01

    It is recognized the economic benefits that might follow the opening process of the Brazilian oil and natural gas industry, which shall experience a fast expansion with the arrival of national and international private investors. However, we should not neglect the broader impact of this process on the future development of all that cluster of national agents that lived around and served the former national oil monopoly, managed by the Brazilian National Oil Company, Petrobras. This work focuses on this larger perspective, discussing about the capacity of Brazil to sustain and expand its competitiveness in the oil business as well as to obtain the maximum economic development from the exploration of its oil and gas reserves. We adopt the work of Michael Porter, from the University of Harvard, about the Competitive Advantage of Nations, as a theoretical model to analyze the Competitive Advantage of Brazil in the global oil industry. By introducing the concept of ''oil diamond'', adapted from the notion introduced by this author, we develop a new understanding of national competitiveness in the oil sector. In this paper, we present the general model as well as a brief characterization of the results found for Brazil Subsequently, we focus on just one leg of the model, for which we discuss, with more detail, about the competitive condition of the country in the opening-up scenario. This leg regards the so-called supporting and supplementary industries that constitute what is denominated in the French tradition the ''para petroleum'' industry. We analyze the conditions for the Brazilian domestic ''para petroleum industry'' to survive and grow in the new competitive environment. (authors)

  3. Types and myths in Brazilian thought

    Directory of Open Access Journals (Sweden)

    Octavio Ianni

    2005-01-01

    Full Text Available "Ideal types" elaborated by different authors and that have become emblematic, notorious or even definitive, sometimes representing myths are quite frequent in Brazilian thought. That is the case of the bandeirantes (colonial crusaders, the gaúcho, Jeca Tatu, Macunaíma, cordial man and others. It is worth contemplating this aspect of Brazilian culture and thought.

  4. Study of brazilian market of advanvced ceramics

    International Nuclear Information System (INIS)

    Veiga, M.M.; Soares, P.S.M.; SIlva, A.P. da; Alvarinho, S.B.

    1989-01-01

    The brazilian actual market survey of advanced ceramics, divided in sectors according to their function is described. The electroelectronics, magnetics, optics, mechanics and nuclears ceramics are presented. A forecasting of the brazilian market in advanced ceramics are also mentioned. (C.G.C.) [pt

  5. Brazilian Studies and Brazilianists: Conceptual remarks

    Directory of Open Access Journals (Sweden)

    Vinicius Mariano de Carvalho

    2017-01-01

    Full Text Available This article discusses the concept of Brazilian Studies. It does not intend to outline a defence for a new discipline, or to propose paradigms for that elusive field called ‘area studies’. It will, bring some reflections on epistemological and methodological issues realted to what it is been called Brazilian Studies.

  6. The new Brazilian national forest inventory

    Science.gov (United States)

    Joberto V. de Freitas; Yeda M. M. de Oliveira; Doadi A. Brena; Guilherme L.A. Gomide; Jose Arimatea Silva; < i> et al< /i>

    2009-01-01

    The new Brazilian national forest inventory (NFI) is being planned to be carried out through five components: (1) general coordination, led by the Brazilian Forest Service; (2) vegetation mapping, which will serve as the basis for sample plot location; (3) field data collection; (4) landscape data collection of 10 x 10-km sample plots, based on high-resolution...

  7. 36th Brazilian Workshop on Nuclear Physics

    CERN Document Server

    Brandão de Oliveira, José Roberto; Barbosa Shorto, Julian Marco; Higa, Renato

    2014-01-01

    The Brazilian Workshop on Nuclear Physics (RTFNB, acronym in Portuguese) is organized annually by the Brazilian Physics Society since 1978, in order to: promote Nuclear Physics research in the country; stimulate and reinforce collaborations among nuclear physicists from around the country; disseminate advances in nuclear physics research and its applications; disseminate, disclose and evaluate the scientific production in this field.

  8. A SELECTIVE BIBLIOGRAPHY OF CONTEMPORARY BRAZILIAN AUTHORS.

    Science.gov (United States)

    HOPE, HENRY W.

    A BIBLIOGRAPHIC LISTING WAS COMPILED IN CONNECTION WITH A RESEARCH PROJECT ON THE SYNTAX OF CONTEMPORARY BRAZILIAN PORTUGUESE. THE DOCUMENT WAS NOT INTENDED TO BE AN EXHAUSTIVE INVENTORY OF CONTEMPORARY BRAZILIAN LITERATURE. SUBJECTS INCLUDED ARE FICTION AND NON-FICTION IN THE HUMANITIES AND SOCIAL SCIENCES. ANNOTATIONS ARE NOT INCLUDED. THE DATES…

  9. Neymar, defender of brazilian tradition

    OpenAIRE

    Silva, Francisca Islandia Cardoso da; Rodrigues, Janete de Páscoa

    2016-01-01

    The purpose of this article is to analyze how university students of Teresina-PI appropriate of the message of a report of the television show Esporte Espetacular. There was use of the technique of focus groups and analytical-descriptive method for collecting and analyzing data. The sample consisted of 24 university students, aged between 18 and 24 years. The report features Neymar as responsible to follow the "tradition" of Brazilians and to be crowned as the best player in the world. The su...

  10. Comparison of postmenopausal endogenous sex hormones among Japanese, Japanese Brazilians, and non-Japanese Brazilians

    Directory of Open Access Journals (Sweden)

    Maciel Maria

    2011-02-01

    Full Text Available Abstract Background Differences in sex hormone levels among populations might contribute to the variation in breast cancer incidence across countries. Previous studies have shown higher breast cancer incidence and mortality among Japanese Brazilians than among Japanese. To clarify the difference in hormone levels among populations, we compared postmenopausal endogenous sex hormone levels among Japanese living in Japan, Japanese Brazilians living in the state of São Paulo, and non-Japanese Brazilians living in the state of São Paulo. Methods A cross-sectional study was conducted using a control group of case-control studies in Nagano, Japan, and São Paulo, Brazil. Participants were postmenopausal women older than 55 years of age who provided blood samples. We measured estradiol, estrone, androstenedione, dehydroepiandrosterone sulfate (DHEAS, testosterone and free testosterone by radioimmunoassay; bioavailable estradiol by the ammonium sulfate precipitation method; and sex hormone-binding globulin (SHBG by immunoradiometric assay. A total of 363 women were included for the present analyses, comprising 185 Japanese, 44 Japanese Brazilians and 134 non-Japanese Brazilians. Results Japanese Brazilians had significantly higher levels of estradiol, bioavailable estradiol, estrone, testosterone and free testosterone levels, and lower SHBG levels, than Japanese. Japanese Brazilians also had significantly higher levels of bioavailable estradiol, estrone and DHEAS and lower levels of SHBG and androstenedione than non-Japanese Brazilians. Levels of estradiol, testosterone and free testosterone, however, did not differ between Japanese Brazilians and non-Japanese Brazilians. These differences were observed even after adjustment for known breast cancer risk factors. We also found an increase in estrogen and androgen levels with increasing body mass index, but no association for most of the other known risk factors. Conclusions We found higher levels of

  11. Political Liberalization, Black Consciousness, and Recent Afro-Brazilian Literature.

    Science.gov (United States)

    Kennedy, James H.

    1986-01-01

    Accounts for the surge in Afro-Brazilian literacy production of the late 1970s and early 1980s from the perspective of Brazil's changing political life and a growth of racial consciousness. Presents a broad overview of recent Brazilian political and literary history. Focuses on racial politics and Afro-Brazilians in the Brazilian literary market.…

  12. German-Brazilian nuclear deal

    International Nuclear Information System (INIS)

    Krugmann, H.

    1981-01-01

    Examination of the arguments in favor of the nuclear deal with West Germany and the resulting program suggests that revisions of both are in order to make them more compatible with Brazil's national interests. The deficiencies of current policy appear to be too weighty and numerous to be ignored. Sooner or later the government will have to move toward adjusting its nuclear agreement with West Germany, if not for the reasons discussed here then for lack of capital. Current estimates of the nuclear package lie in the range of $25 to $30 billion, compared to an initial projection of about $5 billion. The deal has become so expensive that it would draw capital from the hydropower and alcohol programs essential for the short and medium-term energy needs of the country. Mr. Krugman feels the Brazilian government should hold off on further nuclear contracts. And it should thoroughly reassess what Brazil's nuclear energy and technology requirements are and how to meet them. There are indications that the reassessment process is already underway. As long as the German nuclear industry depends on the sale of technology to Brazil, the Brazilian government will have considerable bargaining power to enforce further changes in the deal. If this power is used wisely, the result could be cooperation between the two countries toward nuclear options that are consistent with Brazil's energy and development needs

  13. Brazilian sparkling wine: A successful trajectory

    Directory of Open Access Journals (Sweden)

    Wurz Douglas André

    2017-01-01

    Full Text Available The objective of this study was to explore the evolution of internal and external commercialization of Brazilian sparkling wines during the period between 1986 and 2015, giving an overview of the current situation and its market trends, and highlighting the importance of Brazil in the world scenario for sparkling wines. This research is based on quantitative data sources provided by different institutions: International Organization of Vine and Wine (OIV, Brazilian Union of Viticulture (UVIBRA, Ministry of Agriculture, Livestock and Supply (MAPA and Brazilian Agricultural Research Corporation (EMBRAPA. Brazil is a promising country for the sparkling wine market. From 1986–2015, there was an increase of 465.6% in the sales of sparkling wine in the Brazilian domestic market, especially the last ten, which accounted for an increase of 215.7%. In 1998, Brazilian sparkling wines accounted for 70.5% of sparkling wines sold in Brazil. Today, they represent 82.1%of national market, and proved to be one of the most prestigious products from Brazilian viticulture when compared, for example, to non-sparkling wines, which 79% are imported wines. Of the imported sparkling wines consumed in Brazil, six countries account for 98.5% of the market (France: 32.7%; Italy: 24.8% and Spain: 21.9%. The volume exportation of Brazilian sparkling wine has grown significantly in recent years (4,210.2%, with Paraguay, China, Uruguay, the United States, France and the United Kingdom being the major buyers. The evolution of exports shows that Brazilian sparkling wine becomes an alternative to those produced in traditional countries, such as France, Italy and Spain, due to their quality and price. There is an increase in the commercialization of sparkling wines in the Brazilian domestic market, in addition to the growing participation of Brazil in the volume of exports in the world market, placing Brazil in a leading position in the production and sale of sparkling wines.

  14. SBR Brazilian organophilic/clay nanocomposites

    International Nuclear Information System (INIS)

    Guimaraes, Thiago R.; Valenzuela-Diaz, Francisco R.; Morales, Ana Rita; Paiva, Lucilene B.

    2009-01-01

    The aim of this work is the obtaining of SBR composites using a Brazilian raw bentonite and the same bentonite treated with an organic salt. The clays were characterized by XRD. The clay addition in the composites was 10 pcr. The composites were characterized by XRD and had measured theirs tension strength (TS). The composite with Brazilian treated clay showed TS 233% higher than a composite with no clay, 133% higher than a composite with Cloisite 30B organophilic clay and 17% lower than a composite with Cloisite 20 A organophilic clay. XRD and TS data evidence that the composite with Brazilian treated clay is an intercalated nanocomposite. (author)

  15. Scientometrics: Nature Index and Brazilian science.

    Science.gov (United States)

    Silva, Valter

    2016-09-01

    A recent published newspaper article commented on the (lack of) quality of Brazilian science and its (in) efficiency. The newspaper article was based on a special issue of Nature and on a new resource for scientometrics called Nature Index. I show here arguments and sources of bias that, under the light of the principle in dubio pro reo, it is questionable to dispute the quality and efficiency of the Brazilian science on these grounds, as it was commented on the referred article. A brief overview of Brazilian science is provided for readers to make their own judgment.

  16. Gamma radiation damage in crotamine (venom of Brazilian rattlesnake)

    International Nuclear Information System (INIS)

    Costa, T.A.; Rogero, J.R.

    1988-01-01

    Ionizing Radiations changes the molecular structure due to chemical bond destruction. These chemical alterations is able to change the biological properties of the macro-molecules. Crotamine was obtained from Crotalus durissus terrificus venom by molecular exclusion cromatography and irradiated in concentration of 2 mg/ml of NaCl 0,85% with gamma radiation produced by a 60 Co source. We used doses of 100 Gy, 250 Gy, 500 Gy, 1000 Gy and 2000 Gy (dose rate = 1,19.10 3 Gy/h). We performed the following experiments: presence of free SH groups, proteic concentration,SDS-PAGE and immunodifusion. Preliminary results showed an increase of the number of bands in SDS-PAGE suggesting the appearence of protein aggregates that proportional to the dose increasing. The immunodiffusion data showed no modification of the immunochemical activity against theButantan anti - sera. (author) [pt

  17. Neymar, defender of brazilian tradition

    Directory of Open Access Journals (Sweden)

    Francisca Islandia Cardoso da Silva

    2016-09-01

    Full Text Available The purpose of this article is to analyze how university students of Teresina-PI appropriate of the message of a report of the television show Esporte Espetacular. There was use of the technique of focus groups and analytical-descriptive method for collecting and analyzing data. The sample consisted of 24 university students, aged between 18 and 24 years. The report features Neymar as responsible to follow the "tradition" of Brazilians and to be crowned as the best player in the world. The subjects of research said that the speech conveyed by the report can reproduce and create a reality sometimes dreamlike, because objective to confer to Neymar great importance with regard to national identity.

  18. Best Practices in Brazilian Companies

    Directory of Open Access Journals (Sweden)

    Catia dos Reis Machado

    2013-04-01

    Full Text Available Competitive intelligence (CI is a systematic and ethical collection, analysis, dissemination and management of information about the external environment that may affect the plans, decisions and operations of the organization. Knowledge management (KM can be seen as a tool to promote organizational knowledge through the use of activities designed to identify, create, store, share and use knowledge. Companies face a challenge in the era of knowledge, it is the extraction and management of knowledge produced by people in the organization. CI and KM combined generates organizational intelligence. The exploratory study, based on literature and multicase study, we sought to identify best practices in processes of CI and KM in Brazilian companies. We identified practices related to the CI design process, the stages of the CI, the use of networks, and knowledge management. We also identified, points of attention on the internal/external organizational environment.

  19. ASTER: A Brazilian Mission to an Asteroid.

    Science.gov (United States)

    Winter, O. C.; Macau, E. E. N.; de Campos Velho, H.; Carruba, V.

    2012-05-01

    The first Brazilian mission to an asteroid is being planned. The target is the asteroid 2001 SN263, which has a NEA orbit of class AMOR. The mission is scheduled to be launched in 2015, reaching the asteroid in 2019.

  20. Brazilian nuclear programme - energy in Brazil

    International Nuclear Information System (INIS)

    Lima, J.O.V.

    1988-01-01

    The brazilian energetic model, highly dependent of petroleum, have been changed in the sense to adopt diversified and regionalized solutions. This paper describes the role and the perspective of the nuclear energy in this context. (M.I.)

  1. In The Fabric of Brazilian Sexuality

    Directory of Open Access Journals (Sweden)

    Maria Luiza Heilborn

    2006-01-01

    Full Text Available This article is about sexual myths and conducts, aiming to demonstrate the constructed nature of the Brazilian sexuality representation as highly eroticized and malleable. Starting from a constructivist perspective of sexuality, the myth of Brazilian sexual nature is analyzed. There is a widespread idea that Brazilian culture is sexually too open, expansive and warm – which is considered as a positive reference for national identity. Considering historical data and those originated from a survey carried out in three regions of the country with young people of both sexes aged 18 through 24, the article demonstrates that sexual behaviors do not correspond to the socially diffused image of Brazilian sexuality - strongly patterned by gender relations.

  2. Cerebrotendinous xanthomatosis: report of two Brazilian brothers.

    NARCIS (Netherlands)

    Lange, M.C.; Zetola, V.F.; Teive, H.; Scola, R.H.; Trentin, A.P.; Zavala, J.A.; Pereira, E.R.; Raskin, S.; Werneck, L.C.; Sistermans, E.A.

    2004-01-01

    Cerebrotendinous xanthomatosis is a treatable rare autossomal recessive disease characterized by lipid storage secondary to a sterol 27-hydroxylase deficiency in the formation of cholic and chenodeoxycholic acids. We describe two Brazilian brothers with cognitive impairement and chronic diarrhea.

  3. Drug abuse among workers in Brazilian regions

    OpenAIRE

    Silva,Ovandir Alves; Yonamine,Mauricio

    2004-01-01

    OBJECTIVE: Many business organizations in Brazil have adopted drug testing programs in the workplace since 1992. Rehabilitation, rather than layoff and disciplinary measures, has been offered as part of the Brazilian employee assistance programs. The purpose study is to profile drug abuse among company workers of different Brazilian geographical regions. METHODS: Urine samples of 12,700 workers from five geographical regions were tested for the most common illicit drugs of abuse in the countr...

  4. Brazilian law for scientific use of animals

    OpenAIRE

    Marques,Ruy Garcia; Morales,Marcelo Marcos; Petroianu,Andy

    2009-01-01

    The Brazilian scientific community claimed for a definitive systematization and for comprehensive and realistic national rules, to provide guidance and regulation, instead of sanctions, so that the question of scientific research involving animals could be better contemplated. This is beginning to occur now with Law n.º 11.794, sanctioned by the President of the Republic on November 8, 2008. PURPOSE: To describe the evolution of Brazilian regimentation for scientific use of animals and to ana...

  5. Brazilian Military Dictatorship: theoretical and historiographical approximations

    OpenAIRE

    Carlos Fico

    2017-01-01

    As is common in the History of Present, there is a significant interconnection between politics and academic research regarding the history of the Brazilian military dictatorship. Consequently, it is essential that well-established theoretical formulations guide archival research. This article discusses the alleged revisionism of the historiography on the Brazilian military dictatorship, argues that the recruitment of young left-wing students for the armed struggle has generated a traumatic m...

  6. An analysis of the Brazilian Reits

    OpenAIRE

    Neto, Antonio

    2016-01-01

    To contribute to the literature about the Brazilian Indirect Real Estate market, this paper studies the impact of diversification strategy and full control / ownership of properties on the performance of Fundos de Investimento Imobiliário (FIIs), the Brazilian version of REITs. I collected information about 110 FIIs and the quantitative analysis suggests that both diversification strategy and full control of properties negatively impact performance of FIIs. Considering past res...

  7. [Theater in Brazilian science museums and centers].

    Science.gov (United States)

    Moreira, Leonardo Maciel; Marandino, Martha

    2015-12-01

    This qualitative research, based on a descriptive and exploratory study, examines how theater is used as a science communication strategy by Brazilian science museums and centers. Data was collected through a survey emailed to 24 Brazilian institutions identified as science museums and centers. Content analysis was performed, using cross-sectional thematic analysis. It was found that respondents' activities could be classified as approaching theater as an educational support.

  8. Futebol mulato: racial constructs in Brazilian football

    Directory of Open Access Journals (Sweden)

    Tiago Fernandes Maranhao

    2011-05-01

    Full Text Available The aim of this paper is to review Gilberto Freyre’s ideas about futebol mulato and the way these ideas have spread the notion of the Brazilian mulatto as a symbol of a ‘racial democracy’, unique in Brazil, around the world. The notion first appeared in 1938 in an article by Freyre for the Diários Associados, an important Brazilian newspaper. Football (soccer was employed by Freyre as the special arena where the multiracial Brazilian nation could shine and show the world a different way of being, opposed to the white and ‘rational’ way of European football. In Freyre’s work, the so-called ‘football-art’ was compared to poetry, while the European style was equated with prose. This essay argues that Freyre’s ideas were useful in constructing the Brazilian identity, a nation of harmony in all its aspects, including the area of race, and how the idea of the mulatto has been used to minimise social disparities within Brazilian society. Freyre’s ideas remain contemporary; many Brazilian intellectuals still refer to these concepts. As well, the press in this huge country, and especially in World Cup years, uses the concepts of mulatto and football-art to characterize Brazil and differentiate it from other countries.

  9. 'Choosing Wisely' culture among Brazilian cardiologists.

    Science.gov (United States)

    Correia, Luis C L; Barcellos, Guilherme B; Calixto, Vitor; Volschan, André; Barreto-Filho, José A S; Lopes, Renato D; Rassi, Anis; Levinson, Wendy; de Paola, Angelo A V

    2018-03-01

    (i) To describe how aligned the 'Choosing Wisely' concept is with the medical culture among Brazilian cardiologists and (ii) to identify predictors for physicians' preference for avoiding wasteful care. Cross-sectional study. Brazilian Society of Cardiology. Cardiologists who agree to fill a web questionary. A task force of 12 Brazilian cardiologists prepared a list of 13 'do not do' recommendations, which were made available on the Brazilian Society of Cardiology website for affiliates to assign a supported score of 1 to 10 to each recommendation. Score average for supporting recommendations. Of 14 579 Brazilian cardiologists, 621 (4.3%) answered the questionnaire. The top recommendation was 'do not perform routine percutaneous coronary intervention in asymptomatic individuals' (mean score = 8.0 ± 2.9) while the one with the lowest support was 'do not use an intra-aortic balloon pump in infarction with cardiogenic shock' (5.8 ± 3.2). None of the 13 recommendations presented a mean grade >9 (strong support); 7 recommendations averaged 7-8 (moderate support) followed by 6 recommendations with an average of 5-7 (modest support). Multivariate analysis independently identified predictors of the score attributed to the top recommendation; being an interventionist and time since graduation were both negatively associated with support. (i) The support of Brazilian cardiologists for the 'Choosing Wisely' concept is modest to moderate, and (ii) older generations and enthusiasm towards the procedure one performs may be factors against the 'Choosing Wisely' philosophy.

  10. 3rd BRAZILIAN CONSENSUS ON Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Luiz Gonzaga Coelho

    2013-04-01

    Full Text Available Significant progress has been obtained since the Second Brazilian Consensus Conference on Helicobacter pylori Infection held in 2004, in São Paulo, SP, Brazil, and justify a third meeting to establish updated guidelines on the current management of H. pylori infection. The Third Brazilian Consensus Conference on H pylori Infection was organized by the Brazilian Nucleus for the Study of Helicobacter, a Department of the Brazilian Federation of Gastroenterology and took place on April 12-15, 2011, in Bento Gonçalves, RS, Brazil. Thirty-one delegates coming from the five Brazilian regions and one international guest, including gastroenterologists, pathologists, epidemiologists, and pediatricians undertook the meeting. The participants were allocated in one of the five main topics of the meeting: H pylori, functional dyspepsia and diagnosis; H pylori and gastric cancer; H pylori and other associated disorders; H pylori treatment and retreatment; and, epidemiology of H pylori infection in Brazil. The results of each subgroup were submitted to a final consensus voting to all participants. Relevant data were presented, and the quality of evidence, strength of recommendation, and level of consensus were graded. Seventy per cent and more votes were considered as acceptance for the final statement. This article presents the main recommendations and conclusions to guide Brazilian doctors involved in the management of H pylori infection.

  11. The Northeast Brazilian Rift System

    Science.gov (United States)

    de Matos, Renato M. Darros

    1992-08-01

    The northeast Brazilian rift basins provide important data critical to the understanding of continental rifting processes associated with the opening of the South Atlantic. These basins represent the locus of intersection of the Southern and Equatorial branches and some basins yield substantial chronostratigraphic data that constrain the temporal and spatial interaction of the rift phases. Similar data are not found in its counterpart in Africa, especially for the Neocomian. These Early Cretaceous rift basins of northeast Brazil illustrate key three-dimensional geometries of intracontinental rift systems, mainly controlled by the basement structural framework. During the main rift phase (Syn-rift II, Neocomian-early Barremian) extensional deformation was distributed over three main rift axes: (1) the Gabon-Sergipe Alagoas (GSA) trend, (2) the Recôncavo-Tucano-Jatobá (RTJ) trend and (3) the Cariri-Potiguar (CP) trend. During this phase, extensional deformation jumped west from the easternmost basins (GSA trend) to a series of NE trending intracratonic basins (RTJ and CP trends), characterized by a set of asymmetric half grabens separated by basement highs, transfer faults, and/or accommodation zones. These basins are typically a few tens of kilometers wide and trend NE-SW, roughly perpendicular to the main extension direction during the Neocomian. Preexisting upper crustal weakness zones, like the dominantly NE-SW trending shear zones of the Brazilian/Pan-African orogeny, controlled the development of intracrustal listric normal faults. Internal transverse structures such as transfer faults and accommodation zones were also controlled by the local basement structural framework. The megashear zones of Pernambuco (Brazil) and Ngaundere (Africa) seem to have behaved like a huge accommodation zone, accommodating extensional deformation along the RTJ/GSA trends with simultaneous extension along the CP trend. During the late Barremian (Syn-rift phase III), a significant

  12. Insights from Brazilian medical journals

    Directory of Open Access Journals (Sweden)

    Bruno Caramelli

    2009-01-01

    Full Text Available This brand-new series of articles aims at delivering to national and international readers some of the cutting-edge contributions from the Brazilian medical literature. Recently papers published in the main Brazilian medical journals are carefully selected and analyzed by skilled medical editors. In addition we asked editors to choose keywords to be highlighted in order to claim for reader's attention. Articles are organized by area of interest to facilitate reading. To get the most of the limited available editorial space we did not include the names of the authors of the related articles in the text itself but a complete reference guide is provided at the end of the article. The result carries the most important messages from the original paper accompanied by a personal interpretation. Directed to the busy medical doctor we hope that this initiative may help in the successful translation of knowledge from scientific evidence to clinical practice.Esta nova série de artigos tem por objetivo levar aos leitores nacionais e internacionais algumas das mais importantes contribuições provenientes da literatura médica brasileira recente. Os artigos originais mais relevantes são selecionados por experientes editores a quem solicitamos que escolham palavras- chaves para que sejam destacadas para chamar a atenção do leitor. Para facilitar a leitura, os artigos são organizados por área de interesse. Para aproveitar ao máximo o limitado espaço editorial não são incluídos os nomes dos autores dos artigos. Entretanto, a referência completa é oferecida ao final do artigo. O resultado final traz o que há de melhor do artigo, seguido de uma sintética interpretação pessoal. Endereçado ao médico ocupado, esperamos que esta inciativa possa contribuir para o sucesso da translação do conhecimento da evidência científica para a prática clínica.

  13. Brazilian Chronic Dialysis Census 2014.

    Science.gov (United States)

    Sesso, Ricardo Cintra; Lopes, Antonio Alberto; Thomé, Fernando Saldanha; Lugon, Jocemir Ronaldo; Martins, Carmen Tzanno

    2016-03-01

    National chronic dialysis data have had impact in the treatment planning. To report data of the annual survey of the Brazilian Society of Nephrology about chronic kidney disease patients on dialysis in July 2014. A survey based on data of dialysis units from the whole country. The data collection was performed by using a questionnaire filled out on-line by the dialysis units. Three hundred twelve (44%) of the dialysis units in the country answered the questionnaire. In July 2014, the total estimated number of patients on dialysis was 112,004. The estimated prevalence and incidence rates of chronic maintenance dialysis were 552 (range: 364 in the North region and 672 in the Southeast) and 180 patients per million population (pmp), respectively. The annual incidence rate of patients with diabetic nephropathy was 77 pmp. The annual gross mortality rate was 19%. For prevalent patients, 91% were on hemodialysis and 9% on peritoneal dialysis, 32,499 (29%) were on a waiting list of renal transplant, 37% were overweight/obese, 29% were diabetics, 16% had PTH levels > 600 pg/ml and 26% hemoglobin < 10 g/dl. A venous catheter was the vascular access for 17% of the hemodialysis patients. During 2011-2014 the prevalence and incidence rates of patients on dialysis tended to increase, while the gross mortality rate remained stable. In 2014, diabetes was the primary renal disease in 42% of the new dialysis patients.

  14. Brazilian Chronic Dialysis Survey 2016.

    Science.gov (United States)

    Sesso, Ricardo Cintra; Lopes, Antonio Alberto; Thomé, Fernando Saldanha; Lugon, Jocemir Ronaldo; Martins, Carmen Tzanno

    2017-01-01

    National chronic dialysis data are important for the treatment planning. To report data of the annual survey of the Brazilian Society of Nephrology about chronic kidney disease patients on dialysis in July 2016. A survey based on data of dialysis centers from the whole country. The data collection was performed by using a questionnaire filled out on-line by the dialysis centers. 309 (41%) of the dialysis units in the country answered the questionnaire. In July 2016, the total estimated number of patients on dialysis was 122,825. The estimated prevalence and incidence rates of chronic maintenance dialysis were 596 (range: 344 in the North region and 700 in the Southeast) and 193 patients per million of population (pmp), respectively. The annual incidence rate of patients with diabetic nephropathy was 79 pmp. The annual gross mortality rate was 18.2%. For prevalent patients, 92% were on hemodialysis and 8% on peritoneal dialysis, and 29,268 (24%) were on a waiting list of renal transplant. A venous catheter was the vascular access for 20.5% of the hemodialysis patients. The prevalence rates of positive serology for hepatitis B and C showed a tendency to reduce from 2013 (1.4% and 4.2%, respectively) to 2016 (0.7% and 3.7%, respectively). The absolute number and the prevalence and incidence rates of patients on dialysis continue to rise steadily; the gross mortality rate remained stable. Regional inequities are evident in these rates.

  15. Permeability measuremens of brazilian Eucalyptus

    Directory of Open Access Journals (Sweden)

    Marcio Rogério da Silva

    2010-09-01

    Full Text Available The permeability of Brazilian Eucalyptus grandis and Eucalyptus citriodora wood was measured in a custom build gas analysis chamber in order to determine which species could be successfully treated with preservatives. Liquid permeability was tested using an emulsion of Neen oil and a control of distillated water. Air was used to test the gas phase permeability. For both Eucalyptus grandis and Eucalyptus citriodora, the longitudinal permeability of gas was shown to be about twice as great as the liquid phase permeability. No radial permeability was observed for either wood. The permeability of air and water through the sapwood of Eucalyptus grandis was greater than that through the sapwood of Eucalyptus citriodora. The permeability of neen oil preservative through the sapwood of Eucalyptus grandis was also greater than through the sapwood of E. Citradora, but the difference was not statistically significant. Scanning Electron Microscopy images showed that the distribution and obstruction in the vessels could be correlated with observed permeability properties. Irrespective of the causes of differences in permeability between the species, the fluid phase flux through the sapwood of both species was significant, indicating that both Eucalyptus grandis and Eucalyptus citriodora could be successfully treated with wood preservative.

  16. Extractive reserves in Brazilian Amazonia

    Energy Technology Data Exchange (ETDEWEB)

    Fearnside, P.M (National Institute for Research in the Amazon, Manaus-Amazonas (Brazil))

    1989-06-01

    In 1985 an opportunity arose for maintaining tracts of Amazonian forest under sustainable use. Brazil's National Council of Rubber Tappers and the Rural Worker's Union proposed the creation of a set of reserves of a new type, called extractive reserves. The first six are being established in one of the Brazilian states most threatened by deforestatation. The creation of extractive reserves grants legal protection to forest land traditionally used by rubber tappers, Brazil-nut gatherers, and other extractivists. The term extrativismo (extractivism) in Brazil refers to removing nontimber forest products, such as latex, resins, and nuts, without felling the trees. Approximately 30 products are collected for commercial sale. Many more types of forest materials are gathered, for example as food and medicines, for the extractivists' own use. The reserve proposal is attractive for several reasons related to social problems. It allows the rubber tappers to continue their livelihood rather than be expelled by deforestation. However, it is unlikely that sufficient land will be set aside as extractive reserves to employ all the tappers. Displaced rubber tappers already swell the ranks of urban slum dwellers in Brazil's Amazonian cities, and they have become refugees to continue their profession in the forests of neighboring countries, such as Bolivia.

  17. Aflatoxins in Brazilian Peanut Confection.

    Science.gov (United States)

    2016-04-07

    The study's objectives were to evaluate a method for the determination of aflatoxins (AFs) in the Brazilian peanut confection "Paçoca" and to apply the method in investigating AF concentrations in Paçoca marketed in São Paulo State throughout 2013. Results of another survey conducted between 1994 and 2002 with another method were also reported. The current method consists of immunoaffinity column cleanup, LC with postcolumn derivatization for AF fluorescence enhancement, and fluorescence determination for the toxins. The mean recovery and mean RSD r values were 88.6 and 7.9%, respectively. The LODs for aflatoxin B 1 , aflatoxin B 2 , aflatoxin G 1 , and aflatoxin G 2 were 0.04, 0.01, 0.02, and 0.01 ng/g; and the LOQs were 0.15, 0.04, 0.07, and 0.04 ng/g, respectively. Results of the two survey studies indicate that the contamination of AFs in Paçoca remains a public health problem. In the 2013 survey, 71 of 100 samples (71%) had AFs contamination ranging from 0.3 to 41.8 ng/g, with 12 samples (12%) containing >20 ng/g of the toxins, whereas in the 1994-2002 survey, 73 of 150 samples (51%) had AFs contamination ranging from 9 to 1439 ng/g with 65 samples (45%) containing levels >20 ng/g.

  18. Brazilian Cerrado Soil Actinobacteria Ecology

    Science.gov (United States)

    Suela Silva, Monique; Naves Sales, Alenir; Teixeira Magalhães-Guedes, Karina; Ribeiro Dias, Disney; Schwan, Rosane Freitas

    2013-01-01

    A total of 2152 Actinobacteria strains were isolated from native Cerrado (Brazilian Savannah) soils located in Passos, Luminárias, and Arcos municipalities (Minas Gerais State, Brazil). The soils were characterised for chemical and microbiological analysis. The microbial analysis led to the identification of nine genera (Streptomyces, Arthrobacter, Rhodococcus, Amycolatopsis, Microbacterium, Frankia, Leifsonia, Nakamurella, and Kitasatospora) and 92 distinct species in both seasons studied (rainy and dry). The rainy season produced a high microbial population of all the aforementioned genera. The pH values of the soil samples from the Passos, Luminárias, and Arcos regions varied from 4.1 to 5.5. There were no significant differences in the concentrations of phosphorus, magnesium, and organic matter in the soils among the studied areas. Samples from the Arcos area contained large amounts of aluminium in the rainy season and both hydrogen and aluminium in the rainy and dry seasons. The Actinobacteria population seemed to be unaffected by the high levels of aluminium in the soil. Studies are being conducted to produce bioactive compounds from Actinobacteria fermentations on different substrates. The present data suggest that the number and diversity of Actinobacteria spp. in tropical soils represent a vast unexplored resource for the biotechnology of bioactives production. PMID:23555089

  19. Brazilian Cerrado Soil Actinobacteria Ecology

    Directory of Open Access Journals (Sweden)

    Monique Suela Silva

    2013-01-01

    Full Text Available A total of 2152 Actinobacteria strains were isolated from native Cerrado (Brazilian Savannah soils located in Passos, Luminárias, and Arcos municipalities (Minas Gerais State, Brazil. The soils were characterised for chemical and microbiological analysis. The microbial analysis led to the identification of nine genera (Streptomyces, Arthrobacter, Rhodococcus, Amycolatopsis, Microbacterium, Frankia, Leifsonia, Nakamurella, and Kitasatospora and 92 distinct species in both seasons studied (rainy and dry. The rainy season produced a high microbial population of all the aforementioned genera. The pH values of the soil samples from the Passos, Luminárias, and Arcos regions varied from 4.1 to 5.5. There were no significant differences in the concentrations of phosphorus, magnesium, and organic matter in the soils among the studied areas. Samples from the Arcos area contained large amounts of aluminium in the rainy season and both hydrogen and aluminium in the rainy and dry seasons. The Actinobacteria population seemed to be unaffected by the high levels of aluminium in the soil. Studies are being conducted to produce bioactive compounds from Actinobacteria fermentations on different substrates. The present data suggest that the number and diversity of Actinobacteria spp. in tropical soils represent a vast unexplored resource for the biotechnology of bioactives production.

  20. Case Study: Brazilian Virtual Herbarium

    Directory of Open Access Journals (Sweden)

    Cameron Neylon

    2017-10-01

    Full Text Available The Brazilian Virtual Herbarium (BVH is a project of the Brazillian Centro de Referência em Informação Ambiental (CRIA that has been running since 2009. The Virtual Herbarium provides an infrastructure that gathers digital records of plant specimens from primary source, mainly in Brazil, and makes them available through a central web portal. The source herbaria have complete control over what data is made through the portal and the data collected by BVH is made fully available. BVH in common with many data infrastructures, faces challenges in retaining funding. Most funding sources are project based and as has been noted elsewhere this creates problems for the sustaining of infrastructures. BVH therefore has an interest in demonstrating the use of the data resources it hosts. Through the OCSDNet project it has strengthened its capacity in this area to develop tools showing its wide usage. Overall the BVH hosts over eight million records (as of October 2017 and received 70 billion data requests in October 2017. Its users are mainly in Brazil but there is also substantial global usage. The primary uses are for research and education. There are a broad range of educational users, including universities but also schools. Through providing a central aggregation and access point BHV provides a data infrastructure that is greater – and more useful – than the sum of its parts.

  1. Case Study: Brazilian Virtual Herbarium

    Directory of Open Access Journals (Sweden)

    Cameron Neylon

    2017-10-01

    Full Text Available The Brazilian Virtual Herbarium (BVH is one of Brazil's National Institutes of Science and Technology (a program of the National Council for Scientific and Technological Development, CNPq that has been running since 2009. The Virtual Herbarium provides an infrastructure that gathers digital records of plant specimens from primary source, mainly in Brazil, and makes them available through a central web portal. The source herbaria have complete control over what data is made through the portal and the data collected by BVH is made fully available. BVH in common with many data infrastructures, faces challenges in retaining funding. Most funding sources are project based and as has been noted elsewhere this creates problems for the sustaining of infrastructures. BVH therefore has an interest in demonstrating the use of the data resources it hosts. Through the OCSDNet project it has strengthened its capacity in this area to develop tools showing its wide usage. Overall the BVH hosts over eight million records (as of October 2017 and received 70 billion data requests in October 2017. Its users are mainly in Brazil but there is also substantial global usage. The primary uses are for research and education. There are a broad range of educational users, including universities but also schools. Through providing a central aggregation and access point BHV provides a data infrastructure that is greater – and more useful – than the sum of its parts.

  2. The Brazilian electrical system reform

    International Nuclear Information System (INIS)

    Mendonca, A.F.; Dahl, C.

    1999-01-01

    Although the Brazilian electrical system has been a public monopoly, the threat of electricity shortages from a lack of investment triggered a comprehensive reform. In 1993 the government began a series of laws, decrees and regulations reforming the tariff policy, allowing privatization of utilities, foreign investments and independent power producers, and creating an independent transmission grid and a new electricity regulatory agency (ANEEL). The new regulatory framework is not completely defined but the proposed model intends to transform bulk electricity supply into a competitive market similar to that adopted in England. Our objective is to evaluate whether the proposed reform will succeed in attracting the required private capital, will allow an unregulated wholesale electricity market and will require a strict regulatory framework. The reform has been quite successful in privatizing the distribution companies but is allowing monopolistic rents, and has failed until now to attract private investments to expand generation capacity. The risk of blackouts has increased, and the proposed wholesale electricity market may not be appropriate because of barriers to constructing new hydroelectric units, now 90% of the system. Therefore, a new regulatory framework and a strong regulatory agency with a well-defined tariff policy should have preceded the privatization. (author)

  3. Implementation of the Brazilian national repository

    International Nuclear Information System (INIS)

    Tello, Cledola Cassia Oliveira de

    2013-01-01

    Ionizing radiation in Brazil is used in electricity generation, medicine, industry, agriculture and for research and development purposes. All these activities can generate radioactive waste. At this point, in Brazil, the use of nuclear energy and radioisotopes justifies the construction of a national repository for radioactive wastes of low and intermediate-level. According to Federal Law No. 10308, Brazilian National Commission for Nuclear Energy (CNEN) is responsible for designing and constructing the intermediate and final storages for radioactive wastes. Additionally, a restriction on the construction of Angra 3 is that the repository is under construction until its operation start, attaining some requirements of the Brazilian Environmental Regulator (IBAMA). The RBMN Project (Repository for Low and Intermediate-Level Radioactive Wastes) aims at the implantation of a National Repository for disposal of low and intermediate-level of radiation wastes. This Project has some aspects that are unique in the Brazilian context, especially referring to the time between its construction and the end of its institutional period. This time is about 360 years, when the area will be released for unrestricted uses. It means that the Repository must be safe and secure for more than three hundred years, which is longer than half of the whole of Brazilian history. This aspect is very new for the Brazilian people, bringing a new dimension to public acceptance. Another point is this will be the first repository in South America, bringing a real challenge for the continent. The current status of the Project is summarized. (author)

  4. Global power and Brazilian nuclear decisions

    International Nuclear Information System (INIS)

    Metri, Paulo

    2017-01-01

    Brazilian society declares no intention to development a nuclear artifact. This is on its Constitution. The submarine of nuclear propulsion may be used as a weapon of defense and, therefore, has a peaceful objective. Nationalism must be applied only to benefit the society. Nationalist attention has always been devoted, at various occasions, to the Brazilian nuclear sector. However, since Brazilian society has many needs and the Brazilian government always had numerous energy options, this sector has not been developed as it could be. Other successful applications of nuclear technology, besides electric generation, are not considered here. At present, the country is experiencing a moment of harassment of liberal forces. It is difficult to know if the population understands what is going on, due to the traditional media control. This media belongs to the capital. The rise and the fall of the nationalist strand in a country follow a global tendency and also depend of actions of the international capital. In nationalist periods, more decisions with positive social impact are taken. Therefore, sovereignty is necessary to increase the benefits to society. Unfortunately, the Brazilians deceived by the companies of mass communication and corrupt political leaderships allow the country to be dominated. Even the armed forces had their projects paralyzed. The nuclear sector, as all other, suffers with the low budget and the future is difficult to predict. (author)

  5. Citizenship and decoloniality in Brazilian education

    Directory of Open Access Journals (Sweden)

    Viviane Conceição Antunes

    2014-08-01

    Full Text Available Reflecting on the importance of multiculturalism in teaching process and observing the otherness are primarily a challenge. This enables us to rethink what we have within ourselves, also to reconstitute memories involving discriminatory and unethical attitudes, which takes place in social fellowship. Based on the studies of Walsh (2007, 2009, Gomes (2007 and Tavares (2011, this work relies on decoloniality studies, mainly on the relevance of the history of Africa and Africanness in Brazilian education. Our corpus of analysis is found in the "Diretrizes Curriculares Nacionais para a Educação Básica" (DCN, 2013, the Brazilian Legislative Syllabus for Basic Education. Our focus is on the chapters concerning the Native-Brazilian and Quilomboa Education and ethnic-racial relations. Our most important aims are: to show the intercultural theoretical framework in which they are based on; to understand the immediate link established between the Native-Brazilian education and intercultural perspective; to clarify how the African diaspora was carried out in this particular case. Based on some Excel resources we were able to: 1 stablish the predominance of functional framework of interculturalism throughout these chapters, along with some critical features of interculturalism, as the issue of curricular decoloniality; 2 observe the established relationship between bilingualism and multiculturalism in the guidelines of Native-Brazilian education; and 3 identify a search for an effective inclusion of Africanness in curricula supported by the historical recognition and visibility of their sociocultural contribution.

  6. Global power and Brazilian nuclear decisions

    Energy Technology Data Exchange (ETDEWEB)

    Metri, Paulo, E-mail: pmetri@terra.com.br [Clube de Engenharia, Rio de Janeiro, RJ (Brazil)

    2017-07-01

    Brazilian society declares no intention to development a nuclear artifact. This is on its Constitution. The submarine of nuclear propulsion may be used as a weapon of defense and, therefore, has a peaceful objective. Nationalism must be applied only to benefit the society. Nationalist attention has always been devoted, at various occasions, to the Brazilian nuclear sector. However, since Brazilian society has many needs and the Brazilian government always had numerous energy options, this sector has not been developed as it could be. Other successful applications of nuclear technology, besides electric generation, are not considered here. At present, the country is experiencing a moment of harassment of liberal forces. It is difficult to know if the population understands what is going on, due to the traditional media control. This media belongs to the capital. The rise and the fall of the nationalist strand in a country follow a global tendency and also depend of actions of the international capital. In nationalist periods, more decisions with positive social impact are taken. Therefore, sovereignty is necessary to increase the benefits to society. Unfortunately, the Brazilians deceived by the companies of mass communication and corrupt political leaderships allow the country to be dominated. Even the armed forces had their projects paralyzed. The nuclear sector, as all other, suffers with the low budget and the future is difficult to predict. (author)

  7. Brazilian quilombos: A repository of Amerindian alleles.

    Science.gov (United States)

    Gontijo, Carolina Carvalho; Guerra Amorim, Carlos Eduardo; Godinho, Neide Maria Oliveira; Toledo, Rafaela Cesare Parmezan; Nunes, Adriana; Silva, Wellington; Da Fonseca Moura, Maria Manuela; De Oliveira, José Carlos Coutinho; Pagotto, Rubiani C; Klautau-Guimarães, Maria De Nazaré; De Oliveira, Silviene Fabiana

    2014-01-01

    As a consequence of colonization of the Americas and decimation of the native population, an important portion of autochthonous genetic variation has been lost. However, some alleles have been incorporated into the growing populations of admixed mestizos. In this study, we evaluated the potential of African-derived communities in Brazil to be repositories of Amerindian alleles and, by extension, a source of information on American prehistory. In this study, we describe the genetic variation of 15 ancestry informative markers (AIMs) of autosomal origin in two quilombos, Brazilian populations mainly of African descent, Santo Antônio do Guaporé (SAG; N = 31), and Santiago do Iguape (STI; N = 37). We compared the AIMs from these populations to those of other African-Brazilian populations, and to the Distrito Federal (N = 168), an urban population representative of Brazilian genetic diversity. By admixture analysis, we found that the SAG and STI communities have a much higher proportion (over 40%) of Amerindian contribution to their gene pools than other admixed Brazilian populations, in addition to marked African contributions. These results identify two living African-Brazilian populations that carry unique and important genetic information regarding Amerindian history. These populations will be extremely valuable in future investigations into American pre-history and Native American evolutionary dynamics. Copyright © 2014 Wiley Periodicals, Inc.

  8. Directions and deviations in the Brazilian nuclear policy

    International Nuclear Information System (INIS)

    Leal, M.C.

    1982-01-01

    The emergence of the Brazilian nuclear policy as a subject of interest to the Brazilian society, the conflicts characterizing its formulation and implementation between 1945 and 1958 and the political criteria for executing a Brazilian nuclear program are presented. (M.C.K.) [pt

  9. Trends in water balance components across the Brazilian Cerrado

    Science.gov (United States)

    The Brazilian Cerrado (Savanna) is considered one of the most important biomes for Brazilian water resources; however, little is known about the components of the water balance in this biome. In this study, we reviewed the available literature on the water balance components in the Brazilian Cerrado...

  10. Productive structure of the Brazilian economy, 1960-198

    OpenAIRE

    Guilhoto, Joaquim José Martins

    1993-01-01

    Using the input output tables constructed for Brazil (1959, 1970, 1975, 1980) and the 1985 Brazilian industrial census, this paper has 2 basic goals: 1) to make a study of how the Brazilian economy changed in the period 1960-1985; 2) to make suggestions of how the Brazilian economy could return to its growth with equity.

  11. The Brazilian national system of forest permanent plots

    Science.gov (United States)

    Yeda Maria Malheiros de Oliveira; Maria Augusta Doetzer Rosot; Patricia Povoa de Mottos; Joberto Veloso de Freitas; Guilherme Luis Augusto Gomide; < i> et al< /i>

    2009-01-01

    The Brazilian National System of Forest Permanent Plots (SisPP) is a governmental initiative designed and being implemented in partnership by the Ministry of Environment (MMA), represented by the National Forest Programme (PNF) and the Brazilian Forest Service (SFB) and the Embrapa Forestry (a research center of the Brazilian Agricultural Research Corporation - Embrapa...

  12. Huntington disease: DNA analysis in brazilian population

    Directory of Open Access Journals (Sweden)

    RASKIN SALMO

    2000-01-01

    Full Text Available Huntington disease (HD is associated with expansions of a CAG trinucleotide repeat in the HD gene. Accurate measurement of a specific CAG repeat sequence in the HD gene in 92 Brazilian controls without HD, 44 Brazilian subjects with clinical findings suggestive of HD and 40 individuals from 6 putative HD families, showed a range from 7 to 33 repeats in normal subjects and 39 to 88 repeats in affected subjects. A trend between early age at onset of first symptoms and increasing number of repeats was seen. Major increase of repeat size through paternal inheritance than through maternal inheritance was observed. Data generated from this study may have significant implications for the etiology, knowledge of the incidence, diagnosis, prognosis, genetic counseling and treatment of HD Brazilian patients.

  13. THE INDIGENOUS GROUPS AND THE BRAZILIAN SWEETS

    Directory of Open Access Journals (Sweden)

    Mártin César Tempass

    2008-12-01

    Full Text Available In the books of Gilberto Freyre and Câmara Cascudo, that influencied so much the literature about brazilian alimentation, the participation of indigenous groups in the national sweets formation process is negligencied. However, is possible to find in book´s “interlineations” of these two authors valuables informations about indigenous contributions to this process. Starting from these two authors and based in the culinary system notion, this paper quests to situate the role of indigenous groups in the brazilian sweets formation and numbers the possibles causes to invisibility of sweets by indigenous at the culinary formation process.

  14. Huntington disease: DNA analysis in brazilian population

    OpenAIRE

    RASKIN, SALMO; ALLAN, NASSER; TEIVE, HÉLIO A.G.; CARDOSO, FRANCISCO; HADDAD, MÔNICA SANTORO; LEVI, GILBERTO; BOY, RAQUEL; LERENA JR, JUAN; SOTOMAIOR, VANESSA SANTOS; JANZEN-DÜCK, MÔNICA; JARDIM, LAURA BANNACH; FELLANDER, FLÁVIO R.; ANDRADE, LUIZ AUGUSTO FRANCO

    2000-01-01

    Huntington disease (HD) is associated with expansions of a CAG trinucleotide repeat in the HD gene. Accurate measurement of a specific CAG repeat sequence in the HD gene in 92 Brazilian controls without HD, 44 Brazilian subjects with clinical findings suggestive of HD and 40 individuals from 6 putative HD families, showed a range from 7 to 33 repeats in normal subjects and 39 to 88 repeats in affected subjects. A trend between early age at onset of first symptoms and increasing number of repe...

  15. TECHNOLOGY REPRESENTATION IN SOME BRAZILIAN POEMS

    Directory of Open Access Journals (Sweden)

    Rubel Maria Fanini

    2010-07-01

    Full Text Available Abstract: This article analyses how the universe of technology and labour are depicted in literary terms in some Brazilian poems from the writers Castro Alves, Mario de Andrade and Oswald de Andrade. The poets portray this universe in the following approaches: modern technology dissociated from the Brazilian context painted as traditional and archaic; associated to industrial production and to workers’ exploitation; linked to high class entertainment and as an imported good subjected to central capitalistic economies, facing difficulties to be aggregated to local production.

  16. Brazilianness: a Look at the Multiple Faces of the Brazilian National Identity

    Directory of Open Access Journals (Sweden)

    Mariana Bassi Sutter

    2015-08-01

    Full Text Available Over the past few years, Brazil has been gaining visibility internationally due to its increasing role in the global context. This leads to the interest, from society and academics, to better acknowledge the elements that characterize Brazilian culture. Therefore, the objective of this research is to understand the representations of Brazil's image and the diverse meanings of the Brazilianness concept though different views. Although the discussion about Brazilianness is not new, there are many interpretations about the characteristics that comprise national identity and culture, as well as those that make it unique. This research articulates the theoretical discussion about the theme, exploring what has already been presented by other authors on diverse fields as anthropology, sociology, social sciences, management and other areas. As such, the study was developed as an essay and gathers several visions on the theme, which is its main contribution. This study allows future studies with the use of the Brazilianness concept to managers and academics.

  17. Brazilian energy statistics - 1988. Annual bulletin of the Brazilian National Committee of the World Energy Conference

    International Nuclear Information System (INIS)

    1988-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydraulic energy, petroleum, natural gas and coal. It contains data on ethyl alcohol derived from sugar cane and some information about the Brazilian Action Plan for the petroleum sector, nuclear energy, ecology and Chernobyl. Graphs, annual statistics and long range data of electric power, petroleum and derivates, natural gas, coal and alcohol are also included. 19 figs., 15 tabs

  18. Vector competence of Brazilian Aedes aegypti and Ae. albopictus for a Brazilian yellow fever virus isolate.

    Science.gov (United States)

    Johnson, Barbara W; Chambers, Trudy V; Crabtree, Mary B; Filippis, Ana M B; Vilarinhos, Paulo T R; Resende, Marcelo C; Macoris, Maria de Lourdes G; Miller, Barry R

    2002-01-01

    Because the potential urban yellow fever (YF) mosquito vectors Aedes aegypti and Ae. albopictus are at historical highs in Brazil, both in terms of density and geographical range, we assessed the risk of an urban YF epidemic in Brazil. We evaluated and confirmed in a laboratory setting the vector competence of Brazilian Ae. aegypti for a currently circulating strain of YF virus, and investigated the potential for Brazilian Ae. albopictus to transmit YF.

  19. 2. Brazilian Congress on Cell Biology and 7. Brazilian Colloquium on Electron Microscopy - Abstracts

    International Nuclear Information System (INIS)

    1980-01-01

    Immunology, virology, bacteriology, genetics and protozoology are some of the subjects treated in the 2. Brazilian Congress on Cell Biology. Studies using radioisotopic techniques and ultrastructural cytological studies are presented. Use of optical - and electron microscopy in some of these studies is discussed. In the 7. Brazilian Colloquium on Electron Microscopy, the application of this technique to materials science is discussed (failure analysis in metallurgy, energy dispersion X-ray analysis, etc). (I.C.R.) [pt

  20. CNEN activities and brazilian nuclear power policy

    International Nuclear Information System (INIS)

    Costa, E.M. da

    1989-01-01

    The goal of the brazilian policy in nuclear power is to provide its use in a pacific way to promote the well being of our people. It is intended, as well, to finish the construction of Angra II and III and proceed with the implementation of the nuclear fuel cycle, progressively fomenting its nationalization. (A.C.A.S.)

  1. Myriam Krasilchik: A Brazilian Science Educator.

    Science.gov (United States)

    Bizzo, Nelio Marco Vincenzo; Kelly, Peter Joseph

    1991-01-01

    Tells the story of Brazilian science educator Myriam Krasilchik who, in 1990, became dean of the University of Sao Paolo's School of Education. She provided leadership in the creation of Science Teaching Centers in Brazil and has been active in international science education organizations. (SM)

  2. The Brazilian business and growth cycles

    Directory of Open Access Journals (Sweden)

    Chauvet Marcelle

    2002-01-01

    Full Text Available This paper uses several produceres to date and analyse the Brazilian business and growth cycles. In particular, a Markov switching model is fitted to quarterly and annual real production data. The smoothed probabilities of the Markov states are used as predictive rules to define different phases of cyclical fluctuations of real Brazilian production. The results are compared with different non-parametric rules. All methods implemented yield similar dating and reveal asymmetries across the different states of the Brazilian business and growth cycles, in which slowdowns and recessions are short and abrupt, while high growth phases and expansions are longer and less steep. The resulting dating of the Brazilian economic cycles can be used as a reference point for construction and evaluation of the predictive performance of coincident, leading, or lagging indicators of economic activity. In addition, the filtered probabilities obtained from the Markov switching model allow early recognition of the transition to a new business cycle phase, wich can be used, for example, for evaluation of the adequate strength and timing of countercyclical policies, for reassessment of projected sales or profits by businesses and investors, or for monitoring of inflation pressures.

  3. Uranium enrichment : global view and Brazilian perspectives

    International Nuclear Information System (INIS)

    Zouain, D.M.; Sakamoto, L.H.

    1981-12-01

    A global view of isotope enrichment involving a general description of process (technical-economical aspects and policy) and status in developing countries is done. An enrichment demand in function of the Brazilian Nuclear Program is evaluated, analyzing a probable market and a low market. The perspectives to attend this demand, are studied. (E.G.) [pt

  4. Transcultural Diabetes Nutrition Algorithm: Brazilian Application

    Directory of Open Access Journals (Sweden)

    Fabio Moura

    2015-09-01

    Full Text Available The prevalence of obesity, pre-diabetes, and type 2 diabetes (T2D is increasing worldwide, especially in the developing nations of South America. Brazil has experienced an exponential increase in the prevalence of these chronic non-communicable diseases. The rising prevalence is probably due to changing eating patterns, sedentary living, and a progressive aging of the population. These trends and their underlying causes carry untoward consequences for all Brazilians and the future of Brazilian public health and the healthcare system. Lifestyle changes that include healthy eating (nutrition therapy and regular physical activity (structured exercise represent efficient inexpensive measures to prevent and/or treat the aforementioned disorders and are recommended for all afflicted patients. Regrettably, the implementation of lifestyle changes is fraught with clinical and personal challenges in real life. The transcultural Diabetes Nutrition Algorithm (tDNA is a therapeutic tool intended to foster implementation of lifestyle recommendations and to improve disease-related outcomes in common clinical settings. It is evidence-based and amenable to cultural adaptation. The Brazilian Diabetes Association, Society of Cardiology and Ministry of Health guidelines for nutrition therapy and physical exercise were considered for the Brazilian adaptation. The resultant tDNA-Brazil and its underlying recommendations are presented and explained.

  5. Transcultural Diabetes Nutrition Algorithm: Brazilian Application.

    Science.gov (United States)

    Moura, Fabio; Salles, João; Hamdy, Osama; Coutinho, Walmir; Baptista, Deise Regina; Benchimol, Alexander; Marchetti, Albert; Hegazi, Refaat A; Mechanick, Jeffrey I

    2015-09-01

    The prevalence of obesity, pre-diabetes, and type 2 diabetes (T2D) is increasing worldwide, especially in the developing nations of South America. Brazil has experienced an exponential increase in the prevalence of these chronic non-communicable diseases. The rising prevalence is probably due to changing eating patterns, sedentary living, and a progressive aging of the population. These trends and their underlying causes carry untoward consequences for all Brazilians and the future of Brazilian public health and the healthcare system. Lifestyle changes that include healthy eating (nutrition therapy) and regular physical activity (structured exercise) represent efficient inexpensive measures to prevent and/or treat the aforementioned disorders and are recommended for all afflicted patients. Regrettably, the implementation of lifestyle changes is fraught with clinical and personal challenges in real life. The transcultural Diabetes Nutrition Algorithm (tDNA) is a therapeutic tool intended to foster implementation of lifestyle recommendations and to improve disease-related outcomes in common clinical settings. It is evidence-based and amenable to cultural adaptation. The Brazilian Diabetes Association, Society of Cardiology and Ministry of Health guidelines for nutrition therapy and physical exercise were considered for the Brazilian adaptation. The resultant tDNA-Brazil and its underlying recommendations are presented and explained.

  6. The Brazilian alcohol program - performance and difficulties

    International Nuclear Information System (INIS)

    Moreira, J.R.; Zylberstajn, D.

    1990-01-01

    The Brazilian Alcohol Program, designed with the aim of ethanol utilization as an alternative fuel to gasoline is, up to now, the only commercial example of alternative fuel use to replace oil derivatives for transport use. The success of the Program is widely known but several problems concerned with ethanol availability very frequently destabilize it. (author)

  7. Ten years of Brazilian ballast water management

    Science.gov (United States)

    Castro, Maria Cecilia Trindade; Hall-Spencer, Jason M.; Poggian, Cecília Fonseca; Fileman, Timothy W.

    2018-03-01

    In 2005, Brazil addressed the environmental challenges posed by ballast water through a unilateral regulation, called the Maritime Standard N° 20 (NORMAM-20), applied to all shipping in her waters. This world-leading decision was the culmination of a process that started during the 1990‧s. Here, we summarize how these ballast water regulations were brought in and adopted and present the findings of 10 years of enforcement (2005-2015) in 39 ports along the Brazilian coast. We show that compliance with the Brazilian standard has increased significantly since the regulations were implemented (p < 0.001). After five years of implementation, non-compliance decreased probably reflecting an increase in awareness of the Brazilian Standard and a shift in the shipping industry commitment to minimize and control the spread of invasive species through ballast water. The Brazilian experience shows that very high levels (97%) of compliance with ballast water management regulations can be made to work in a region of global importance to the maritime industry. In the last decade, the rules governing ballast water in Brazil have evolved to address the demands from the maritime community and to provide updates such as imminent requirements for the use of ballast water management systems on board ships. These regulations are rarely cited when ballast water regulations are discussed internationally, yet there is much to learn from the proactive approach taken by Brazil such as what is feasible and enforceable.

  8. Motor Acquisition Rate in Brazilian Infants

    Science.gov (United States)

    Lopes, Virlaine Bardella; de Lima, Carolina Daniel; Tudella, Eloisa

    2009-01-01

    This study used the Alberta Infant Motor Scale (AIMS) with the aim of characterizing motor acquisition rate in 70 healthy 0-6-month-old Brazilian infants, as well as comparing both emergence (initial age) and establishment (final age) of each skill between the study sample and the AIMS normative data. New motor skills were continuously acquired…

  9. Lizards of Brazilian Amazonia (Reptilia: Squamata)

    NARCIS (Netherlands)

    Avila-Pires, T.C.S.

    1995-01-01

    Eighty-nine species of lizards, six of which polytypic (forming a total of 97 taxa), are presently known from Brazilian Amazonia. This number includes six species and one subspecies described as new to science in this paper: Stenocercus fimbriatus, Lepidoblepharis hoogmoedi, Leposoma osvaldoi, L.

  10. Spirometry reference values in the Brazilian population.

    Science.gov (United States)

    Rufino, R; Costa, C H; Lopes, A J; Maiworm, A I; Maynard, K; Silva, L M R A; Dias, R M

    2017-03-02

    The aim of the present study was to provide new spirometry reference equations in a sample of the Brazilian population for the following parameters: forced vital capacity (FVC), forced expiratory volume in 1 second (FEV1), FEV1/FVC ratio, peak of expiratory flow (PEF), forced expiratory flow at 50% (FEF50%), 75% average vital capacity (FEF25-75%), and average forced expiratory flow time (FEFT). This was a prospective study using results from chest radiographs, electrocardiograms, and questionnaires to investigate the participants' respiratory symptoms, sedentarism, and comorbidities (Charlson comorbidity index). From December 2010 to July 2014, individuals were randomly selected from various locations in the state of Rio de Janeiro. All individuals were examined by a single technician in the morning at the laboratory, and performed the spirometry with the same spirometer. Spirometry values were tabulated for the creation of three equation models: linear regression, logarithmic regression, and logarithms through a method that incorporates the lambda, median, and coefficient of variation (LMS method). Initially, 7003 individuals from both genders were contacted, and 454 were recruited. The data from the new equations were compared with one Brazilian and eight international equations, resulting in a high correlation (r>0.9). The values derived from the LMS method and linear regression were very similar (P>0.5), and both could be used to acquire the reference values for Brazilian spirometry. Data derived from the equations of this study were different from the current Brazilian equation, which could be justified by the different method used.

  11. Bullying in Brazilian Schools and Restorative Practices

    Science.gov (United States)

    Grossi, Patricia Krieger; dos Santos, Andreia Mendes

    2012-01-01

    Bullying is a widespread phenomenon that affects many children and adolescents in Brazilian schools. A pilot research study was carried out in four schools (one private and three public) located in Porto Alegre, RS, Brazil. A combination of self-administered questionnaires and focus groups with students as well as interviews with teachers were…

  12. Earning management in Brazilian financial institutions

    Directory of Open Access Journals (Sweden)

    Adriana Bruscato Bortoluzzo

    2016-06-01

    Full Text Available ABSTRACT The present study aims to study earnings management in a significant sample of 123 banks in the Brazilian market between 2001 and 2012. Given the important role that banks play in a country's economy, it is important to understand that there are discretionary factors involved in the reporting of a financial institution's profitability. Credit provisioning guidelines for Brazilian financial institutions are described in Resolution 2682/99 of the National Monetary Council (Conselho Monetário Nacional. Because of the discretion allowed in this resolution, loan loss provision is used as instrument of earnings management, which is not an illegal practice, but this behavior does affect the risk perception of agents and analysts, and they should be aware of it and understand it. We found that credit provisioning is used as an earnings management mechanism to smooth the net income of Brazilian financial institutions. Brazilian banks tend to avoid not only negative net income pre-loan loss provisions and taxes, but also negative net income pre-loan loss provisions and taxes in relation to the previous period. Contrary to the previous studies, it is not clear if banks avoid lower net income pre-loan loss provisions and taxes than a given peer group.

  13. Selective logging in the Brazilian Amazon.

    Science.gov (United States)

    G. P. Asner; D. E. Knapp; E. N. Broadbent; P. J. C. Oliveira; M Keller; J. N. Silva

    2005-01-01

    Amazon deforestation has been measured by remote sensing for three decades. In comparison, selective logging has been mostly invisible to satellites. We developed a large-scale, high-resolution, automated remote-sensing analysis of selective logging in the top five timber-producing states of the Brazilian Amazon. Logged areas ranged from 12,075 to 19,823 square...

  14. Land Use Dynamics in the Brazilian Amazon

    Science.gov (United States)

    Robert Walker

    1996-01-01

    The articles presented in this special issue of Ecological Economics address the important theme of land use dynamics as it pertains to the Brazilian Amazon. Much environmental change is an ecological artifact of human agency, and such agency is often manifested in land use impacts, particularly in tropical areas. The critical problem of tropical deforestation is but...

  15. Anthropometry of Brazilian Air Force pilots.

    Science.gov (United States)

    da Silva, Gilvan V; Halpern, Manny; Gordon, Claire C

    2017-10-01

    Anthropometric data are essential for the design of military equipment including sizing of aircraft cockpits and personal gear. Currently, there are no anthropometric databases specific to Brazilian military personnel. The aim of this study was to create a Brazilian anthropometric database of Air Force pilots. The methods, protocols, descriptions, definitions, landmarks, tools and measurements procedures followed the instructions outlined in Measurer's Handbook: US Army and Marine Corps Anthropometric Surveys, 2010-2011 - NATICK/TR-11/017. The participants were measured countrywide, in all five Brazilian Geographical Regions. Thirty-nine anthropometric measurements related to cockpit design were selected. The results of 2133 males and 206 females aged 16-52 years constitute a set of basic data for cockpit design, space arrangement issues and adjustments, protective gear and equipment design, as well as for digital human modelling. Another important implication is that this study can be considered a starting point for reducing gender bias in women's career as pilots. Practitioner Summary: This paper describes the first large-scale anthropometric survey of the Brazilian Air Force pilots and the development of the related database. This study provides critical data for improving aircraft cockpit design for ergonomics and comprehensive pilot accommodation, protective gear and uniform design, as well as digital human modelling.

  16. Effects of Brazilian Schools on Student Learning

    Science.gov (United States)

    Soares, José Francisco; Alves, Maria Teresa Gonzaga; Xavier, Flavia Pereira

    2016-01-01

    The objective of this study is to evaluate the effect of Brazilian elementary schools on the chances of their students achieving at different levels of mathematics proficiency. Since student proficiency is classified at three levels--Insufficient, Basic and Proficient--the chosen model of analysis was the hierarchical multinomial model. The…

  17. [Brazilian colonization in the Paraguayan agricultural frontier].

    Science.gov (United States)

    Neupert, R F

    1991-04-01

    This work briefly describes Brazilian colonization of the Paraguayan agricultural frontier, analyzes factors responsible for expelling population from Brazil and for attracting Brazilians to Paraguay, and assesses the economic and social consequences of immigration to the area. Paraguay's vast and sparsely populated agricultural frontier in areas outside the Central subregion underwent a process of intense colonization from the early 1960s to the mid-1980s. The Paraguayan government initiated an ambitious colonization program in 1963 to increase production, relieve population pressure and subdivision of small parcels in the Central subregion, encourage agricultural modernization, and produce a more diversified agriculture. Paraguayan agriculture in the early 1960s suffered from excessive concentration of land in a few hands and resulting exclusion of around 3/4 of workers from ownership and from any possibility of obtaining credit to fund technological improvements. Results of studies 2 decades after implementation of the colonization plan suggest that it has failed in significant areas. Although a considerable population redistribution alleviated pressure in the Central subregion, it apparently resulted more from spontaneous movement of peasants outside the colonization areas than from the official program. Concentration of lands is now occurring in the colonization area. Assistance for agricultural modernization and diversification of production in the peasant sector has been minimal. On the other hand, production of soy, wheat, and cotton for export increased substantially, because of an entrepreneurial agriculture capitalized by foreign as well as national interests The unmet goals of the colonization program would have required structural reforms rather than simple spatial redistribution of the population. Many of the colonists in the 1970s were Brazilian families displaced by mechanized agriculture in the southern states of Parana, Santa Catarina, and Rio

  18. INTERNATIONALIZATION OF BRAZILIAN FRANCHISE CHAINS: A COMPARATIVE STUDY

    Directory of Open Access Journals (Sweden)

    Pedro Lucas de Resende Melo

    2015-04-01

    Full Text Available The primary goal of this paper is to comprehend the fundamental organizational differences between Brazilian franchise chains that only operate in the home market and Brazilian franchise chains that operate internationally. The sample chosen for this study comprehends 96 Brazilian franchises operating in the home market and 67 franchises with international operations; logistic regression was used to analyze data obtained from these sources. Our findings suggest that the development of a brand in international operations can be strategic for certain Brazilian franchise chains; this seems to be, however, a scarce resource for many franchises and it could be developed through international operations. With regard to the fees charged, the outcomes demonstrate that Brazilian franchises with international operations tend to charge lower fees from its franchisees to install new units. Regarding the monitoring and control of franchises, there is evidence that the monitoring capability is one of the determining factors in the development of Brazilian franchises international operations.

  19. Assessing gross motor development of Brazilian infants.

    Science.gov (United States)

    Gontijo, Ana Paula Bensemann; de Castro Magalhães, Lívia; Guerra, Miriam Queiroz Faria

    2014-01-01

    To determine whether the Alberta Infant Motor Scale (AIMS) requires reference values specific for Brazilian infants. A total of 660 (330 girls) healthy full-term infants from Belo Horizonte were assessed using the AIMS. Scores and percentile curves were compared with the Canadian reference values. Differences were found in the 5th percentile (9-<10 and 10-<11 months) and the 10th percentile (4-<5, 9-<10, and 10-<11 months) curves. No significant differences were found between sexes on the basis of the economic classification or the criteria of the Human Development Index. Primarily because of the corrections made to the 5th and 10th percentile curves, we recommend the use of the Brazilian infant data curves reported here for further studies conducted in Brazil. Because the Human Development Index of Belo Horizonte is similar to that for Brazil as a whole, the results of this study should be relevant for clinicians throughout Brazil.

  20. Analysis of the Brazilian Entrepreneurial Ecosystem

    Directory of Open Access Journals (Sweden)

    Edmundo Inácio Júnior

    2016-01-01

    Full Text Available The objective of this study was to analyze the Brazilian entrepreneurial ecosystem in the light of the National System of Entrepreneurship – NSE theory, through the implementation of the Global Entrepreneurship Index methodology – GEI. The study indicates that Brazil has low quality average institutional interaction. However, social context is the main bottleneck in the national entrepreneurial ecosystem. Differences between the performance quality of the institutional framework and social factors promote entrepreneurship low socioeconomic impact. The results of the article show that the Brazilian entrepreneurial ecosystem presents low internationalization of companies, innovation in pro- ducts and processes, formation of human capital and high-growth enterprises. The results of the article provide insights for decision makers on the factors that determine the opening of new businesses.

  1. TRADING FORWARD IN THE BRAZILIAN ELECTRICITY MARKET

    Directory of Open Access Journals (Sweden)

    Paulo Cesar Coutinho

    2013-01-01

    Full Text Available We study the interaction between forward and spot electricity markets in a scenario where buyers and sellers are price takers in the forward market and trade through marketers, who play a Cournot game. Our model’s main features come from the Brazilian electricity market, where a free contract market coexists with a regulated contract market, and the spot price is the output of a stochastic dynamic algorithm. We are able to show that the price of energy bought (sold forward decreases (increases with the number of marketers, and that, as a result, full hedging is achieved in the limit. We also investigate the effects on prices of changes in the number of market participants and in aggregate consumption and supply, an exercise that yields important policy recommendations for the Brazilian regulator.

  2. Marketing Approach of Brazilian Wind Energy Sector

    Directory of Open Access Journals (Sweden)

    Gustavo Henrique Silva de Souza

    2013-12-01

    Full Text Available Prospects for the wind energy market have proposed changes of focus to managerial issues. The objective of this article is to map the specific market factors from Brazilian wind energy industry, in order to develop reflections and considerations on the subject, towards to the managerial, strategic and commercial development of the sector. Through an exploratory methodology in empirical format, and by a SWOT analysis of Telescopic Observations Strategic Framework, were found results that show funding and grants determined by Brazilian government, as the big question of the wind energy industry marketing, allowing the economic viability of wind energy projects. Further, it appears that the wind energy industry is eager to investments and has great potential for new business, but there are problems within the producing companies which that have to be assessed, such as the competitiveness capability, the high equipment costs, the installation locations limitations and lack of specialized employees with specific skills and capacities.

  3. EDITORIAL: XVI Brazilian Colloquium on Orbital Dynamics

    Science.gov (United States)

    de Melo, Cristiano F.; Macau, Elbert E. N.; Prado, Antonio B. A.; Hetem Jnr, Annibal

    2013-10-01

    The XVI Brazilian Colloquium on Orbital Dynamics was held from 26-30 November 2012, at the Biazi Grand Hotel, Serra Negra, São Paulo, Brazil. The Brazilian Colloquia on Orbital Dynamics are scientific events that occur bi-annually and are designed to develop those areas of research in celestial mechanics, orbital dynamics, planetary science, fundamental astronomy, aerospace engineering, and nonlinear systems and chaos. The meeting has been held for 30 years and it brings together researchers, professors and students from South American and also from other continents. Acknowledgements National Council for Scientific and Technological Development - CNPq Coordination for the Improvement of Higher Level - CAPES São Paulo Research Foundation - FAPESP

  4. Representations of black people in Brazilian museums

    Directory of Open Access Journals (Sweden)

    Myrian Sepúlveda dos Santos

    2015-04-01

    Full Text Available This article investigates the different ways Brazilian museums have represented the issue of blackness. Concerning current exhibitions, three main aspects are considered: the silence and exaggeration of the race issue in museum exhibits; the representation of passivity of the black population in historical narratives, and, the over exposition of the suffering and humiliation of the black population during slavery. The main argument developed is that Brazilian racial democracy discourses involve discrimination at many different levels, since racism is reproduced by the intertwinement of narratives that were produced in different historical periods. It is important to notice that new narratives are not free from those which preceded them, and that old practices of discrimination survive within new representations of blackness.

  5. Persistence and transformations of Brazilian racism

    Directory of Open Access Journals (Sweden)

    Teresinha Bernardo

    2015-06-01

    Full Text Available The study of race relationships carried aout by the Author in São Paulo, Brazil, in three field researches, one of them still in progress, clearly shows the perpetuation of the racial democracy myth, one of the main pillars on which was developed the Brazilian national consciousness. However, the harmony between whites and blacks and between whites and indians is only apparent and although the Brazilians say they are not racist, the racism is very strong in Brazil, but is projected on the Other. At present there are two main schools of thought: those who affirm the existence of harmony between the different pillars of civil society, and those who affirm the existence of racism, sometimes covered but underlined by the policies of whitening of certain sectors of society.

  6. Zirconium oxide obtainment from brazilian zircon concentrate

    International Nuclear Information System (INIS)

    Ribeiro, S.; Martins, A.H.

    1991-01-01

    This work presents the experimental results of studies about alkaline melting, acid leaching and sulfation steps for obtention of zirconium oxide and partially stabilized zirconia by yttrium and rare-earth coprecipitation in chlorine medium, starting from the brazilian zircon concentrate. Using statistical methods of factorial design and the Packett-Burman approach, the results are discussed and the optimal conditions of the production steps were determined. (author)

  7. Aromatic compounds from three Brazilian Lauraceae species

    Energy Technology Data Exchange (ETDEWEB)

    Batista, Andrea Nastri de Luca; Batista Junior, Joao Marcos; Lopez, Silvia Noeli; Furlan, Maysa; Cavalheiro, Alberto Jose; Silva, Dulce Helena Siqueira; Bolzani, Vanderlan da Silva [UNESP, Araraquara, SP (Brazil). Inst. de Quimica. Dept. de Quimica Organica; Nunomura, Sergio Massayoshi [Instituto Nacional de Pesquisa da Amazonia (INPA), Manaus, AM (Brazil). Dept. de Produtos Naturais; Yoshida, Massayoshi [Centro de Biotecnologia da Amazonia, Manaus, AM (Brazil)

    2010-07-01

    Phytochemical investigations on three Brazilian Lauraceae species from the Cerrado region of Sao Paulo State, Ocotea corymbosa (Meins) Mez., O. elegans Mez. and Persea pyrifolia Nees and Mart. ex Nees resulted in the isolation of flavonoids, an ester of the 4-O-E-caffeoylquinic acid, an aromatic sesquiterpene besides furofuran lignans. This is the first chemical study on the leaves of Ocotea elegans and O. corymbosa as well as the first report of non-volatile compounds from Persea pyrifolia. (author)

  8. Aromatic compounds from three Brazilian Lauraceae species

    International Nuclear Information System (INIS)

    Batista, Andrea Nastri de Luca; Batista Junior, Joao Marcos; Lopez, Silvia Noeli; Furlan, Maysa; Cavalheiro, Alberto Jose; Silva, Dulce Helena Siqueira; Bolzani, Vanderlan da Silva

    2010-01-01

    Phytochemical investigations on three Brazilian Lauraceae species from the Cerrado region of Sao Paulo State, Ocotea corymbosa (Meins) Mez., O. elegans Mez. and Persea pyrifolia Nees and Mart. ex Nees resulted in the isolation of flavonoids, an ester of the 4-O-E-caffeoylquinic acid, an aromatic sesquiterpene besides furofuran lignans. This is the first chemical study on the leaves of Ocotea elegans and O. corymbosa as well as the first report of non-volatile compounds from Persea pyrifolia. (author)

  9. Cardiovascular health in Brazilian state capitals

    OpenAIRE

    Matozinhos, Fernanda Penido; Felisbino-Mendes, Mariana Santos; Gomes, Crizian Saar; Jansen, Ann Kristine; Machado, Ísis Eloah; Lana, Francisco Carlos Félix; Malta, Deborah Carvalho; Velaquez-Melendez, Gustavo

    2017-01-01

    Resume Objective: to estimate the prevalence of ideal cardiovascular health indicators in the Brazilian population, according to gender, age, education and region of residence. Method: cross-sectional study that used data from 41,134 participants of the Surveillance System of Risk and Protective Factors for Chronic Diseases by Telephone Survey (Vigitel). The ideal cardiovascular health assessment considers four behavioral factors: not smoking; body mass index less than 25 kg/m2; practicing ...

  10. Transcultural Diabetes Nutrition Algorithm: Brazilian Application

    OpenAIRE

    Fabio Moura; João Salles; Osama Hamdy; Walmir Coutinho; Deise Regina Baptista; Alexander Benchimol; Albert Marchetti; Refaat A. Hegazi; Jeffrey I. Mechanick

    2015-01-01

    The prevalence of obesity, pre-diabetes, and type 2 diabetes (T2D) is increasing worldwide, especially in the developing nations of South America. Brazil has experienced an exponential increase in the prevalence of these chronic non-communicable diseases. The rising prevalence is probably due to changing eating patterns, sedentary living, and a progressive aging of the population. These trends and their underlying causes carry untoward consequences for all Brazilians and the future of Brazil...

  11. Diagnosis of the Brazilian Nuclear Regulatory body

    International Nuclear Information System (INIS)

    Santos Gomes, Rogerio dos; Magalhaes Ennes Ennes, Edson Carlos

    2008-01-01

    This work has the objective to present the diagnosis of the existing structure in the Brazilian Government to ensure the radioprotection and nuclear safety in the country, being compared the current situation with the conclusions presented in another studies, carried through in last 30 years, with special attention in the existence of the necessary available to support and independence of the national regulatory body for the development of the regulatory inspections activities in the radioprotection and nuclear safety. (author)

  12. On the Brazilian energetic situation 1970 - 2030

    International Nuclear Information System (INIS)

    Lima, Maria Thereza da Silva Lopes; Souza, Marina Correa de; Flores, Tarcisio Santos; Cruz, Nathalia Gracielle da Silva; Diamantino, Hugo Duarte; Barroso, Livia Alves; Rocha, Bruna Almeida; Souza, Romulo Luiz Mendes; Ramos, Pedro Camilo; Macedo, Marcio Henrique Marques

    2015-01-01

    In this paper we report, first, the Brazilian energy situation from the major oil crisis in the 1970s.Next, we discuss the period from the 1980s until 2005.Finally, it is projected scenarios from recent past (2005-2013), to the future that begins today and runs until 2030.This is a work for educational purposes, in which we provide compiled data for school research in all levels. (author)

  13. Segmentation in the brazilian labor market

    OpenAIRE

    Botelho, Fernando; Ponczek, Vladimir Pinheiro

    2007-01-01

    This paper measures the degree of segmentation in the brazilian labor market. Controlling for observable and unobservable characteristics, workers earn more in the formal sector, which supports the segmentation hypothesis. We break down the degree of segmentation by socio-economic attributes to identify the groups where this phenomenon is more prevalent. We investigate the robustness of our findings to the inclusion of self-employed individuals, and apply a two-stage panel probit model using ...

  14. Semantic dementia: Brazilian study of nineteen cases

    OpenAIRE

    Senaha,Mirna Lie Hosogi; Caramelli,Paulo; Porto,Claudia Sellitto; Nitrini,Ricardo

    2007-01-01

    Abstract The term semantic dementia was devised by Snowden et al. in 1989 and nowadays, the semantic dementia syndrome is recognized as one of the clinical forms of frontotemporal lobar degeneration (FTLD) and is characterized by a language semantic disturbance associated to non-verbal semantic memory impairment. Objectives: The aim of this study was to describe a Brazilian sample of 19 semantic dementia cases, emphasizing the clinical characteristics important for differential diagnosis of t...

  15. Actualization of the Brazilian nuclear regulations

    International Nuclear Information System (INIS)

    Wieland, Patricia; Soares, Abner Duarte; Nogueira, Tindyua de Moraes; Monteiro, Iara Arraes; Pitta, Maria Adelia Rocha; Bruno, Natanael Carvalho; Pereira, Enneite Souza; Pinto, Marvio dos S.; Lidington, Regina Marcia Rocha; Rocha, Marco Aurelio Toledo

    2011-01-01

    The present work has the objective of making public the methodological approach adopted by the Brazilian Nuclear Energy Commission (CNEN) to create a nuclear normative structure up-dated and coherent. According to the Law 4118/62, 6189/74 and 7781/89, is the attribution the CNEN to establish specific guidelines for nuclear safety and radiological protection, and also do dictate safety norms through the emission of Resolutions

  16. Factors influencing competitive anxiety in Brazilian athletes

    OpenAIRE

    Marcos Gimenes Fernandes; Sandra Adriana Neves Nunes; José Vasconcelos Raposo; Helder Miguel Fernandes

    2013-01-01

    DOI: http://dx.doi.org/10.5007/1980-0037.2013v15n6p705 The study of factors influencing competitive anxiety, according to a multidimensional perspective and supported by valid instruments, is scarce among Brazilian athletes of different sports. The present study aims to: i) investigate the theoretical relationship between the different dimensions of the multidimensional theory of anxiety (i.e., cognitive anxiety, somatic anxiety and self-confidence); and ii) investigate the effects of gen...

  17. Sexuality education in Brazilian medical schools.

    Science.gov (United States)

    Rufino, Andrea Cronemberger; Madeiro, Alberto; Girão, Manoel João Batista Castello

    2014-05-01

    Sexuality education has been valued since the 1960s in medical schools worldwide. Although recent studies reaffirm the importance of incorporating sexuality into medical education, there are data gaps concerning how this happens in Brazil. To understand how Brazilian medical school professors teach sexuality in undergraduate courses. An exploratory, cross-sectional descriptive study was conducted. A total of 207 professors from 110 Brazilian medical schools responded to an online semistructured questionnaire about the characteristics of the sexuality-related topics offered. The main variables assessed were contact hours devoted to sexuality, disciplines in which sexuality topics were taught, sexuality-related course titles, and sexuality-related topics addressed. Questionnaires were tabulated and analyzed using descriptive statistics for frequency distribution. The response rate to the questionnaire was 77.2%. Almost all professors (96.3%) addressed sexuality-related topics mainly in the third and fourth years as clinical disciplines, with a 6-hour load per discipline. Gynecology was the discipline in which sexuality-related topics were most often taught (51.5%), followed by urology (18%) and psychiatry (15%). Sexuality-related topics were addressed mainly in classes on sexually transmitted diseases and AIDS (62.4%) and on the anatomy and physiology of the reproductive system (55.4%). About 25% of the professors reported teaching courses with a sexuality-related title. There was emphasis on the impact of diseases and sexual habits (87.9%) and sexual dysfunction (75.9%). Less than 50% of professors addressed nonnormative sexuality or social aspects of sexuality. The teaching of sexuality in Brazilian medical schools occurred in a nonstandardized and fragmented fashion across several disciplines. The topic was incorporated with an organic and pathological bias, with a weak emphasis on the social aspects of sexuality and the variety of human sexual behaviors. The

  18. Sorption of fomesafen in Brazilian soils

    OpenAIRE

    Silva,G.R.; D'Antonino,L.; Faustino,L.A.; Silva,A.A.; Ferreira,F.A.; Texeira,C.C.

    2013-01-01

    The study of the dynamics of a herbicide in the soil focus on the interactions with environmental components to obtain agronomic efficiency, ensuring selectivity to the culture and risk reduction of environmental impact. This study evaluated the sorption process of fomesafen in the Brazilian soils Ultisol, Cambisol, and Organosol. Besides soil, washed sand was used as an inert material for determination of the sorption ratio of fomesafen in the soil. The bioassay method was applied, using Sor...

  19. Homeschooling or schooling: responses from Brazilian Judiciary

    OpenAIRE

    Barbosa, Luciane Muniz

    2013-01-01

    This article aims to present the view of Brazilian judiciary on the homeschooling subject, analyzing the case of four families who have been affected by judicial process after decision to withdraw their children from school and teach them at home. Highlight the emphasis that is given to the school as an institution promoting not only academic knowledge, but also as a space for socializing and training for citizenship, fundamental themes for the homeschooling remains considered forbidden in Br...

  20. Older adults abuse in three Brazilian cities

    OpenAIRE

    Rodrigues, Rosalina Aparecida Partezani; Monteiro, Edilene Araújo; Santos, Ana Maria Ribeiro dos; Pontes, Maria de Lourdes de Farias; Fhon, Jack Roberto Silva; Bolina, Alisson Fernandes; Seredynskyj, Fernanda Laporti; Almeida, Vanessa Costa; Giacomini, Suelen Borelli Lima; Defina, Giovanna Partezani Cardoso; Silva, Luipa Michele

    2017-01-01

    ABSTRACT Objective: To analyze the police reports filed by older adults who suffered abuse in order to identify the socio-demographic characteristics of victims and aggressors, type of violence, location, as well as to compare rates in three Brazilian cities in the period from 2009 to 2013. Method: Ecological study, in which 2,612 police reports registered in Police Stations were analyzed. An instrument was used to obtain data from the victim, the aggressor and the type of violence. Result...

  1. HUMAN RESOURCE MANAGEMENT PRACTICES IN BRAZILIAN COMPANIES

    OpenAIRE

    Li, Y.

    2017-01-01

    The article considers the analysis of human resource management practices for Brazilian companies. The country-specific context and organizational behavior peculiarities of Brazil define the companies’ approach for HRM practices. The example of “CCR Group” is considered as a case study example. Analysis from company structure, culture specific context, current situation of human resource management not only in this company, but also in Brazil, in order to give the recommendation about how to ...

  2. Brazilian Soybean Policy: The International Effects of Intervention

    OpenAIRE

    Gary W. Williams; Robert L. Thompson

    1984-01-01

    This paper examines the effects of the complex set of Brazilian soybean sector policies on the world soybean and products market. Brazilian policy makers have intended to encourage domestic crushing of soybeans and exports of processed rather than raw soybeans. Removal of the Brazilian policy set for the period 1960–78 is simulated with an econometric model of the world soybean market. The results indicate that the intervention objectives were not achieved. Moreover, the U.S. soybean industry...

  3. INTERNATIONALIZATION OF BRAZILIAN FRANCHISE CHAINS: A COMPARATIVE STUDY

    OpenAIRE

    MELO,PEDRO LUCAS DE RESENDE; BORINI,FELIPE MENDES; OLIVEIRA JR,MOACIR DE MIRANDA; PARENTE,RONALDO COUTO

    2015-01-01

    The primary goal of this paper is to comprehend the fundamental organizational differences between Brazilian franchise chains that only operate in the home market and Brazilian franchise chains that operate internationally. The sample chosen for this study comprehends 96 Brazilian franchises operating in the home market and 67 franchises with international operations; logistic regression was used to analyze data obtained from these sources. Our findings suggest that the development of a brand...

  4. The nuclear importation and exportation - The Brazilian situation

    International Nuclear Information System (INIS)

    Coimbra, G.L.

    1985-01-01

    The panorama of Brazilian economy emphasizing the measurements adopted by Brazilian government referring to importation and exportation policy is presented. The Brazilian Nuclear Program knows the nuclear trade gives good economic perspective. In the context of importation and exportation policy the laws concerned to nuclear trade transactions, taxes, national organizations responsible by the external trade policy and their attributions are presented. (M.C.K.) [pt

  5. Brazilian in Spain: the labor market, unemployment and social security

    OpenAIRE

    Masanet, Erika; Centro de Investigação e Estudos de Sociologia (CIES), Lisboa, Portugal; Baeninger, Rosana; Universidade Estadual de Campinas (UNICAMP)

    2012-01-01

    The Brazilian migration to Spain has increased in recent years, contributing to the diversification of migration flows to the country. Since 2008 Spain has undergone a profound economic crisis. This paper aims to give an overview of the employment situation of recent Brazilian immigrant population in Spain and the changes associated with economic crisis. The analysis focuses on the insertion of Brazilians in the Spanish labor market and in the Spanish social protection system, as well as the ...

  6. [Profile of clinical trials enrolling Brazilian children].

    Science.gov (United States)

    Vieira, Jean Mendes de Lucena; Lima, Elisangela da Costa; Land, Marcelo Gerardin Poirot; Ventura, Miriam; Coelho, Helena Lutescia Luna

    2017-06-12

    This study aimed to characterize the clinical trials with medicines enrolling Brazilian children and adolescents, registered in the databases of Clinical Trials and the Brazilian Clinical Trials Network (ReBEC) from 1994 to 2014. Only 462 clinical trials enrolled Brazilian children and adolescents. There was an increase in registrations beginning in 2003, with an important drop in 2011. Among these trials, 35.5% were hosted in Brazil. The international clinical trials were mostly conducted by North American companies. In both cases, multinational industry was the principal source of funding. The clinical trials were predominantly phase III with injectable and solid oral pharmaceutical forms of antiviral drugs. Domestic clinical trials showed wider variation in the pharmaceutical forms and higher percentage of liquid formulations, when compared to the international trials. In addition to heavy external dependence for conducting clinical trials, the study emphasized the challenge for pediatric care in Brazil, which presents epidemiological peculiarities in an environment prone to the use of unlicensed medicines for children.

  7. The Brazilian Public Health in Contemporary Capitalism.

    Science.gov (United States)

    Junqueira, Virgínia; Mendes, Áquilas N

    2018-01-01

    This article examines some political and economic facts that led to an intensification of austerity measures by the Brazilian government, including ones against the Unified Health System (SUS) and its progressive dismantling. In a country where fundamental human rights were never fully respected, nowadays social and labor rights are under severe attacks. The deepening of the capital crisis and the rise of interest-bearing capital dominance have been causing unemployment, social insecurity growth, and resulting public fund appropriation by the private capital. The Brazilian governments in the 1990s and 2000s have implemented deeper cuts in social policy expenditure, freezing security benefits, privatizing services, and prioritizing the payment of public debt interests. The right wing's project involves the demoralization of not only the Workers' Party but also the left as a whole, so that the adoption of austerity measures could be achieved without popular resistance. It is the duty of the Brazilian left wing to denounce such a project and to provoke firm initiatives to rebuild its bonds with the working class.

  8. Indoor Air Quality in Brazilian Universities

    Directory of Open Access Journals (Sweden)

    Sonia R. Jurado

    2014-07-01

    Full Text Available This study evaluated the indoor air quality in Brazilian universities by comparing thirty air-conditioned (AC (n = 15 and naturally ventilated (NV (n = 15 classrooms. The parameters of interest were indoor carbon dioxide (CO2, temperature, relative humidity (RH, wind speed, viable mold, and airborne dust levels. The NV rooms had larger concentration of mold than the AC rooms (1001.30 ± 125.16 and 367.00 ± 88.13 cfu/m3, respectively. The average indoor airborne dust concentration exceeded the Brazilian standards (<80 µg/m3 in both NV and AC classrooms. The levels of CO2 in the AC rooms were significantly different from the NV rooms (1433.62 ± 252.80 and 520.12 ± 37.25 ppm, respectively. The indoor air quality in Brazilian university classrooms affects the health of students. Therefore, indoor air pollution needs to be considered as an important public health problem.

  9. Resistance Stories of African-Brazilian Women

    Directory of Open Access Journals (Sweden)

    Stela Nazareth Meneghel

    2005-01-01

    Full Text Available This study consists of an intervention using narrative workshops as a device to stimulate the empowerment of women. Ten women, victims of gender violence, took part in a workshop developed by non-governmental organization for African-Brazilian women Maria Mulher, which gives assistance to women living in Vila Cruzeiro do Sul, in the city of Porto Alegre. The main objective of the research was to debate questions related to gender and violence, making use of stories and histories related to the feminine, specifically African-Brazilian stories. Five meetings were held, where the women told and were told stories, took part in group discussions, experiences and rituals. The workshops gave those women a space where they could tell and hear stories, take part in the rituals of the orixás [African-Brazilian deities] of the black culture and tell their personal histories using those experiences. This intervention was an attempt at invoking different subjective experiences, and made it possible to empower the women who took part in the research, contributing for the rescue of the individual and collective memory of this group.

  10. Match analysis on no-gi Brazilian jiu-jitsu

    OpenAIRE

    Simola, Tuomas

    2017-01-01

    Gi and no-gi Brazilian jiu-jitsu are fast growing sports. The aim of this thesis is to conclude a match analysis on no-gi Brazilian jiu-jitsu. Match analysis is used to identify the most used techniques in no-gi Brazilian jiu-jitsu. There is no sport analysis done for either gi or no-gi Brazilian jiu-jitsu, therefore the match analysis and its results can be utilized later as a base for sport analysis. The goal of this study is to find out the match duration, the type of match ending, the...

  11. Brazilian energy statistics - 1990. Annual bulletin of the Brazilian National Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1990-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas and coal. It contains data on ethyl alcohol derived from sugar cane since it is of major importance in Brazil's energy scenario. The Brazilian Power Sector's Environmental Master Plan is also described including the expansion planning and the handling of socio-environmental issues; the power sector's evolution in the treatment of socio-environmental issues; the guidelines for socio-environmental planning and management and the institutional and technical development in the socio-environmental area. 15 figs., 16 tabs

  12. Brazilian energy statistics - 2002. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    2003-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas, nuclear energy and coal. It also contains data on ethyl alcohol derived of sugar cane since it is of special importance in Brazil's energy scenario

  13. Brazilian energy statistics - 1995. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1995-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas and coal. It also contains data on ethyl alcohol derived of sugar cane since it is of special importance in Brazil's energy scenario

  14. Brazilian energy statistics - 1998. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1998-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas and coal. It also contains data on ethyl alcohol derived of sugar cane since it is of special importance in Brazil's energy scenario

  15. Brazilian energy statistics - 2000. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    2001-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas, nuclear energy and coal. It also contains data on ethyl alcohol derived of sugar cane since it is of special importance in Brazil's energy scenario

  16. Brazilian energy statistics - 1999. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1999-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas, nuclear energy and coal. It also contains data on ethyl alcohol derived of sugar cane since it is of special importance in Brazil's energy scenario

  17. Brazilian energy statistics - 1991. Annual bulletin of the Brazilian National Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1991-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydraulic energy, petroleum, natural gas and coal. It contains data on ethyl alcohol derived from sugar cane since it is of special importance in Brazil's energy scenario. 13 figs., 22 tabs

  18. Brazilian energy statistics - 1994. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1994-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydraulic energy, petroleum, natural gas and coal. It also contains data on ethyl alcohol derived from sugar cane since it is of special importance in Brazil's energy scenario. 10 figs., 11 tabs

  19. Brazilian energy statistics - 1996. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1996-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydroelectric energy, petroleum, natural gas and coal. It also contains data on ethyl alcohol derived of sugar cane since it is of special importance in Brazil's energy scenario. Domestic production, petroleum and petroleum product imports, as well as natural gas production statistics are furnished in this bulletin

  20. Private Health Care Coverage in the Brazilian population, according to the 2013 Brazilian National Health Survey.

    Science.gov (United States)

    Malta, Deborah Carvalho; Stopa, Sheila Rizzato; Pereira, Cimar Azeredo; Szwarcwald, Célia Landmann; Oliveira, Martha; Reis, Arthur Chioro Dos

    2017-01-01

    This study aims to present the percentages of the Brazilian population holding health insurance plans, itemized by social-demographic characteristics, based on the data of the National Health Survey carried out in 2013, and to compare this information with the administrative data of the National Supplementary Health Agency for the same year. Data from the National Health Survey, and from the Beneficiaries Information System of the National Health Agency for the year 2013, were used. The percentage of people having a health plan was described according to stratification for: all of Brazil, urban/rural, Brazilian official Regions, Brazilian States and state capitals, gender, age group, level of schooling, position in the workforce, ethnic classification, and self-assessed state of health. Results include the following: The percentage of people saying they had some health plan in Brazil was 27.9% (CI 95%: 27.1-28.8). A significant difference was found relating to level of schooling - the percentage being highest for those who stated they had complete secondary education (68.8% CI 95%: 67.2-70.4) and for those who said they were currently in work (32.5% CI 95%: 31.5-33.5). The increase in health plan coverage in the Brazilian population reflects the improvement of the suply of employment and the growth in the country's economy.

  1. Effectiveness of business strategies in Brazilian textile industry

    OpenAIRE

    Paulo César de Sousa Batista; João Veríssimo de Oliveira Lisboa; Mário Gomes Augusto; Fátima Evaneide Barbosa de Almeida

    2016-01-01

    ABSTRACT This research analyses how the interaction between strategy capabilities, strategy types, strategy formulation quality and implementation capability affect organizational performance in Brazilian textiles companies. This article proposes and tests a conceptual framework, using a structural equation modeling of a set of 211 valid questionnaires on Brazilian textiles firms. The results support links between focus strategy and marketing capabilities, and between cost leadership strategy...

  2. An Optimality-Theoretic Analysis of Codas in Brazilian Portuguese

    Science.gov (United States)

    Goodin-Mayeda, C. Elizabeth

    2015-01-01

    Brazilian Portuguese allows only /s, N, l, r/ syllable finally, and of these, only /s/ is realized faithfully (as well as /r/ for some speakers). In order to avoid unacceptable codas, dialects of Brazilian Portuguese employ such strategies as epenthesis, nasal absorption, debucalization, and gliding. The current analysis argues that codas in…

  3. Cintia Moscovich's Brazilian View on Jewish Literary Themes ...

    African Journals Online (AJOL)

    This article focuses on the work of Cintia Moscovich, author of four books, and one of the very few Brazilian writers dealing with Jewish subjects. Her writings concentrate on the southern Brazilian state of Rio Grande do Sul, where Jewish immigration began 100 years ago. Unlike Jewish immigrants' literature in Yiddish or in ...

  4. The Afro-Brazilian Fetish Cults: Religious Syncretism.

    Science.gov (United States)

    Hedrick, B. C.

    1967-01-01

    This paper treats the Afro-Brazilian fetish cults found throughout Brazil and examines the syncretism of these cults with Catholicism. The religious practices of the "macumbas" (deities of the Afro-Brazilian cults), ritual music, and the ethnicity of the Negroes from both southern and northern Brazil are discussed. Frequently, excerpts…

  5. Watching Clone: Brazilian soap operas and Muslimness in Kyrgyzstan

    NARCIS (Netherlands)

    McBrien, J.

    2012-01-01

    In 2004 Clone, a Brazilian soap opera that featured Moroccans and Brazilians as main characters, broadcast throughout post-Soviet Central Asia. The program rose to tremendous popularity in the Kyrgyzstani town of BazaarKorgon partly due to the romanticism of its imagery. The town's residents said

  6. A Dictionary of Informal Brazilian Portuguese with English Index.

    Science.gov (United States)

    Chamberlain, Bobby J., Ed.; Harmon, Ronald M., Ed.

    This dictionary is intended to bridge the gap between the basic, generally simple language learned in the classroom and the preponderance of nonformal and idiomatic language used in Brazilian society on all levels and in contemporary Brazilian literature. It is the product of 15 years of systematic research involving interviews and conversations…

  7. Linguistic Policies, Linguistic Planning, and Brazilian Sign Language in Brazil

    Science.gov (United States)

    de Quadros, Ronice Muller

    2012-01-01

    This article explains the consolidation of Brazilian Sign Language in Brazil through a linguistic plan that arose from the Brazilian Sign Language Federal Law 10.436 of April 2002 and the subsequent Federal Decree 5695 of December 2005. Two concrete facts that emerged from this existing language plan are discussed: the implementation of bilingual…

  8. The Brazilian external individual monitoring scenario

    International Nuclear Information System (INIS)

    Mauricio, Claudia L.P.; Silva, Claudio R. da; Cunha, Paulo G. da

    2015-01-01

    In order to improve radiation protection it is necessary to have knowledge of the occupational radiation dose levels in all radiation facilities. This information comes from individual monitoring services, which are responsible for measuring and providing information about workers' radiation exposure. In 1981, the Comissao Nacional de Energia Nuclear (CNEN) of Brazil starts to develop a comprehensive system for regulation and storage of occupational radiation dose. This paper starts with an overview of the evolution of the Brazilian authorization and data storage system for external individual monitoring. It starts with a rule for authorization of all Brazilian photon individual monitoring services and the obligation for them to send the measured dose to CNEN. Up to now there is no regulation for neutron individual monitoring. The aim of this paper is to present the current scenario of the Brazilian external monitoring system, reinforcing its importance and remaining problems. The number of monitored workers greatly increases every year, having surpassed 150,000 people monitored. The stored data show that the mean annual occupational external dose is decreasing from 2.4 mSv in 1987 to about 0.6 mSv, in 2012, but there is still some not realistic very high dose measured (higher than 100 mSv), without investigation. About 80% of the annual dose values are lower than the monthly register level. As expected, the higher real photon doses are found in Nuclear Medicine, Industrial Radiology and Interventional Radiology. All recorded annual neutron dose values are lower than 20 mSv. (author)

  9. Smoking: what has been addressed in Brazilian journals.

    Science.gov (United States)

    Prado, Gustavo Faibischew; Lombardi, Elisa Maria Siqueira; Morais, Anna Miethke; Martins, Stella Regina; Santos, Ubiratan de Paula

    2012-12-01

    The topic of tobacco smoking, in its several aspects, has been receiving increasing attention among researchers over the past few years, which has been reflected in more data and more solid scientific literature on the subject in national journals. This article aims to review the studies that focused on smoking published between January 2010 and June 2012, in Arquivos Brasileiros de Cardiologia (Brazilian Archives of Cardiology), Brazilian Journal of Medical and Biological Research, Clinics (Sao Paulo), Jornal Brasileiro de Pneumologia (Brazilian Journal of Pulmonology), Revista da Associação Médica Brasileira (Journal of the Brazilian Medical Association) and Revista Brasileira de Cirurgia Cardiovascular (Brazilian Journal of Cardiovascular Surgery). During the aforementioned period 58 articles were published, 52 of which were original ones, addressing several aspects of smoking, such as effects on health, epidemiology, cessation and experimental studies.

  10. Necessity to review the Brazilian regulation about fluoride toothpastes

    Science.gov (United States)

    Cury, Jaime Aparecido; Caldarelli, Pablo Guilherme; Tenuta, Livia Maria Andaló

    2015-01-01

    The aim of this study was to evaluate the adequacy of the Brazilian legislation about fluoride toothpaste. A search was conducted in LILACS, Medline and SciELO databases about the fluoride concentration found in Brazilians toothpastes, using descriptors on health. Publications since 1981 have shown that some Brazilian toothpastes are not able to maintain, during their expiration time, a minimum of 1,000 ppm F of soluble fluoride in the formulation. However, the Brazilian regulation (ANVISA, Resolution 79, August 28, 2000) only sets the maximum total fluoride (0.15%; 1,500 ppm F) that a toothpaste may contain but not the minimum concentration of soluble fluoride that it should contain to have anticaries potential, which according to systematic reviews should be 1,000 ppm F. Therefore, the Brazilian regulation on fluoride toothpastes needs to be revised to assure the efficacy of those products for caries control. PMID:26487295

  11. The Argentine-Brazilian fast reactor programme

    International Nuclear Information System (INIS)

    Gho, C.J.; Mauricio, A.

    1989-01-01

    This paper summarizes the Argentine-Brazilian Fast Reactor Programme and gives reasons for the decision of a binational venture. The work carried out by both countries is described, showing how they complement each other, with the corresponding saving of resources. The main objectives of the Programme and tentative schedules in three progressing integrating stages are given and the present nuclear know-how in each country is identified as a good starting point. The paper also gives some details regarding the economical and human resources involved. (author). 1 graph

  12. Reverse logistics in the Brazilian construction industry.

    Science.gov (United States)

    Nunes, K R A; Mahler, C F; Valle, R A

    2009-09-01

    In Brazil most Construction and Demolition Waste (C&D waste) is not recycled. This situation is expected to change significantly, since new federal regulations oblige municipalities to create and implement sustainable C&D waste management plans which assign an important role to recycling activities. The recycling organizational network and its flows and components are fundamental to C&D waste recycling feasibility. Organizational networks, flows and components involve reverse logistics. The aim of this work is to introduce the concepts of reverse logistics and reverse distribution channel networks and to study the Brazilian C&D waste case.

  13. Women neurologist: a worldwide and Brazilian struggle

    Directory of Open Access Journals (Sweden)

    Marleide da Mota Gomes

    2011-10-01

    Full Text Available The main aim of this paper was to present some pioneer women neurologist, their struggle to pursue their career and the barriers mainly encountered at the beginning of their professional lives. It was also presented the progressive increasing of the feminine participation in medicine and in the neurology with study based on data of the School of Medicine of the Federal University of Rio de Janeiro and Brazilian Academy of Neurology. Their composition were analyzed according to gender, class and academic rank. In spite of this feminization, there is lack of a women's parallel advancement into leadership positions despite no visible barriers ("glass ceiling".

  14. Nickel exposure from keys: a Brazilian issue.

    Science.gov (United States)

    Suzuki, Nathalie Mie; Duarte, Ida Alzira Gomes; Hafner, Mariana de Figueiredo Silva; Lazzarini, Rosana

    2017-01-01

    Keys are a significant source of exposure to metal allergens and can be a relevant problem for nickel-allergic individuals. This study aimed to perform nickel and cobalt spot testing among the 5 most common Brazilian brands of keys. Among the tested keys, 100% showed positive result to nickel spot test, 83,3% presented strong positive reaction. 50% exhibited cobalt release as well. Nickel release from keys is very common in our country and may cause a negative impact on sensitized individual's quality of life. Study's results highlight the importance of establishing directives to regulate nickel release in Brazil.

  15. Brazilian energy balance 1996: calendar year 1995

    International Nuclear Information System (INIS)

    1996-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in every sector of the Brazilian economy, for the calendar year 1995. It's divided into nine sections, as follows: summary; energy supply and consumption by source; energy consumption by sector; energy foreign trading; transformation center balances ;energy resources and reserves; energy and socio economy; regional parameters; and appendices - installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances

  16. Historical origins of Brazilian relative backwardness

    Directory of Open Access Journals (Sweden)

    ALEXANDRE RANDS BARROS

    2015-03-01

    Full Text Available This paper relies on some data to identify the 19th century as the major period in which Brazil economy lagged behind some chosen benchmarking countries, as the USA, Canada, New Zealand, Australia and some European periphery countries. To identify the reasons for this an exercise using immigration data was used to make a decomposition of the sources of growth of the proportion of the USA per capita GDP to the Brazilian one. The results indicate that the imported human capital was responsible for 59% to 88% of this total growth between 1820 and 1900.

  17. Educational mediation in distance education: Brazilian research

    OpenAIRE

    Sousa, Carlos Ângelo de Meneses; Freitas, Lêda Gonçalves de

    2014-01-01

    The article refers to exploratory research conducted in Capes’ thesis banks, in the Brazilian Digital Library of Thesis and Dissertations, in SciELO Brasil and in Academic Google, on educational mediation in distance education. Two complementary perspectives stood out – the role of the professor-tutor and its relation with technological artifacts. They highlight the importance of educational mediation in distance education processes and point to didactical-educational elements that must be ef...

  18. Brazilian endogenous trade policy: 1991-1998

    Directory of Open Access Journals (Sweden)

    Geraldo Edmundo Silva Junior

    2011-12-01

    Full Text Available This paper presents an empirical contribution to the identification of Grossman-Helpman's "Protection for Sale" parameters model for Brazilian trade policy, based on robust estimations techniques, which means the use of instrumental variables in a 2SLS for Generalized Method of Moments and Limited Information Maximum Likelihood methods for weak instruments with corrections of size tests, in order to correct endogenous bias. The results suggest that the political economy of Brazil's trade policy is an outlier in international comparisons, as the identification of structural parameters for Protection for Sale model shows a low part of population represented by an interest group and low weight of the welfare function.

  19. Brazilian energy balance 1998: calendar year 1997

    International Nuclear Information System (INIS)

    1998-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in every sector of the Brazilian economy, for the calendar year 1995. It's divided into nine sections, as follows: summary; energy supply and consumption by source; energy consumption by sector; energy foreign trading; transformation center balances ;energy resources and reserves; energy and socio economy; regional parameters; and appendices - installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances

  20. BRAZILIAN EDUCATION AND SURVIVAL STRATEGIES OF CAPITALISM

    Directory of Open Access Journals (Sweden)

    Adriana Almeida Sales de Melo

    2012-06-01

    Full Text Available In discussing the theme Imperialism, Crisis and education, the essay points out aspects of our historical totality in relation to recent crises through which it passed capitalism, and its relationship to changes in Brazilian educational policies. Education remains at the heart of development projects, as a producer of knowledge, as well as guiding the processes of social conformation. They also discussed the aftermath of the crisis: the rise of social inequality and the increase of labor exploitation. Make clear our project of society and education, as resistance movements to the survival of capitalism is a necessity in building movements of counter-hegemony.

  1. Brazilian energy balance 1999: calendar year 1998

    International Nuclear Information System (INIS)

    1999-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in all the sectors of the Brazilian economy, for the calendar year 1998. It is divided into nine sections: a summary from 1983 to 1998; energy supply and demand by source; energy consumption by sector; energy foreign trading; transformation centers balances; energy resources and reserves; energy and socio-economy; regional parameters, and appendices including installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances

  2. Brazilian energy balance 1995: calendar year 1994

    International Nuclear Information System (INIS)

    1995-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in all the sectors of the Brazilian economy, for the calendar year 1998. It is divided into nine sections: a summary from 1979 to 1994; energy supply and demand by source; energy consumption by sector; energy foreign trading; transformation centers balances; energy resources and reserves; energy and socio-economy; regional parameters, and appendices including installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances

  3. Brazilian energy balance 1997: calendar year 1996

    International Nuclear Information System (INIS)

    1997-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in all the sectors of the Brazilian economy, for the calendar year 1998. It is divided into nine sections: a summary from 1981 to 1996; energy supply and demand by source; energy consumption by sector; energy foreign trading; transformation centers balances; energy resources and reserves; energy and socio-economy; regional parameters, and appendices including installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances

  4. Brazilian energy balance 2000: calendar year 1999

    International Nuclear Information System (INIS)

    2000-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in all the sectors of the Brazilian economy, for the calendar year 1999. It is divided into nine sections: a summary from 1984 to 1999; energy supply and demand by source; energy consumption by sector; energy foreign trading; transformation centers balances; energy resources and reserves; energy and socio-economy; regional parameters, and appendices including installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances

  5. The Brazilian programme for labelling photovoltaic systems

    Energy Technology Data Exchange (ETDEWEB)

    Galdino, Marco Antonio; Lima, Jorge Henrique [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)], E-mail: marcoag@cepel.br; Novgorodcev, Alexandre [Instituto Nacional de Metrologia, Normalizacao e Qualidade Industrial (PBE/INMETRO), Brasilia, DF (Brazil). Programa Brasileiro de Etiquetagem; Zilles, Roberto [Universidade de Sao Paulo (IEE/USP), SP (Brazil). Inst. de Eletrotecnica e Energia; Zanesco, Izete; Moehlecke, Adriano [Pontificia Universidade Catolica do Rio Grande do Sul (PUCRS), Porto Alegre, RS (Brazil); Krenzinger, Arno [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil); Orlando, Alcir de Faro [Pontificia Universidade Catolica do Rio de Janeiro (PUC-Rio), Rio de Janeiro, RJ (Brazil)

    2003-07-01

    A great increase in the installation of stand-alone PV systems for rural electrification is expected in Brazil for the next years due to a government program named Luz para Todos. However, there is a major concern for the quality of the equipment and systems to be acquired and installed, which led to an initiative, coordinated by INMETRO - Brazilian Institute for Metrology, Standardisation and Industrial Quality (Instituto Brasileiro de Metrologia, Normalizacao e Qualidade Industrial), joining several institutions to establish a programme for labelling these equipment. The adopted requirements are discussed in the present article. (author)

  6. Food in African Brazilian Candomblé

    OpenAIRE

    Patricia Rodrigues de Souza

    2015-01-01

    The aim of this article is to highlight the importance of food in the rituals of African Brazilian Candomblé, as well as in its cosmovision (world view). A brief description of Candomblé’s historical trajectory is provided in order to show how food offerings became part of its rituals and how specific ingredients became symbolically significant in this belief system. According to the theories applied, it is possible that food has at least two functions in Candomblé: to materialize principles ...

  7. The thermoluminescent properties of Brazilian topaz

    International Nuclear Information System (INIS)

    Lima, C.A.F.; Rosa, L.A.R.; CUNHA, P.G.

    1986-01-01

    The TL properties of Brazilian topaz were investigated. The flow curve up to 573K presents peaks close to 373, 403, 473 and 523 K. A linear response from 7 to at least 10 4 mGy is observed. The TL sensitivity is about 150 times lower than that of LiF-TL 100 Harshaw. The fading behaviour was investigated during a period of 15 days, at room temperature. the third peak intensity, after 24 h, becomes 80% of its initial value and then seems to stabilize. (author)

  8. Brazilian exchange rate complexity: Financial crisis effects

    Science.gov (United States)

    Piqueira, José Roberto C.; Mortoza, Letícia Pelluci D.

    2012-04-01

    With the financial market globalization, foreign investments became vital for the economies, mainly in emerging countries. In the last decades, Brazilian exchange rates appeared as a good indicator to measure either investors' confidence or risk aversion. Here, some events of global or national financial crisis are analyzed, trying to understand how they influenced the "dollar-real" rate evolution. The theoretical tool to be used is the López-Mancini-Calbet (LMC) complexity measure that, applied to real exchange rate data, has shown good fitness between critical events and measured patterns.

  9. Transitivity in Brazilian Greenpeace's electronic bulletins

    Directory of Open Access Journals (Sweden)

    Rodrigo Esteves de Lima-Lopes

    2014-05-01

    Full Text Available This article aims to analyse transitivity choices in 21 Greenpeace electronic bulletins written in Brazilian Portuguese. The theoretical framework is based on Systemic-Functional Grammar (HALLIDAY, 1994; HALLIDAY & MATTHIESSEN, 1999, 2004. Corpus Linguistics was the main methodological tool, in which concordancers and a tag system were applied. As results indicated, these texts draw a textual representation in which each of the text entities plays a specific role. People affiliated with Greenpeace, for example, are commonly portrayed as advocates of green causes, while companies are commonly represented as villains who care nothing about the environment. Each of these representations is accompanied by specific grammatical patterns.

  10. ESR dating of teeth from Brazilian megafauna

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, L C; Kinoshita, A; Barreto, A M F; Figueiredo, A M; Silva, J L L; Baffa, O, E-mail: lcoliveira@biomag.usp.b

    2010-11-01

    The study of radiation defects created in biomaterials, such as bone and teeth, can be used in dating with importance to palaeontology and archaeology. Two Stegomastodon teeth (AL1 and AL2) from north-eastern Brazilian megafauna were studied by electron spin resonance (ESR) spectroscopy. The samples were collected in Fazenda Ovo da Ema, (913349 / 3714965) UTM, Alagoas state, Brazil. The dating of these samples can contribute to the better knowledge of megafauna presence in this region as well as to the events associated to the extinction of these species.

  11. The Brazilian deindustrialization: financialization is not guilty

    Directory of Open Access Journals (Sweden)

    MYLÈNE GAULARD

    2015-06-01

    Full Text Available The financialization of the Brazilian economy is often criticized as being responsible of the slowdown of capital accumulation in this country. Indeed, very high interest rates are maintained in order to finance the public debt, and this fosters capitalists to get more Treasury bonds rather than to invest in the productive area. Nevertheless, the evolution of the profit rate in this area also explains the particular relation existing between capitalists, finance and productive investment, as Marx showed it more than a century ago.

  12. Brand Personality Dimensions in the Brazilian Context

    Directory of Open Access Journals (Sweden)

    Karlan Muller Muniz

    2012-04-01

    Full Text Available Brands may be perceived as possessing a set of distinct traits or characteristics, i.e., a personality, similar to aperson. Thus, the personality of a brand is relevant as a source of differentiation in an increasingly competitivemarket environment. In this study, the authors explore the dimensions of brand personality proposed by J. Aaker(1997, seeking to discover the particular evaluation dimensions of the Brazilian context. The study wasconducted in exploratory stages, beginning with a preparatory stage that was carried out by professionals andacademics from the fields of communication and marketing. This was followed by stages of conclusive researchusing an online survey with a sample of 1,302 Brazilian consumers. Two sub-samples were extracted: onecalibration sample for exploratory factor analysis and a validation sample to perform confirmatory factoranalysis in order to verify the convergent and discriminant validities of the final scale. Five dimensions of brandpersonality in Brazil were detected: credibility, joy, audacity, sophistication and sensitivity. These dimensionsshowed some differences in comparison with similar studies that had been carried out in other countries. Thestudy led to a scale of 28 items for measuring brand personality and made it possible to compare competingbrands in terms of brand personality.

  13. International HR Strategy of Brazilian Technology Multinationals

    Directory of Open Access Journals (Sweden)

    Patricia Morilha Muritiba

    2010-10-01

    Full Text Available Four cases of Brazilian Multinationals from the information technology [IT] sector were compared in their international Human Resources strategy. The analysis is focused on the development and application of two research models. One analyzes the level of subsidiary autonomy in terms of strategic HR decisions, including difficult decisions regarding coordination in multinationals, following the theoretical approach of the autonomy of subsidiaries (Kidger, 2002; Nohria & Ghoshal, 1997. The other is related to the level of internationalization of HR strategies, defined as the capacity to take advantage of globalization, providing the best resources for the company regardless of where they are located (Sparrow, 2007. Both models were applied in a multiple case study method (Eisenhardt, 1989. Data were collected through semi-structured interviews and company reports, and analyzed through content analysis. The results show: (a a more centralizing characteristic of the multinational companies examined, despite the limitations of this choice as shown by the literature; and (b that Brazilian IT multinationals tend to rely more on their national competencies when managing human resources instead of going global to aggregate differentiated competencies.

  14. Brazilian law for scientific use of animals.

    Science.gov (United States)

    Marques, Ruy Garcia; Morales, Marcelo Marcos; Petroianu, Andy

    2009-01-01

    The Brazilian scientific community claimed for a definitive systematization and for comprehensive and realistic national rules, to provide guidance and regulation, instead of sanctions, so that the question of scientific research involving animals could be better contemplated. This is beginning to occur now with Law no. 11.794, sanctioned by the President of the Republic on November 8, 2008. To describe the evolution of Brazilian regimentation for scientific use of animals and to analyze Law no. 11.794. The legislation about the use of animals in teaching and in scientific research in Brazil and in Rio de Janeiro State was identified and discussed. Until now, there was no updated general and systematizing rule regarding animal vivisection and experimentation for didactic or scientific purposes. The only specific law dates back to 1979 and was not regimented. More recent laws equated the practice of scientific experiments to acts of abuse and mistreatment of animals, when alternative technology was available. Municipal laws that restricted the scientific practice of vivisection and experimentation with animals were created in the cities of Rio de Janeiro and Florianopolis. With the claim and collaboration of the scientific community, the sanction of Law no. 11.794 regarding the scientific use of animals represented an invaluable advance in spite of the presence of some points that eventually may require another type of treatment. The new Law states that it will be regimented within 180 (one-hundred-and-eighty) days, when some of these points could be better elucidated.

  15. The citation pattern of Brazilian economists

    Directory of Open Access Journals (Sweden)

    João Ricardo Faria

    2007-03-01

    Full Text Available This paper studies the determinants of international citations by Brazilian economists in papers published in the top domestic journals in 1994 and 2004. Brazilian research in economics has become more open to international influence and widespread geographically; researchers more specialized and technically oriented and the research topics more diversified. However, Brazil is plagued by editorial favoritism, reflected in the negative and significant impact of references to the works authored by domestic journals editors on international citations. We also find that longer technical papers written on topics other than the economic history of Brazil are more likely to cite foreign literature.Este artigo estuda os determinantes das citações internacionais dos economistas brasileiros em artigos publicados nas principais revistas domésticas de economia nos anos 1994 e 2004. A pesquisa de economia no Brasil se tornou mais aberta à influencia internacional e mais espalhada geograficamente; os pesquisadores mais especializados e tecnicamente orientados e os tópicos de pesquisa mais diversificados. Entretanto, a pesquisa continua sendo prejudicada pelo favoritismo editorial, refletido no impacto negativo e significante das referências dos autores aos trabalhos dos editores das revistas domésticas sobre as citacoes internacionais. Constatamos que artigos técnicos mais longos sobre tópicos que não sejam sobre história econômica do Brasil têm maior chance de citar a literatura internacional.

  16. Brazilian obesity prevention and control initiatives.

    Science.gov (United States)

    Jaime, P C; da Silva, A C F; Gentil, P C; Claro, R M; Monteiro, C A

    2013-11-01

    Obesity prevalence in the Brazilian adult population is 12.5% among men and 16.9% among women. Obesity control has been a subject of concern in Brazilian health policies since the publication of the National Food and Nutrition Policy in 1999. The initiatives include a comprehensive national intersectorial plan for obesity prevention and control focused on confronting its social and environmental causes, development of a food and nutrition education framework aimed at intersectorial public policies in the food and nutritional security field, promotion and provision of healthy food in school environments (linked to family farming), structuring nutrition actions in primary healthcare in the national healthcare system, promoting community physical activity, food regulation and control, and encouragement of public participation and food control. We conclude that several initiatives have been developed in Brazil to deal with the challenge of implementing an intergovernmental, intersectorial response to reverse the rising overweight and obesity rates. The success of this response will depend on a governance model that promotes joint and integrated action by different sectors and active participation of society to consolidate the actions, places and laws that protect health and promote healthy lifestyles. © 2013 The Authors. Obesity Reviews published by John Wiley & Sons Ltd on behalf of the International Association for the Study of Obesity.

  17. Protein Quality of Irradiated Brazilian Beans

    Science.gov (United States)

    Delincée, Henry; Villavicencio, Anna-Lucia C. H.; Mancini-Filho, Jorge

    1998-06-01

    Beans are a major source of dietary protein in Brazil. However, high losses due to insect infestation occur after each harvest. To combat these losses, radiation processing of beans offers promise as an alternative to chemical treatment, provided the nutritional quality of beans is not impaired by the radiation treatment. Conflicting results have been published about the effect of radiation on the biological value of legume proteins. Therefore, two varieties of Brazilian beans were studied: 1) Phaseolus vulgaris L., var. carioca and 2) Vigna unguiculata (L.) Walp, var. macaçar. The beans were irradiated with doses of 0, 0.5, 1.0, 2.5, 5.0 and 10 kGy. Since irradiated beans will be consumed after appropriate storage, the beans under study were stored for 6 months at ambient temperature. Protein quality was measured by a biological assay employing the nitrogen balance approach in weanling rats. The animals were fed with optimally cooked beans, which were the only source of protein (˜10%). Nitrogen contents of legumes, diets, animal urine and faeces were determined by Kjeldahl analysis. The indices for apparent protein quality: net protein utilisation, digestibility and biological value were not influenced by irradiation. Thus, radiation treatment of Brazilian beans offers considerable promise as an effective insect disinfection process, without impairing the biological quality of the valuable bean protein.

  18. Demand for Life Annuities: a Brazilian Perspective

    Directory of Open Access Journals (Sweden)

    Thalita Amorim Vaz

    2012-10-01

    Full Text Available Because pension plans have been marketed using outdated technical premises, Brazilian insurance companies find themselves required to identify additional resources to ensure their ability to meet future benefit payments obligations. When calculating the additional amount of this provision, the parameters used are: mortality and disability decrements, the structure of interest rates, financial performance, cancellation fees and conversion rates. The aim of this study is to present the estimation of conversion rates based on a Probit Model. The data for this study was obtained through the transfer of restricted data from the portfolio of a company with relevant activity in the Brazilian insurance market, including a group of 14,511 individuals eligible for retirement in the period between January 1, 2005 and December 31, 2009. The resulting analysis of the data allows us to conclude that two factors — the volume of accumulated reserves and the classification of prices as actuarially fair —increase the propensity of an individual to convert resources upon retirement. In turn, retirement age and the need for liquidity reduce the propensity to convert resources upon retirement.

  19. The Brazilian education system. Students with disabilities

    Directory of Open Access Journals (Sweden)

    Roberto Dainese

    2010-07-01

    Full Text Available The Brazilian education system provides a specific form of organization for the inclusive education of students with disabilities. Law No. 9394 dated December 20, 1996, “Lei de diretrizes e bases da educação nacional”, presents in Chapter V the “educação especial" as a form of organization offered to students "portadores de Necessidades especiais”. Admission of students with disabilities in the Brazilian schools was characterized by several phases: the welfarist phase, the integration phase and the inclusion phase, which is the most recent one and now being debated. The presence of a special device fosters the differences, even when everybody enters the classbecause a separation perspective damps down all the procedural and design efforts towards a true integration, holding back collaboration and action sharing among teachers. We consider however effective an action that accompanies the gradual learning evolution mediating between the student with disabilities and peers, between him and the teachers, between him and the learning tools designed.

  20. Antimicrobial resistance among Brazilian Corynebacterium diphtheriae strains

    Directory of Open Access Journals (Sweden)

    Gabriela Andrade Pereira

    2008-08-01

    Full Text Available The increasing problems with multidrug resistance in relation to Corynebacterium, including C. diphtheriae, are examples of challenges confronting many countries. For this reason, Brazilian C. diphtheriae strains were evaluated by the E-Test for their susceptibility to nine antibacterial drugs used in therapy. Resistance (MIC < 0.002; 0.38 µg/ml to penicillin G was found in 14.8% of the strains tested. Although erythromycin (MIC90 0.75 µg/ml and azithromycin (MIC90 0.064 µg/ml were active against C. diphtheriae in this study, 4.2% of the strains showed decreased susceptibility (MIC 1.0 µg/ml to erythromycin. Multiple resistance profiles were determined by the disk diffusion method using 31 antibiotics. Most C. diphtheriae strains (95.74% showed resistance to mupirocin, aztreonam, ceftazidime, and/or oxacillin, ampicillin, penicillin, tetracycline, clindamycin, lincomycin, and erythromycin. This study presents the antimicrobial susceptibility profiles of Brazilian C. diphtheriae isolates. The data are of value to practitioners, and suggest that some concern exists regarding the use of penicillin.

  1. Protein Quality of Irradiated Brazilian Beans

    International Nuclear Information System (INIS)

    Delincee, Henry; Villavicencio, Anna-Lucia C.H.; Mancini-Filho, Jorge

    1998-01-01

    Beans are a major source of dietary protein in Brazil. However, high losses due to insect infestation occur after each harvest. To combat these losses, radiation processing of beans offers promise as an alternative to chemical treatment, provided the nutritional quality of beans is not impaired by the radiation treatment. Conflicting results have been published about the effect of radiation on the biological value of legume proteins. Therefore, two varieties of Brazilian beans were studied: 1) Phaseolus vulgaris L., var. carioca and 2) Vigna unguiculata (L.) Walp, var. macacar. The beans were irradiated with doses of 0, 0.5, 1.0, 2.5, 5.0 and 10 kGy. Since irradiated beans will be consumed after appropriate storage, the beans under study were stored for 6 months at ambient temperature. Protein quality was measured by a biological assay employing the nitrogen balance approach in weanling rats. The animals were fed with optimally cooked beans, which were the only source of protein (∼10%). Nitrogen contents of legumes, diets, animal urine and faeces were determined by Kjeldahl analysis. The indices for apparent protein quality: net protein utilisation, digestibility and biological value were not influenced by irradiation. Thus, radiation treatment of Brazilian beans offers considerable promise as an effective insect disinfestation process, without impairing the biological quality of the valuable bean protein

  2. Protein Quality of Irradiated Brazilian Beans

    Energy Technology Data Exchange (ETDEWEB)

    Delincee, Henry; Villavicencio, Anna-Lucia C.H.; Mancini-Filho, Jorge

    1998-06-01

    Beans are a major source of dietary protein in Brazil. However, high losses due to insect infestation occur after each harvest. To combat these losses, radiation processing of beans offers promise as an alternative to chemical treatment, provided the nutritional quality of beans is not impaired by the radiation treatment. Conflicting results have been published about the effect of radiation on the biological value of legume proteins. Therefore, two varieties of Brazilian beans were studied: 1) Phaseolus vulgaris L., var. carioca and 2) Vigna unguiculata (L.) Walp, var. macacar. The beans were irradiated with doses of 0, 0.5, 1.0, 2.5, 5.0 and 10 kGy. Since irradiated beans will be consumed after appropriate storage, the beans under study were stored for 6 months at ambient temperature. Protein quality was measured by a biological assay employing the nitrogen balance approach in weanling rats. The animals were fed with optimally cooked beans, which were the only source of protein ({approx}10%). Nitrogen contents of legumes, diets, animal urine and faeces were determined by Kjeldahl analysis. The indices for apparent protein quality: net protein utilisation, digestibility and biological value were not influenced by irradiation. Thus, radiation treatment of Brazilian beans offers considerable promise as an effective insect disinfestation process, without impairing the biological quality of the valuable bean protein.

  3. Ochratoxin A in Brazilian green coffee

    Directory of Open Access Journals (Sweden)

    LEONI Luís A.B.

    2001-01-01

    Full Text Available Ochratoxin A is a nephrotoxic, teratogenic and imunotoxic compound produced by Aspergillus and Penicillium spp. It is a suspected carcinogen to humans and it is carcinogenic to rats. Recently it has drawn attention because it has been found in coffee and it has been the object of regulation by coffee importing countries. Brazil is the largest coffee producing country and its largest consumer. In order to conduct an initial assessment of the situation of the coffee produced in the country and offered to its population, one hundred and thirty two samples of Brazilian green coffee from 5 producing states (Minas Gerais, Paraná, São Paulo, Espírito Santo and Bahia and destined for the home market, were collected at sales points at the cities of Londrina and Santos, Brazil, and analyzed for ochratoxin A. The toxin was isolated in immunoaffinity columns and quantified by HPLC with florescence detection. The limit of detection was 0.7ng/g and the average RSD for duplicates of the samples was 11%. Twenty seven samples were found contaminated with the toxin and the average concentration for the contaminated samples was 7.1ng/g ochratoxin A. Neither the total number of defects nor the number of specific defects according to the Brazilian coffee classification system (black, partly -- black, sour, stinkers-black, stinkers-green, pod beans showed any relation to the contamination of the samples with ochratoxin A.

  4. Panorama of the Brazilian correctional structure

    Directory of Open Access Journals (Sweden)

    Renata de Oliveira Cartaxo

    2014-04-01

    Full Text Available Objective: To describe, based on the Penitentiary Information Integrated System (Sistema Integrado de Informações Penitenciárias - Infopen, aspects of the national correctional structure, the convicts’ characteristics and the profiles of the existing professionals to guarantee the constitutional precept of healthcare. Methods: Descriptive study, on a documental basis, carried out from secondary data available in the Penitentiary Information Integrated System, where the Brazilian correctional structure was assessed, along with the prison inmate’s profile regarding personal characteristics and the committed crime, and the professionals involved in healthcare. Results: There are 298,275 vacancies, occupied by 496,251 convicts in 1,857 prisons. Concerning the inmates’ profile, it was observed that 92.3% (461,444 are male between 18 and 24 years old (25.6% - 126,929, dark-skinned (36.7% - 82,354, with incomplete elementary school (40.7% - 201,938, who mainly committed the drug smuggling crime (23.5% - 100,648. As to the composition of the health assistance team, it was evidenced a total amount of 5,132 professionals registered in the system. Conclusion: Based on the penitentiary information integrated system, the Brazilian correctional structure is characterized by presenting a vacancy deficit, caused by overcrowding and/or saturation of the existent prisons, what makes it especially difficult to guarantee the fulfillment of the inmates’ necessities. doi:10.5020/18061230.2013.p266

  5. Complex network study of Brazilian soccer players

    Science.gov (United States)

    Onody, Roberto N.; de Castro, Paulo A.

    2004-09-01

    Although being a very popular sport in many countries, soccer has not received much attention from the scientific community. In this paper, we study soccer from a complex network point of view. First, we consider a bipartite network with two kinds of vertices or nodes: the soccer players and the clubs. Real data were gathered from the 32 editions of the Brazilian soccer championship, in a total of 13411 soccer players and 127 clubs. We find a lot of interesting and perhaps unsuspected results. The probability that a Brazilian soccer player has worked at N clubs or played M games shows an exponential decay while the probability that he has scored G goals is power law. Now, if two soccer players who have worked at the same club at the same time are connected by an edge, then a new type of network arises (composed exclusively by soccer player nodes). Our analysis shows that for this network the degree distribution decays exponentially. We determine the exact values of the clustering coefficient, the assortativity coefficient and the average shortest path length and compare them with those of the Erdös-Rényi and configuration model. The time evolution of these quantities are calculated and the corresponding results discussed.

  6. The Brazilian Pampa: A Fragile Biome

    Directory of Open Access Journals (Sweden)

    Valdir Marcos Stefenon

    2009-12-01

    Full Text Available Biodiversity is one of the most fundamental properties of Nature. It underpins the stability of ecosystems, provides vast bioresources for economic use, and has important cultural significance for many people. The Pampa biome, located in the southernmost state of Brazil, Rio Grande do Sul, illustrates the direct and indirect interdependence of humans and biodiversity. The Brazilian Pampa lies within the South Temperate Zone where grasslands scattered with shrubs and trees are the dominant vegetation. The soil, originating from sedimentary rocks, often has an extremely sandy texture that makes them fragile—highly prone to water and wind erosion. Human activities have converted or degraded many areas of this biome. In this review we discuss our state-of-the-art knowledge of the diversity and the major biological features of this regions and the cultural factors that have shaped it. Our aim is to contribute toward a better understanding of the current status of this special biome and to describe how the interaction between human activities and environment affects the region, highlighting the fragility of the Brazilian Pampa.

  7. [Mineral waters from several Brazilian natural sources].

    Science.gov (United States)

    Rebelo, M A; Araujo, N C

    1999-01-01

    To divulge information on the chemical composition and physical-chemical features of some mineral waters from Brazilian natural sources that will be of useful protocol investigation and patient advice. The survey was based on bottle labels of non-gaseous mineral waters commercially available in the city of Rio de Janeiro. The íon concentration of each mineral was calculated from the salt content. 36 springs were enralled from different states of the country. The pH (25 degrees C), 4.1 to 9.3, varied on dependence of the source and it was linearey correlated with the cations calcium, magnesium and sodium and the anion bicarbonate. It was atributed to high alkalinity (about 70% of bicarbonate in the molecula-gram) of these salts. The calcium (0.3 to 42 mg/l), magnesium (0.0 to 18 mg/l) and bicarbonate (4 to 228 mg/l) contents are relatively low. The mineral content of the Brazilian springs enrolled in this survey is low; about 70% of the sources having calcium and magnesium less than 10 mg/l and 1.0 mg/l, respectively, similar to local tap water.

  8. Ticket consumption forecast for Brazilian championship games

    Directory of Open Access Journals (Sweden)

    Adriana Bruscato Bortoluzzo

    Full Text Available Abstract For the efficiency of sales and marketing management of athletic clubs, it is crucial to find a way to appropriately estimate the level of demand for sporting events. More precise estimates allow for an appropriate financial and operational plan and a higher quality of service delivered to the fans. The focus of this study is to analyze and forecast the ticket consumption for soccer games in Brazilian stadiums. We compare the results of the regression model with normally distributed errors (benchmark, the TOBIT model and the Gamma generalized linear model. The models include explanatory variables related to the economic environment, product quality, as well as monetary and non-monetary incentives that people are given to attend sporting events at stadiums. We show that most of these variables are statistically significant to explain the amount of fans that go to stadiums. We used different measures of accuracy to evaluate the performance of demand forecasts and concluded that Gamma generalized linear model presented better results to forecast the ticket consumption for Brazilian championship games, when compared to a benchmark.

  9. NASALIZATION IN BRAZILIAN PORTUGUESE: AN AUTOSEGMENTAL (REVIEW

    Directory of Open Access Journals (Sweden)

    Consuelo de Paiva Godinho COSTA

    2015-06-01

    Full Text Available We propose to make a brief review on nasalization phenomena studies in Portuguese, aiming the phonological process of nasal harmonization that occurs in the variety of Brazilian Portuguese spoken in Vitória da Conquista-BA and region, a phenomenon hitherto not described for any Portuguese dialect. To do so, we consider as fundamental, D’Angelis (2002 analysis, which incorporates relevant concepts presented by Trubetzkoy, from the Prague School, and some points of Camara Jr. propose. We also propose to update the discussion with the approaches along the lines of auto segmental phonology, incorporating some insights of Piggott (1992, discussing with other analyzes for nasalization phenomena in other languages, especially Guarani (language of Tupi-Guarani Linguistic Family, as proposed by Costa (2010, which deals with the phonological processes involving nasality and nasal harmony in Brazilian indigenous languages , in order to verify if the researches on nasality phenomena in other languages can shed some light on the processes that occur in Portuguese.

  10. Brazilian sandy beaches: characteristics, ecosystem services, impacts, knowledge and priorities

    Directory of Open Access Journals (Sweden)

    Antonia Cecília Zacagnini Amaral

    Full Text Available ABSTRACT Sandy beaches constitute a key ecosystem and provide socioeconomic goods and services, thereby playing an important role in the maintenance of human populations and in biodiversity conservation. Despite the ecological and social importance of these ecosytems, Brazilian sandy beaches are significantly impacted by human interference, chemical and organic pollution and tourism, as well as global climate change. These factors drive the need to better understand the environmental change and its consequences for biota. To promote the implementation of integrated studies to detect the effects of regional and global environmental change on beaches and on other benthic habitats of the Brazilian coast, Brazilian marine researchers have established The Coastal Benthic Habitats Monitoring Network (ReBentos. In order to provide input for sample planning by ReBentos, we have conducted an intensive review of the studies conducted on Brazilian beaches and summarized the current knowledge about this environment. In this paper, we present the results of this review and describe the physical, biological and socioeconomics features of Brazilian beaches. We have used these results, our personal experience and worldwide literature to identify research projects that should be prioritized in the assessment of regional and global change on Brazilian sandy beaches. We trust that this paper will provide insights for future studies and represent a significant step towards the conservation of Brazilian beaches and their biodiversity.

  11. Jorge Amado and the internationalization of brazilian literature

    Directory of Open Access Journals (Sweden)

    Elizabeth Lowe

    2013-02-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2013v1n31p119 Jorge Amado (1912-2001 is the most translated Brazilian writer and the literary figure that has shaped the reception of Brazilian literature in the world.  He is credited with opening the international literary market to the post-dictatorship generation of Brazilian writers.  Yet Amado is also a controversial figure.  The debate around him is sparked by what some believe is sexual and ethnic stereotyping in his post-1958 works and the reinforcement of "paternalistic "racial views. His reception therefore is mixed. For his English-language readers, he is a fascinating source of exotic and titillating narratives about the vast, unknown country of Brazil, and for Brazilians he is either a "great ambassador of Brazilian culture around the world" or a faux populist who disguises sexist and racist attitudes behind charming prose. This paper will address Amado's literary career, his unique contributions to Brazilian letters, the challenges of translating his work, and his influence on the production of a new Brazilian literature for export

  12. Diasporic and Transnational Internationalization: The Case of Brazilian Martial Arts

    Directory of Open Access Journals (Sweden)

    Angela da Rocha

    2015-10-01

    Full Text Available Brazilian diasporas overseas hasreceived little academic interest. Nevertheless, estimates suggest that around three million Brazilians currently live in other countries. The present study looks at a specific type of diaspora: small entrepreneurs from the Brazilian martial arts sector. The study adopts the case study method of research. The unit of analysis is comprised by the martial arts (capoeira and Brazilian jiu-jitsu. Data analysis used secondary and primary data from interviews. Cross-case analysis searched for similarities and differences in the internationalization processes of the two martial arts, using several analytical devices, such as chronologies, timelines, matrices, and pattern matching analysis. Evidences suggest that the concept of diasporic internationalization fits better capoeira than Brazilian jiu-jitsu. However, Brazilian jiu-jitsu shows an initial combination of diasporic and transnational characteristics, but more recently became fully transnational. Brazilian jiu-jitsu became a truly global business, formally organized and professionally managed. Capoeira, however, is still seen as non-commercial and as the preservation and practice of an ancient art. Such ethos, combined with the origin of its members in lower economic classes and their restricted access to capital turns internationalization into an often less profitable activity.

  13. [Citation patterns in Portuguese and Brazilian biomedical journals].

    Science.gov (United States)

    Lopes, Sílvia Costa; Santos, Tiago S; Lopes, Pedro Faria; Fernandez-Llimos, Fernando

    2012-01-01

    Bibliographic references of scientific articles are the source for calculating impact indexes frequently used for the assignment of funding to research projects. Different citation patterns may result in measurement bias of these impact indexes. To analyze citation patterns of Brazilian and Portuguese biomedical journals regarding the geographic origin of the sources cited. As part of the v+biomed project, a convenience sample of 11 biomedical journals, 4 Portuguese and 7 Brazilian, was gathered including the following subject categories: General and Internal Medicine, Public Health, Gynecology and Obstetrics, and Surgery. All the references from all the articles published in all the issues (except supplements) in 2009 and 2010 were retrieved. The type of source cited and its geographic origin were analyzed. A total of 102 issues from the 11 journals, containing 1430 articles, with a total of 32782 references were analyzed. No differences were found regarding the number of authors, pages or references between articles from Brazilian and Portuguese journals. Brazilian journals presented higher prevalence of English language and cited significantly more journals from their own country (30.1%) comparing to Portuguese journals (5.4%). Additionally, a lower citation rate to journals from the other country analyzed was evident in Brazilian (0.1%) when compared to Portuguese (3.2%) journals, as well as a higher self-citation of Brazilian journals (Brazil - 5.6%, Portugal - 2.1%). A different citation pattern between Portuguese and Brazilian biomedical journals was found, consisting of a higher citation rate from Brazilian to other Brazilian journals and to themselves. This differential in citation patterns may have implications on impact indexes determination which warrant further investigation.

  14. The mitogenome of Onchocerca volvulus from the Brazilian Amazonia focus.

    Science.gov (United States)

    Crainey, James L; Silva, Túllio R R da; Encinas, Fernando; Marín, Michel A; Vicente, Ana Carolina P; Luz, Sérgio L B

    2016-01-01

    We report here the first complete mitochondria genome of Onchocerca volvulus from a focus outside of Africa. An O. volvulus mitogenome from the Brazilian Amazonia focus was obtained using a combination of high-throughput and Sanger sequencing technologies. Comparisons made between this mitochondrial genome and publicly available mitochondrial sequences identified 46 variant nucleotide positions and suggested that our Brazilian mitogenome is more closely related to Cameroon-origin mitochondria than West African-origin mitochondria. As well as providing insights into the origins of Latin American onchocerciasis, the Brazilian Amazonia focus mitogenome may also have value as an epidemiological resource.

  15. The mitogenome of Onchocerca volvulus from the Brazilian Amazonia focus

    Directory of Open Access Journals (Sweden)

    James L Crainey

    2016-01-01

    Full Text Available We report here the first complete mitochondria genome of Onchocerca volvulus from a focus outside of Africa. An O. volvulus mitogenome from the Brazilian Amazonia focus was obtained using a combination of high-throughput and Sanger sequencing technologies. Comparisons made between this mitochondrial genome and publicly available mitochondrial sequences identified 46 variant nucleotide positions and suggested that our Brazilian mitogenome is more closely related to Cameroon-origin mitochondria than West African-origin mitochondria. As well as providing insights into the origins of Latin American onchocerciasis, the Brazilian Amazonia focus mitogenome may also have value as an epidemiological resource.

  16. Understanding the Trend in the Brazilian Seafaring Labor Market

    DEFF Research Database (Denmark)

    Lobrigo, Enrico; Zylberstajn, Hélio; Jensen, Søren Henning

    in the Brazilian seafaring labor market, it is relevant to research the interaction between various factors that can provide insights regarding the nature of this distinct labor sector. This paper explores the economic indicators that can possibly influence the trend in the Brazilian seafaring labor market...... regression analysis is an attempt to gain insights and understand the trend in the Brazilian seafaring labor market. Moreover, this research sheds light to essential institutional interventions and nature of the free play of the market that are relevant to the behavior of the trend in the seafaring labor...

  17. ESSE versus ESTE in Brazilian movies: substitution or specialization?

    Directory of Open Access Journals (Sweden)

    Hélcius Batista Pereira

    2013-02-01

    Full Text Available This study aims at contributing to the discussion on the uses of demonstrative pronouns in Brazilian Portuguese. For this end, samples of Brazilian films were analyzed. It was found that in the endophoric uses and in the spatial exophoric uses there is a tendency to substitute “este” with “esse”. Based on these results, it was found that Marine thesis (2004 which defends that “Brazilian Portuguese” has a binary paradigm, in which “esse” has become specialized in endophoric uses and “este” has become specialized in exophoric uses is not correct.

  18. The role of interest rates in the Brazilian business cycles

    Directory of Open Access Journals (Sweden)

    Nelson F. Souza-Sobrinho

    2011-09-01

    Full Text Available This paper offers additional insights on the relationship between interest rates and business cycles in Brazil. First, I document that Brazilian interest rates are very volatile, counter-cyclical and positively correlated with net exports, as observed in other emerging market economies. Next, I present a dynamic stochastic general equilibrium model in which firms face working capital constraints and labor supply is independent of consumption. This parsimonious model, appropriately calibrated to the Brazilian economy, predicts that interest rate shocks can explain about one third of output fluctuations and delivers business cycle regularities consistent with the Brazilian data.

  19. Brazilian vodkas have undetectable levels of ethyl carbamate

    Directory of Open Access Journals (Sweden)

    Elainy V. S. Pereira

    2013-01-01

    Full Text Available While in Europe vodka is mainly derived from potatoes or cereals, a large proportion of Brazilian vodka is likely obtained from sugarcane, which contains ethyl carbamate (EC precursors. EC, in addition to several other contaminants and congeners, were investigated in 32 samples of Brazilian vodka. All samples complied with the Brazilian regulations for congeners and contaminants, having EC content below 0.01 mg/L (detection limit. These results are probably related to the processing of vodka, in particular the use of extractive and rectifying stainless steel distillation columns, which allow the production of high strength spirits with low levels of congeners and contaminants.

  20. Prevalence and predictive factors of dental anxiety in Brazilian adolescents.

    Science.gov (United States)

    de Carvalho, Ricardo Wathson Feitosa; de Carvalho Bezerra Falcão, Paulo Germano; de Luna Campos, Gustavo José; de Souza Andrade, Emanuel Sávio; do Egito Vasconcelos, Belmiro Cavalcanti; da Silva Pereira, Maria Auxiliadora

    2013-01-01

    The purpose of this study was to determine the prevalence and predicitve factors of dental anxiety among Brazilian adolescents. This was a cross-sectional study of a random sample of 340 Brazilian adolescents, done between 2005 and 2010. Corah's Dental Anxiety Scale and an objective questionnaire were used to determine the degree of dental anxiety. The prevalence of moderate to severe dental anxiety was approximately 18%. Dental anxiety was correlated with the following factors: gender (Pdental pain (P=.002). Dental fear and anxiety in Brazilian adolescents are associated with lack of economic resources, negligence of oral health, low educational level, female gender, and younger age.

  1. Brazilian energy statistics - 1989. Annual bulletin of the Brazilian National Committee of the World Energy Conference

    International Nuclear Information System (INIS)

    1989-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydraulic energy, petroleum, natural gas and coal. It contains data on ethyl alcohol derived from sugar cane and some aspects about nuclear energy in Brazil. Graphs, annual statistics and historical data of electric power, petroleum and petroleum products, natural gas, coal and alcohol are also included. 17 figs., 12 tabs

  2. Greenhouse Gas Emissions from Brazilian Sugarcane Soils

    Science.gov (United States)

    Carmo, J.; Pitombo, L.; Cantarella, H.; Rosseto, R.; Andrade, C.; Martinelli, L.; Gava, G.; Vargas, V.; Sousa-Neto, E.; Zotelli, L.; Filoso, S.; Neto, A. E.

    2012-04-01

    Bioethanol from sugarcane is increasingly seen as a sustainable alternative energy source. Besides having high photosynthetic efficiency, sugarcane is a perennial tropical grass crop that can re-grow up to five or more years after being planted. Brazil is the largest producer of sugarcane in the world and management practices commonly used in the country lead to lower rates of inorganic N fertilizer application than sugarcane grown elsewhere, or in comparison to other feedstocks such as corn. Therefore, Brazilian sugarcane ethanol potentially promotes greenhouse gas savings. For that reason, several recent studies have attempted to assess emissions of greenhouse gases (GHG) during sugarcane production in the tropics. However, estimates have been mainly based on models due to a general lack of field data. In this study, we present data from in situ experiments on emission of three GHG (CO2, N2O, and CH4) in sugarcane fields in Brazil. Emissions are provided for sugarcane in different phases of the crop life cycle and under different management practices. Our results show that the use of nitrogen fertilizer in sugarcane crops resulted in an emission factor for N2O similar to those predicted by IPCC (1%), ranging from 0.59% in ratoon cane to 1.11% in plant cane. However, when vinasse was applied in addition to mineralN fertilizer, emissions of GHG increased in comparison to those from the use of mineral N fertilizer alone. Emissions increased significantly when experiments mimicked the accumulation of cane trash on the soil surface with 14 tons ha-1and 21 tons ha-1, which emission factor were 1.89% and 3.03%, respectively. This study is representative of Brazilian sugarcane systems under specific conditions for key factors affecting GHG emissions from soils. Nevertheless, the data provided will improve estimates of GHG from Brazilian sugarcane, and efforts to assess sugarcane ethanol sustainability and energy balance. Funding provided by the São Paulo Research

  3. Consensus of the Brazilian Society of Infectious Diseases and Brazilian Society of Clinical Oncology on the management and treatment of Kaposi's sarcoma

    Directory of Open Access Journals (Sweden)

    Érico Arruda

    2014-05-01

    There are no treatment guidelines for Kaposi's sarcoma established in Brazil, and thus the Brazilian Society of Clinical Oncology and the Brazilian Society of Infectious Diseases developed the treatment consensus presented here.

  4. Aging, Gender and Sexuality in Brazilian Society

    Directory of Open Access Journals (Sweden)

    Guita Grin Debert

    2014-04-01

    Full Text Available Drawing on the interplay between gender, aging, and sexuality, the aim of this article is twofold: (1 to show how Brazilian gerontologists treat gender differences and sexual activity in old age; (2 to analyze the  ways  discourses regarding the aging body and sexuality are perceived and evaluated by older women and men . I argue that  attempts of gerontologists’ to eroticize old age have to contend with the widespread notion that the desire for sex is inevitably lost with age. Thus, in the retiree associations that were studied, men had a tendency to assume they are not ‘old’ because their erectile function was still in good condition, and divorced or widowed women, in senior citizen associations, tend to regard themselves as happy due to having freed themselves from the sexual obligations imposed by marriage. In both cases, the dominant belief that there is a loss of sexual desire in old age was reproduced.

  5. Small Nominals in Brazilian Portuguese Copular Constructions

    Directory of Open Access Journals (Sweden)

    Patrícia Rodrigues

    2015-06-01

    Full Text Available The focus of this paper is copular clauses in Brazilian Portuguese like Mulher(es é complicado, in which the predicate exhibits an unmarked form for gender and number (masculine singular, despite the presence of the feminine and/or plural form of the noun in subject position. We reject the analyses that propose that (i there is a hidden infinitive clause in the subject position, (ii the agreement is an instance of semantic agreement, and (iii the DP subject is in A-bar position, and argue that the subject is a Small Nominal (they are not projected as full DPs which lacks index features that trigger external agreement (Pereltsvaig 2006.

  6. 12th Brazilian Meeting on Bayesian Statistics

    CERN Document Server

    Louzada, Francisco; Rifo, Laura; Stern, Julio; Lauretto, Marcelo

    2015-01-01

    Through refereed papers, this volume focuses on the foundations of the Bayesian paradigm; their comparison to objectivistic or frequentist Statistics counterparts; and the appropriate application of Bayesian foundations. This research in Bayesian Statistics is applicable to data analysis in biostatistics, clinical trials, law, engineering, and the social sciences. EBEB, the Brazilian Meeting on Bayesian Statistics, is held every two years by the ISBrA, the International Society for Bayesian Analysis, one of the most active chapters of the ISBA. The 12th meeting took place March 10-14, 2014 in Atibaia. Interest in foundations of inductive Statistics has grown recently in accordance with the increasing availability of Bayesian methodological alternatives. Scientists need to deal with the ever more difficult choice of the optimal method to apply to their problem. This volume shows how Bayes can be the answer. The examination and discussion on the foundations work towards the goal of proper application of Bayesia...

  7. Development of a Brazilian maize core collection

    Science.gov (United States)

    2009-01-01

    The aim of this study was to evaluate methods for developing a Brazilian maize core collection. For an initial survey of the active collection, passport information, as well as characterization and evaluation of accessions, were taken into consideration, these then being divided according to geographic region and kernel-type. Multiple sampling methods were evaluated. The strategy of constant sampling generated extensive alterations in extract accession frequency. The multivariate strategy with dispersion graphs and principal components associated with the Tocher method was considered efficient for identifying the most divergent genotypes. The multivariate strategy generated greater alterations in the variance of traits. The average number of traits revealed few modifications with the various sampling strategies used. Therefore, the active collection could be considered as possessing a satisfactory amount of information for most of its accessions. Moreover, the multivariate strategy generated modifications in the variance of the traits, independent of sampling intensity. PMID:21637517

  8. The multiplicity of Brazilian Social Psychology

    Directory of Open Access Journals (Sweden)

    Mariana Prioli Cordeiro

    2014-02-01

    Full Text Available Brazilian Social Psychology has many definitions, theories and objects of study. In this essay, based on Actor-Network Theory, we argue that these are not different aspects or attributes of a single object, but elements that help to perform different versions of this object. They are, therefore, elements that make Social Psychologies different, although related to each other. They produce a multiple Social Psychology, which is more than one and, at the same time, less than many. In doing so, we strived to call attention to the possibility of ordinating and coordinating reality in different ways, of recognizing that there are multiple and diverse actants in a discipline and of making a Social Psychology that searches for complex connections that articulate humans and non-humans and perform multiple realities.

  9. Equity Market Timing: Testing Using Brazilian IPOs

    Directory of Open Access Journals (Sweden)

    José Luiz Rossi Jr

    2010-04-01

    Full Text Available This paper analyzes whether the behavior related to the equity market timing affected the recent IPO wave of Brazilian firms and exerted an impact on companies'capital structure. Using data from january 2004 to december 2007 the paper classifies the months in the sample in hot or cold according the number of IPOs that took place in each month. The paper confirms an oportunistic behavior by the firms that issue a higher volume of stocks in periods classified as hot. The paper also shows that the impact of this behavior on companies` capital structure is very limited. Although there is a reduction in companies` leverage right after the IPO, this returns to its previous level only a few quarters after the IPO.

  10. Brazilian energy balance 2004: calendar year 2003

    International Nuclear Information System (INIS)

    2004-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in all the sectors of the Brazilian economy, for the calendar year 2003. It is divided into nine sections: a summary from 1970 to 2003; energy supply and demand by source, from 1988 to 2003; energy consumption by sector from 1988 to 2003; energy foreign trading also from 1988 to 2003; transformation centers balances in the same period; energy resources and reserves from 1973 to 2003; energy and socio-economy from 1988 to 2003; regional parameters, and appendices including installed capacity, international data, general structure of the balance, information processing, conversion units and consolidated energy balances. It also presents analytical texts on the main energy numbers for 2003 and also energy evolution in Brazil and energy expansion all over the world

  11. Progress toward Brazilian cesium fountain second generation

    Science.gov (United States)

    Bueno, Caio; Rodriguez Salas, Andrés; Torres Müller, Stella; Bagnato, Vanderlei Salvador; Varela Magalhães, Daniel

    2018-03-01

    The operation of a Cesium fountain primary frequency standard is strongly influenced by the characteristics of two important subsystems. The first is a stable frequency reference and the second is the frequency-transfer system. A stable standard frequency reference is key factor for experiments that require high accuracy and precision. The frequency stability of this reference has a significant impact on the procedures for evaluating certain systematic biases in frequency standards. This paper presents the second generation of the Brazilian Cesium Fountain (Br-CsF) through the opto-mechanical assembly and vacuum chamber to trap atoms. We used a squared section glass profile to build the region where the atoms are trapped and colled by magneto-optical technique. The opto-mechanical system was reduced to increase stability and robustness. This newest Atomic Fountain is essential to contribute with time and frequency development in metrology systems.

  12. μ-SRXRF characterization of Brazilian emeralds

    International Nuclear Information System (INIS)

    Curado, J F; Radtke, M; Buzamcn, G; Reinnolz, U; Riesemeier, H; Guttler, R A S; Kizzutto, M A

    2014-01-01

    The aim of the present study is to characterize emeralds from different mines of Brazil by using Synchrotron Radiation X-ray Fluorescence Microanalysis (μ-SRXRF). The advantage of this technique is that we can analyze a homogeneous, inclusion free area of the stone with the microbeam to distinguish the elemental fingerprint according to the provenance of the emerald. A total of 47 samples belonging to 5 different Brazilian mines were studied in this work and 28 elements were identified. By means of Principal Component Analysis (PCA) it is possible to build different groups according to the provenance of the stones, which allows to assign samples of unknown origin to the according mine.

  13. Representation of differences in Brazilian journalistic discourse

    Directory of Open Access Journals (Sweden)

    Fernando Resende

    2015-08-01

    Full Text Available Considering the technological advance, which enhances the production of mediatic discourses, and the notion of a libidinal power installed in our globalized societies, reflecting upon representation of differences seems to be a major issue. This essay discusses the production of journalistic discourses from an epistemological perspective. The field of media is taken as constituted by a triple component – discourse/narrative/machines – and we suggest that this triad has proved to be incomplete: discourse and narrative, once they really are vertexes of the triangle, are absences. Two journalistic-documentary productions – which intend to represent life in the slums of Brazil – are compared in order to reflect upon representation of differences in Brazilian journalistic discourse. In view of the up-to-date polarization and pulverization of discourses, we suggest that in the perspective of the journalistic discourse, one can only speak about alterity if one tries to comprehend the ways news is staged.

  14. Globalization and the Brazilian balance accounts

    International Nuclear Information System (INIS)

    Urbina, Ligia M. Soto; Cabral, Arnoldo S.; Vieira, Wilson J.

    1999-01-01

    The globalization of the world economy calls for a country specialization with new structures for the product sectors and an increase in the competitiveness in areas of specialization. This process requires the amplification of markets and the adoption of technological innovations which increase the volume of economic trade, but also change trade relations. This process is made possible because of price stabilization and the stability and transparency of the exchange rate policy of various countries. In this work it is shown the opportunity to place nuclear energy as one of the sectors in which Brazil may have competitive advantages and enhance its external balance accounts, by the competitive substitution of imports by producing internally goods and services which technology is known by Brazilian firms and because of the increase in exports. (author)

  15. Say syndrome: A new Brazilian case

    Directory of Open Access Journals (Sweden)

    M.L. Guion-Almeida

    1998-12-01

    Full Text Available We report on a Brazilian boy, born to nonconsanguineous parents, who presented short stature, microcephaly, large ears, Robin sequence, hand anomalies, delayed bone age, and developmental delay. Major signs found in this patient are related to the Say syndrome.Os autores descrevem um menino, filho de pais normais e não-consanguíneos, apresentando baixa estatura, microcefalia, orelhas grandes, seqüência de Robin, anomalias digitais, atraso na idade óssea e atraso no desenvolvimento neuropsicomotor. Estudo cromossômico mostrou cariótipo normal, 46,XY. Os achados são compatíveis com a síndrome de Say.

  16. Hereditary fructose intolerance in Brazilian patients

    Directory of Open Access Journals (Sweden)

    Eugênia Ribeiro Valadares

    2015-09-01

    Results and discussion: Age at diagnosis was between 10 and 32 months and the severity of the disease correlated with the increasing of age at diagnosis. The predominant symptoms were vomiting, weight loss, and hepatomegaly. Severe renal tubular acidosis manifested in one child. All patients had remission of symptoms after dietary modification. The sequencing of the ALDOB gene identified one homozygous patient for the mutation c.524C>A (p.A175D, while the others were compound heterozygous for c.360_363delCAAA (p.N120KfsX32, c.178C>T (p.R60X mutations, c.448G>C (p.A150P and c.524C>A (p.A175D. Clinical improvement of patients after dietary treatment is suggestive of the diagnosis, confirmed by molecular analysis. The prevalence of mutations found in our Brazilian patients is different from those of international literature.

  17. Measuring complexity in Brazilian economic crises.

    Science.gov (United States)

    Mortoza, Letícia P D; Piqueira, José R C

    2017-01-01

    Capital flows are responsible for a strong influence on the foreign exchange rates and stock prices macroeconomic parameters. In volatile economies, capital flows can change due to several types of social, political and economic events, provoking oscillations on these parameters, which are recognized as economic crises. This work aims to investigate how these two macroeconomic variables are related with crisis events by using the traditional complex measures due to Lopez-Mancini-Calbet (LMC) and to Shiner-Davison-Landsberg (SDL), that can be applied to any temporal series. Here, Ibovespa (Bovespa Stock Exchange main Index) and the "dollar-real" parity are the background for calculating the LMC and SDL complexity measures. By analyzing the temporal evolution of these measures, it is shown that they might be related to important events that occurred in the Brazilian economy.

  18. A study about lithium - the Brazilian situation

    International Nuclear Information System (INIS)

    Ribeiro, G.F.

    1984-01-01

    A geoeconomical analysis of lithium is carried out, from its natural occurrence to its final application as a commercial product. General geological aspects such as the most important lithium mines, their minerals and their world distribution are taken into account. Also discussed is the viewpoint of enterprises regarding the various economical sectors associated with the production, consumption, marketing, installed industrial capacity, preparation of new products, development programs and installation of new plants. The applications of lithium, its several alloys and other chemical compounds are considered. Conclusions from these studies and from the data acquired are drawn, regarding the present Brazilian situation and its perspectives towards a future demand for lithium. (C.L.B.) [pt

  19. MAPRAD: mapping of radioactivity in Brazilian soils

    International Nuclear Information System (INIS)

    Ribeiro, Fernando C.A.; Signorelli, Carla de A.; Conti, Claudio de C.; Lauria, Dejanira da C.; Ferreira, Ingryd M.; Carvalho, Laercio L. de; Rio, Monica A. Pires do; Trindade Filho, Octavio Luiz; Gonzalez, Sergio de A.; Silva, Tadeu Augusto de A.; Sousa, Wanderson de O.; Cunha, Fernanda G. da

    2011-01-01

    The MAPRAD Project main objective is to increase the knowledge of the distribution of natural radioactivity in soils of Brazilian national territory and to provide (among others) information which are essential for medical geology and environmental radiation safety researches and for decision-making process regarding soil contamination levels. It also aims to make available the generated information for researchers and for public, through an online database. Soil samples are collected by the Geological Survey of Brazil (CPRM) and are sent to the Institute of Radioprotection and Dosimetry (IRD), National Commission of Nuclear Energy (CNEN), where they are processed and analyzed for determination of concentrations of radionuclides by gamma spectrometry. The results are inserted into a database containing the sample information as geographic coordinates of the samples and land use. After the sample analysis, results are made available for the scientific community access on Internet. (author)

  20. Natural radionuclide distribution in Brazilian commercial granites

    International Nuclear Information System (INIS)

    Anjos, R.M.; Veiga, R.; Soares, T.; Santos, A.M.A.; Aguiar, J.G.; Frasca, M.H.B.O.; Brage, J.A.P.; Uzeda, D.; Mangia, L.; Facure, A.; Mosquera, B.; Carvalho, C.; Gomes, P.R.S.

    2005-01-01

    The dimension stones sector in Brazil produces several varieties of granites, marbles, slates and basalts. More than half of this production corresponds to around 200 different commercial types of granites with specific names, geographical and geological origins and mineral compositions. The well-known natural radioactivity present in rocks, where high radiation levels are associated with igneous rocks such as granite, can be used to determine their general petrologic features. This subject is important in environmental radiological protection, since granites are widely used as building and ornamental stones. In this paper, it is applied to correlate the petrographic characteristics of commercial granites with their corresponding dose rates for natural radioactivity. Amounts of thorium, uranium and potassium concentrations have been reported in several Brazilian commercial granite samples

  1. Brazilian energy balance 2008 - year 2007

    International Nuclear Information System (INIS)

    2008-01-01

    The Brazilian energy balance - BEB - is divided into eight chapters and eleven annexes, whose contents are as follow: chapter 1 - energy analysis and aggregated data; chapter 2 - energy supply and demand by source; chapter 3 - energy consumption by sector; chapter 4 - energy imports and exports; chapter 5 - balance of transformation centers; chapter 6 - energy resources and reserves; chapter 7 - energy and socioeconomics; chapter 8 - state energy data; annex I - installed capacity; annex II - self-generation of electricity; annex III - world energy data; annex IV - world energy evolution; annex V - useful energy balance; annex VI - general structure of the BEN; annex VII - treatment of information; annex VIII - units; annex IX - conversion factors; annex X - consolidated energy balances 1970/2007; annex XI - energy balance 2007. (author)

  2. PREFACE: XXXVII Brazilian Meeting on Nuclear Physics

    Science.gov (United States)

    2015-07-01

    The XXXVII Brazilian Meeting on Nuclear Physics (or XXXVII RTFNB 2014) gave continuity to a long sequence of workshops held in Brazil, devoted to the study of the different aspects of nuclear physics. The meeting took place in the Maresias Beach Hotel, in the town of Maresias (state of São Paulo) from 8th to 12th September 2014. Offering gentle weather, a charming piece of green land of splendid natural beauty with beach and all amenities, the place had all the conditions for very pleasant and fruitful discussions. The meeting involved 162 participants and attracted undergraduate and graduate students, Brazilian and South American physicists and invited speakers from overseas (USA, Italy, Spain, France, England, Switzerland, Germany and South Corea). In the program we had plenary morning sessions with review talks on recent developments in theory, computational techniques, experimentation and applications of the many aspects of nuclear physics. In the parallel sessions we had a total of 58 seminars. This volume contains 60 written contributions based on these talks and on the poster sessions. Evening talks and poster sessions gave still more insight and enlarged the scope of the scientific program. The contributed papers, representing mainly the scientific activity of young physicists, were exhibited as posters and are included in the present volume. Additional information about the meeting can be found at our website: http://www.sbfisica.org.br/~rtfnb/xxxvii-en Support and sponsorship came from brazilian national agencies: Conselho Nacional de Desenvolvimento Científico e Tecnoógico (CNPq); Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES); Fundação de Amparo á Pesquisa do Estado de São Paulo (FAPESP); Fundação de Amparo á Pesquisa do Estado do Rio de Janeiro (FAPERJ); Sociedade Brasileira de Física (SBF) and Instituto de Física da Universidade de São Paulo (IFUSP). We honored Professor Alejandro Szanto de Toledo, who completed

  3. Measuring complexity in Brazilian economic crises

    Science.gov (United States)

    Mortoza, Letícia P. D.; Piqueira, José R. C.

    2017-01-01

    Capital flows are responsible for a strong influence on the foreign exchange rates and stock prices macroeconomic parameters. In volatile economies, capital flows can change due to several types of social, political and economic events, provoking oscillations on these parameters, which are recognized as economic crises. This work aims to investigate how these two macroeconomic variables are related with crisis events by using the traditional complex measures due to Lopez-Mancini-Calbet (LMC) and to Shiner-Davison-Landsberg (SDL), that can be applied to any temporal series. Here, Ibovespa (Bovespa Stock Exchange main Index) and the “dollar-real” parity are the background for calculating the LMC and SDL complexity measures. By analyzing the temporal evolution of these measures, it is shown that they might be related to important events that occurred in the Brazilian economy. PMID:28301506

  4. Systematic review on obesity in Brazilian adolescents

    Directory of Open Access Journals (Sweden)

    Rafael Miranda Tassitano

    2009-09-01

    Full Text Available The purpose of this study was to systematically review the Brazilian literature on the prevalence of obesity and associated factors in adolescents. The literature search was carried out in the electronic databases Pubmed and Bireme, using the keywords: obesity, overweight, BMI, adolescents and Brazil. The following inclusion criteria were considered: Brazilian adolescents, BMI-based obesity estimates, publication until 2007, and adequate methodology. After the examination of titles, abstracts and full texts, 27 papers fulfilled our inclusion criteria. For describing the studies, the following variables were used: type of survey, design, age range, sample size, place of data collection. For evaluating the evidence, the following indicators were used: methods used, independent variables studied, statistical analyses employed, and cut-off used for defining obesity. Most studies used cross-sectional designs (77.7% and were carried out through home interviews (51.7%. Only one study used a nationally-based sample and three used regional-based samples (Northeast and Southeast. Regardless the design, place, type of survey, age range and cut-off used, the prevalence of obesity tended to be higher in the following groups: adolescents living in the Southeast region, living in urban areas, from high socioeconomic level and from private schools. In terms of behavioral determinants of obesity, the paucity of prospective studies and the difficulties of adequately measuring physical activity and food consumption, make the results less clear. Although the number of studies has increased, it is still necessary to stimulate surveys in the North, Southeast and Mideast regions. Prospective studies are also necessary, in order to evaluate the association between obesity and behavioral exposures.

  5. Safety reviews of the Brazilian multipurpose reactor

    International Nuclear Information System (INIS)

    Soares, Humberto Vitor

    2014-01-01

    This work presents a model developed for thermal hydraulic (TH) simulation of the Multipurpose Brazilian Reactor (RMB), whose Brazilian proposal for design, construction and operation was established in 2007. This reactor has as main proposed the production of radioisotopes for use in exams of nuclear medicine, material tests and utilization of neutrons beams. Besides of the TH modeling and safety analysis of the reactor, the application of a methodology to perform coupled calculation thermal-hydraulic/neutron kinetic (TH/NK) is also presented. Initially, the RMB was modeled in the safety analysis RELAP5 code. This code performs the thermal hydraulic calculation using point kinetics. Subsequently, the model was adapted and verified to the RELAP5-3D© code. This code performs the process of internal coupling through the option of nodal neutron kinetics calculation using the NESTLE code which solves the neutron diffusion equation. To generate the neutronic group constants, which are macroscopic cross sections that serve as input data for the neutronic codes, it was used the WIMSD-5B cell calculation code. The neutron analysis code PARCS was also used to model the 3D RMB core in order to compare the results of radial and axial average power distribution with the results generated by RELAP5-3D© code and with the available results of the CITATION neutron kinetic code. The safety analyses demonstrated safe behavior of the reactor through situations of possible transients. The 3D coupled calculations to the steady state operation also showed expected behavior, as well as the RMB neutronic analyzes performed with the codes NESTLE and PARCS.(author)

  6. Systematic review on obesity in Brazilian adolescents

    Directory of Open Access Journals (Sweden)

    Rafael Miranda Tassitano

    2009-01-01

    Full Text Available http://dx.doi.org/10.5007/1980-0037.2009v11n4p449 The purpose of this study was to systematically review the Brazilian literature on the prevalence of obesity and associated factors in adolescents. The literature search was carried out in the electronic databases Pubmed and Bireme, using the keywords: obesity, overweight, BMI, adolescents and Brazil. The following inclusion criteria were considered: Brazilian adolescents, BMI-based obesity estimates, publication until 2007, and adequate methodology. After the examination of titles, abstracts and full texts, 27 papers fulfilled our inclusion criteria. For describing the studies, the following variables were used: type of survey, design, age range, sample size, place of data collection. For evaluating the evidence, the following indicators were used: methods used, independent variables studied, statistical analyses employed, and cut-off used for defining obesity. Most studies used cross-sectional designs (77.7% and were carried out through home interviews (51.7%. Only one study used a nationally-based sample and three used regional-based samples (Northeast and Southeast. Regardless the design, place, type of survey, age range and cut-off used, the prevalence of obesity tended to be higher in the following groups: adolescents living in the Southeast region, living in urban areas, from high socioeconomic level and from private schools. In terms of behavioral determinants of obesity, the paucity of prospective studies and the difficulties of adequately measuring physical activity and food consumption, make the results less clear. Although the number of studies has increased, it is still necessary to stimulate surveys in the North, Southeast and Mideast regions. Prospective studies are also necessary, in order to evaluate the association between obesity and behavioral exposures.

  7. Protein profile of Brazilian Pythium insidiosum isolates.

    Science.gov (United States)

    Dal Ben, Vanessa; Oliveira, Rômulo S; Borchardt, Jéssica L; Valente, Júlia de Souza S; Brasil, Carolina Lichtina; Zambrano, Cristina Gomes; Leite, Fábio Pereira Leivas; de Avila Botton, Sônia; Pereira, Daniela Isabel Brayer

    2017-10-09

    Pythium insidiosum is an important aquatic Oomycota that causes pythiosis in mammals, especially horses, dogs, and humans; these inhabit marshy environments in tropical and subtropical areas. The aim of this study was to determine the protein profile, as well as identify likely immunodominant proteins, of Brazilian P. insidiosum isolates from southern Brazil, an important equine pythiosis endemic area. P. insidiosum isolates (horses, n = 20 and dogs, n = 02) were analyzed by SDS-PAGE and Western blot techniques. Horse, cattle, dog, and rabbit sera of both diseased and healthy animals were used to identify P. insidiosum proteins. SDS-PAGE protein profile detected antigens of molecular weights ranging from 100 to 20 KDa. Dog isolates revealed a protein profile similar to that of horse isolates. Anti-P. insidiosum antibodies in the sera of the four species could recognize proteins of different molecular weights (∼74 KDa to ∼24 KDa), and proteins ∼50-55 KDa and ∼34 KDa were shown to be immunodominant. Furthermore, ∼74 KDa, ∼60 KDa, ∼30 KDa and ∼24 KDa proteins were poorly recognized by host species antibodies. The Brazilian P. insidiosum isolates analyzed showed a similar protein profile; however, further studies are essential for the identification and characterization of proteins expressed by P. insidiosum, and an evaluation of the immunological profile of hosts susceptible to this Oomycota is necessary. © The Author 2017. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  8. Structural Properties of the Brazilian Air Transportation Network

    Directory of Open Access Journals (Sweden)

    GUILHERME S. COUTO

    2015-09-01

    Full Text Available The air transportation network in a country has a great impact on the local, national and global economy. In this paper, we analyze the air transportation network in Brazil with complex network features to better understand its characteristics. In our analysis, we built networks composed either by national or by international flights. We also consider the network when both types of flights are put together. Interesting conclusions emerge from our analysis. For instance, Viracopos Airport (Campinas City is the most central and connected airport on the national flights network. Any operational problem in this airport separates the Brazilian national network into six distinct subnetworks. Moreover, the Brazilian air transportation network exhibits small world characteristics and national connections network follows a power law distribution. Therefore, our analysis sheds light on the current Brazilian air transportation infrastructure, bringing a novel understanding that may help face the recent fast growth in the usage of the Brazilian transport network.

  9. Structural Properties of the Brazilian Air Transportation Network.

    Science.gov (United States)

    Couto, Guilherme S; da Silva, Ana Paula Couto; Ruiz, Linnyer B; Benevenuto, Fabrício

    2015-09-01

    The air transportation network in a country has a great impact on the local, national and global economy. In this paper, we analyze the air transportation network in Brazil with complex network features to better understand its characteristics. In our analysis, we built networks composed either by national or by international flights. We also consider the network when both types of flights are put together. Interesting conclusions emerge from our analysis. For instance, Viracopos Airport (Campinas City) is the most central and connected airport on the national flights network. Any operational problem in this airport separates the Brazilian national network into six distinct subnetworks. Moreover, the Brazilian air transportation network exhibits small world characteristics and national connections network follows a power law distribution. Therefore, our analysis sheds light on the current Brazilian air transportation infrastructure, bringing a novel understanding that may help face the recent fast growth in the usage of the Brazilian transport network.

  10. Proceedings of the 5. Brazilian Meeting on Analytical Chemistry

    International Nuclear Information System (INIS)

    1989-01-01

    The works of 5 0 Brazilian Meeting on Analitycal Chemistry are presented, including topics about elements determination with instrumental technique. The use of these techniques in soil and food are also cited. (C.G.C.) [pt

  11. Industrial development - consequences about the implantation of Brazilian Nuclear Program

    International Nuclear Information System (INIS)

    Syllus, C.

    1987-07-01

    The strategy to promote the growing industry participation in the Brazilian Nuclear Program, the difficulties, the measurements adopted for overcoming and the results obtained in terms of industrial development, are presented. (M.C.K.) [pt

  12. Competitive integration. A new strategy for the brazilian industrialization

    International Nuclear Information System (INIS)

    Lucas, L.P.V.

    1989-01-01

    It is discussed a new strategy for brazilian industrialization: from importation substitution to structural changes. The strategy of competitive integration, technological progress and the new technologies. (A.C.A.S.)

  13. Proceedings of the 36. Brazilian Congress on Ceramic. v. 1

    International Nuclear Information System (INIS)

    1992-01-01

    The 36. Brazilian Congress on Ceramic - volume 1 - present works about basic science, raw-materials, powders synthesis, red ceramics, coating and refractories materials and thermomechanical ceramics. (C.G.C.)

  14. Molluscicidal activity against Biomphalaria glabrata of Brazilian Cerrado medicinal plants.

    Science.gov (United States)

    Bezerra, J C B; Silva, I A; Ferreira, H D; Ferri, P H; Santos, S C

    2002-08-01

    Alcoholic extracts of six Brazilian Cerrado medicinal plants were evaluated for their molluscicidal activity against Biomphalaria glabrata, intermediate host of schistosomiasis. Stryphnodendron polyphyllum bark extract, rich in condensed tannins, was the most promising as molluscicide.

  15. Depression and Its Correlates Among Brazilian Immigrants in Massachusetts, USA.

    Science.gov (United States)

    Lazar-Neto, Felippe; Louzada, Andressa C Sposato; de Moura, Ricardo Faé; Calixto, Fernando Morelli; Castro, Marcia C

    2017-07-31

    The goal of this paper is to assess the frequency of depression symptoms among Brazilian immigrants living in Massachusetts, the second largest Brazilian immigrant population in the United States, and to identify correlates of depression. A convenience sample of Brazilian immigrants aged 18 or older residing in Massachusetts was used. Data were collected from December 2013 to March 2014, in the Consulate General of Brazil in Boston and in three religious events, using a structure questionnaire and the Center for Epidemiological Studies Depression Scale (CES-D). Depression symptoms were observed in 35.3% of the respondents, with equal distribution by sex. Correlates of depression were low income, being single, poor English proficiency, and poor self-perception of health. These results suggest a need for community outreach, sensitization, and counseling, in Portuguese and adapted to the culture of Brazilian immigrants.

  16. Argentine-Brazilian declaration on common nuclear policy

    International Nuclear Information System (INIS)

    1990-12-01

    The document reproduces the texts of the speeches made by the Presidents of Argentina and Brazil at Foz do Iguacu, Brazil, on 28 November 1990, at the signing of the Argentine-Brazilian Declaration on Common Nuclear Policy

  17. Tudo Pela Patria: The Brazilian Navy's Drive to Blue Water

    National Research Council Canada - National Science Library

    Conners, Michael E

    2005-01-01

    The Brazilian Navy is unique among most world navies today. Since the end of the Cold War, most nations have reduced their naval power, yet Brazil has maintained a determination to possess a blue-water fleet...

  18. Proceedings of the 1. Brazilian Congress on Plasma Physics

    International Nuclear Information System (INIS)

    1991-01-01

    The 1. Brazilian Congress on Plasma Physics proceedings presents technical papers on magnetohydrodynamics, plasma diagnostic, plasma waves, plasma impurities, plasma instabilities, and astrophysics plasma. (L.C.J.A.)

  19. Abstracts of the 26. Brazilian Congress on Chemistry

    International Nuclear Information System (INIS)

    1985-01-01

    It is presented the short communications of papers presented at the 26. Brazilian Congress on Chemistry, of nuclear interest. The papers are classified in four areas: isotope chemistry, organic chemistry, inorganic chemistry and physico-chemical. (E.G.) [pt

  20. Clinical trials in Brazilian journals of ophthalmology: where we are

    Directory of Open Access Journals (Sweden)

    Rodrigo Pessoa Cavalcanti Lira

    2013-02-01

    Full Text Available PURPOSE: To compare clinical trials published in Brazilian journals of ophthalmology and in foreign journals of ophthalmology with respect to the number of citations and the quality of reporting [by applying the Consolidated Standards for Reporting Trials (CONSORT statement writing standards]. METHODS: The sample of this systematic review comprised the two Brazilian journals of ophthalmology indexed at Science Citation Index Expanded and six of the foreign journals of ophthalmology with highest Impact Factor® according ISI. All clinical trials (CTs published from January 2009 to December 2010 at the Brazilians journals and a 1:1 randomized sample of the foreign journals were included. The primary outcome was the number of citations through the end of 2011. Subgroup analysis included language. The secondary outcome included likelihood of citation (cited at least once versus no citation, and presence or absence of CONSORT statement indicators. RESULTS: The citation counts were statistically significantly higher (P<0.001 in the Foreign Group (10.50 compared with the Brazilian Group (0.45. The likelihood citation was statistically significantly higher (P<0.001 in the Foreign Group (20/20 - 100% compared with the Brazilian Group (8/20 - 40%. The subgroup analysis of the language influence in Brazilian articles showed that the citation counts were statistically significantly higher in the papers published in English (P<0.04. Of 37 possible CONSORT items, the mean for the Foreign Group was 20.55 and for the Brazilian Group was 13.65 (P<0.003. CONCLUSION: The number of citations and the quality of reporting of clinical trials in Brazilian journals of ophthalmology still are low when compared with the foreign journals of ophthalmology with highest Impact Factor®.

  1. The Determinants of Brazilian Pulp exports from 1980 to 2001

    OpenAIRE

    Bacha, Carlos José Caetano; SanJuan, Adriana E.

    2004-01-01

    This paper makes an econometric analysis of the determinants of BrazilÂ’s pulp exports. The time period from 1980 to 2001 is considered for estimating a supply equation of pulp exports. Exogenous variables considered were: price of Brazilian exported pulp, production cost of Brazilian pulp, productive capacity, exchange rate between dollar and domestic currency and lagged pulp exports. It was observed that BrazilÂ’s pulp exports have responded little to price fluctuation; however, these expor...

  2. Outlook for the Land Policy as Democratic Brazilian Law

    Directory of Open Access Journals (Sweden)

    Mauê Ângela Romeiro Martins

    2016-10-01

    Full Text Available Whereas related to land distribution in Brazil consecutively problems were unsuccessful, and there was not meeting the demands for democratization of access to land, but the ratification of exclusionary land policy and permeated by the maintenance of land conflicts, no need of transcendence perspective stipulated in the abstract normative constructions factual world, which brings us to the subject of the article is to discuss the outlook for the Brazilian land policy in the constancy of the Brazilian Democratic State.

  3. The nuclear contribution to the solution of Brazilian energy problem

    International Nuclear Information System (INIS)

    1995-01-01

    This report presents the justifying of Brazilian Nuclear Programme. Due to the demand increasing of electric energy in Brazil, the government decided to an alternative source. Although the brazilian electric power program continue basically hydroelectric, the nuclear power plants began to be constructed. The strategy adopted, the prospection of uranium enrichment, the project and construction of nuclear power plants, the responsibilities of Nuclebras and Nuclen and several stages of this program are described. (C.M.)

  4. E-Commerce Sites: Use Intention by Brazilian Users

    Science.gov (United States)

    Guimaraes, Cayley; Lacerda, Lucas; Antunes, Diego R.

    This article discusses the behavior of Brazilian's intention of use e-commerce sites. To explain its use, or not, the Unified Theory of Acceptance of Technology (UTAUT) was used. A survey was conducted through a questionnaire based on variables from UTAUT available for twenty days over the Web, that prompted 1900 responses. The results indicate that Effort and Social Influence are the variables of the model that better explain Brazilian user's intention to use e-commerce sites.

  5. The Brazilian Business World: the difficult adaptation to globalization

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-01-01

    Full Text Available The article deals with the internationalization of Brazilian businesses in the current decade. In the 1990s, Brazil embraced economic neoliberalism and promoted a huge opening up of its economy. At that time, Brazilian companies had to adapt rapidly. Twenty years later, the country has reinforced its presence in Latin America and has ensured a better position in the global markets, especially by through agricultural exports.

  6. PRODEEM - the Brazilian programme for rural electrification using photovoltaics

    Energy Technology Data Exchange (ETDEWEB)

    Galdino, Marco A.; Lima, Jorge H.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)], Emails: marcoag@cepel.br, jlima@cepel.br

    2002-07-01

    This work describes several technical and managerial aspects of the Brazilian PRODEEM Program, which comprises installation of thousands of PV systems for several applications in Brazilian outback. The equipment were acquired through international bidding and CEPEL was specially concerned about the its quality and lifespan, as well as about the correct sizing of the systems. The purpose of this work is to present a history and the technical experience obtained by CEPEL after several years of involvement in PRODEEM activities. (author)

  7. Locative inversion and agreement syntax in Brazilian Portuguese

    Directory of Open Access Journals (Sweden)

    Juanito Ornelas de Avelar

    2009-12-01

    Full Text Available Adopting the Minimalist Program framework (CHOMSKY 2000, 2001, this paper suggests that, in Brazilian Portuguese, sentences with a locative prepositional phrase in preverbal position can be characterized as instances of locative inversion in which prepositional constituents occupy the grammatical subject position. It will be proposed that particularities involving the patterns of locative inversion in Brazilian Portuguese derive from properties of the subject-verb agreement in this language.

  8. Incoherences of Brazilian labour laws face to present radioprotection concepts

    International Nuclear Information System (INIS)

    Borges, J.C.

    1996-01-01

    The Brazilian labour legislation establishes, since 1950, some privileges for people working in activities which imply exposure to ionizing radiations. Comparing the present legal framework with technical radioprotection knowledge, one can detect several incoherences covering: classification of such activities; additional payments; reduced labour journey; more vacations; medical surveillance; early retirements; special norms for women. An analysis of these incoherences lead us to propose a new frame of labour rights and radioprotection norms, coupling Brazilian juridical principles and modern radioprotection knowledge. (author)

  9. Brazilian franchisor: Entry and operation of internationalized franchise

    OpenAIRE

    Aguiar, Helder de Souza; Luppe, Marcos Roberto; Nascimento, Paulo Tromboni de Souza

    2017-01-01

    This study aimed to compare the entry and operations strategies of franchisors of developed countries into foreign countries with Brazilian counterparts. Were there significant differences? An exploratory study was conducted with 16 international franchisors operating in Brazil and 31 Brazilian franchisors operating abroad. The results show that international franchisors operating abroad prefer to use a subsidiary in the destination country. At the same time, this strategy is little used by B...

  10. Sleep complaints in the Brazilian population: Impact of socioeconomic factors.

    Science.gov (United States)

    Hirotsu, Camila; Bittencourt, Lia; Garbuio, Silverio; Andersen, Monica Levy; Tufik, Sergio

    2014-09-01

    National surveys are relevant for the study of sleep epidemiology since they can provide specific data about sleep in large dimension with important implications for the health system. Thus, the aim of this study was to investigate the prevalence of sleep complaints among the Brazilian population using a randomized cluster sample according to region and socioeconomic class. For this, a 3-stage sampling technique was used to randomly select Brazilian subjects of both genders older than 16 years. A total of 2017 subjects, from 132 different cities, were selected to estimate prevalence in the Brazilian population with a sampling error of ±2%. Questions about sleep complaints were administered face-to-face by Instituto Datafolha interviewers on April 10 and 16, 2012. Data were expanded using a weighted variable. The results showed that 76% of the study population suffers from at least 1 sleep complaint, indicating that approximately 108 million Brazilians may be affected by sleep disorders. On average, each subject had 1.9 sleep problems with the most common complaints being light and insufficient sleep, snoring, moving a lot during sleep, and insomnia, which usually occurred more than 3 times per week. Low income was associated with higher number of sleep complaints only in Northeast and Southeast regions. In conclusion, this study showed a high prevalence of sleep complaints in a sample of the Brazilian population, suggesting that sleep disorders may be markedly frequent in the Brazilian population with a possible correlation with the socioeconomic situation of the interviewed subjects.

  11. Sleep complaints in the Brazilian population: Impact of socioeconomic factors

    Directory of Open Access Journals (Sweden)

    Camila Hirotsu

    2014-09-01

    Full Text Available National surveys are relevant for the study of sleep epidemiology since they can provide specific data about sleep in large dimension with important implications for the health system. Thus, the aim of this study was to investigate the prevalence of sleep complaints among the Brazilian population using a randomized cluster sample according to region and socioeconomic class. For this, a 3-stage sampling technique was used to randomly select Brazilian subjects of both genders older than 16 years. A total of 2017 subjects, from 132 different cities, were selected to estimate prevalence in the Brazilian population with a sampling error of ±2%. Questions about sleep complaints were administered face-to-face by Instituto Datafolha interviewers on April 10 and 16, 2012. Data were expanded using a weighted variable. The results showed that 76% of the study population suffers from at least 1 sleep complaint, indicating that approximately 108 million Brazilians may be affected by sleep disorders. On average, each subject had 1.9 sleep problems with the most common complaints being light and insufficient sleep, snoring, moving a lot during sleep, and insomnia, which usually occurred more than 3 times per week. Low income was associated with higher number of sleep complaints only in Northeast and Southeast regions. In conclusion, this study showed a high prevalence of sleep complaints in a sample of the Brazilian population, suggesting that sleep disorders may be markedly frequent in the Brazilian population with a possible correlation with the socioeconomic situation of the interviewed subjects.

  12. References from Brazilian medical journals in national publications.

    Science.gov (United States)

    Teixeira, Renan Kleber Costa; Botelho, Nara Macedo; Petroianu, Andy

    2013-01-01

    To assess whether there is a preference for international journal citation to the detriment of national ones in ten Brazilian medical journals, in two different periods. All references in the articles published in Arquivos Brasileiros de Oftalmologia, Revista Brasileira de Cirurgia Cardiovascular, Revista da Associação Médica Brasileira, São Paulo Medical Journal, Arquivos Brasileiros de Endocrinologia e Metabologia, Clinics, Jornal Brasileiro de Pneumologia, Revista da Sociedade Brasileira de Medicina Tropical, Revista Brasileira de Psiquiatria e Acta Ortopédica Brasileira in the years 2011 and 2007 were analyzed, assessing the number of articles published in national and international journals. A total of 36,125 references from 1,462 articles published in the 10 aforementioned journals were analyzed. Of the total number, 4.242 (11.74%) were from Brazilian journals. There was no significant difference between the two analyzed periods. A total of 453 (30,98%) of the articles studied non-cited brazilian papers,and 81 (5.54%) articles had more Brazilian than international references. Of total references analyzed, 11.74% were related to articles published in Brazilian journals. This number, when compared to the percentage of Brazilian articles published in the medical area, demonstrates a good number of citations of national articles. Copyright © 2012 Elsevier Editora Ltda. All rights reserved.

  13. Proposal for a Brazilian centre on alternative test methods.

    Science.gov (United States)

    Eskes, Chantra; Sá-Rocha, Vanessa de Moura; Nunes, Jadir; Presgrave, Octavio; de Carvalho, Dermeval; Masson, Philippe; Rivera, Ekaterina; Coecke, Sandra; Kreysa, Joachim; Hartung, Thomas

    2009-01-01

    Several initiatives have recently taken place in Brazil in order to foster the creation of centers dedicated to alternatives to animal testing. In 2008, Vanessa Sá-Rocha organized a meeting with Brazilian regulatory authorities and the major stakeholders in the field of testing to foster discussions on the process of funding, development, and validation of alternative methods in Brazil. Octavio Presgrave published a scientific article on "The Need for the Establishment of a Brazilian Centre for the Validation of Alternative Methods." Also in 2008, Jadir Nunes, together with Dermeval de Carvalho, prepared and presented a proposal to the Brazilian National Agency of Health Surveillance (ANVISA) for the creation of a Centre for the Validation of Alternative Methods. ECVAM and other European stakeholders have been involved in the initiatives. Furthermore, also in 2008, a new legislation has been adopted in Brazil regarding the use of animals for scientific purposes ("lei Arouca"). The legislation establishes, among other provisions, the task of monitoring and evaluating the introduction of alternative methods. However, the legislation does not provide for promotion of or information about, existing alternative methods to the larger Brazilian scientific community. In order to streamline the different activities, Chantra Eskes acted as a facilitator by establishing a new joint proposal with the current Brazilian stakeholders, aimed at setting up a Brazilian Center on Alternative Test Methods.

  14. IV Brazilian Consensus on Rhinitis - an update on allergic rhinitis,

    Directory of Open Access Journals (Sweden)

    Eulalia Sakano

    Full Text Available Abstract Introduction The guidelines on allergic rhinitis aim to update knowledge about the disease and care for affected patients. The initiative called "Allergic Rhinitis and its Impact on Asthma", initially published in 2001 and updated in 2008 and 2010, has been very successful in disseminating information and evidence, as well as providing a classification of severity and proposing a systemized treatment protocol. In order to include the participation of other medical professionals in the treatment of allergic rhinitis, it is important to develop algorithms that accurately indicate what should and can be done regionally. Objective To update the III Brazilian Consensus on Rhinitis - 2012, with the creation of an algorithm for allergic rhinitis management. Methods We invited 24 experts nominated by the Brazilian Association of Allergy and Immunology, Brazilian Association of Otorhinolaryngology and Head and Neck Surgery and Brazilian Society of Pediatrics to update the 2012 document. Results The update of the last Brazilian Consensus on Rhinitis incorporated and adapted the relevant information published in all "Allergic Rhinitis and its Impact on Asthma" Initiative documents to the Brazilian scenario, bringing new concepts such as local allergic rhinitis, new drugs and treatment evaluation methods. Conclusion A flowchart for allergic rhinitis treatment has been proposed.

  15. IV Brazilian Consensus on Rhinitis - an update on allergic rhinitis.

    Science.gov (United States)

    Sakano, Eulalia; Sarinho, Emanuel S C; Cruz, Alvaro A; Pastorino, Antonio C; Tamashiro, Edwin; Kuschnir, Fábio; Castro, Fábio F M; Romano, Fabrizio R; Wandalsen, Gustavo F; Chong-Neto, Herberto J; Mello, João F de; Silva, Luciana R; Rizzo, Maria Cândida; Miyake, Mônica A M; Rosário Filho, Nelson A; Rubini, Norma de Paula M; Mion, Olavo; Camargos, Paulo A; Roithmann, Renato; Godinho, Ricardo N; Pignatari, Shirley Shizue N; Sih, Tania; Anselmo-Lima, Wilma T; Solé, Dirceu

    2017-11-02

    The guidelines on allergic rhinitis aim to update knowledge about the disease and care for affected patients. The initiative called "Allergic Rhinitis and its Impact on Asthma", initially published in 2001 and updated in 2008 and 2010, has been very successful in disseminating information and evidence, as well as providing a classification of severity and proposing a systemized treatment protocol. In order to include the participation of other medical professionals in the treatment of allergic rhinitis, it is important to develop algorithms that accurately indicate what should and can be done regionally. To update the III Brazilian Consensus on Rhinitis - 2012, with the creation of an algorithm for allergic rhinitis management. We invited 24 experts nominated by the Brazilian Association of Allergy and Immunology, Brazilian Association of Otorhinolaryngology and Head and Neck Surgery and Brazilian Society of Pediatrics to update the 2012 document. The update of the last Brazilian Consensus on Rhinitis incorporated and adapted the relevant information published in all "Allergic Rhinitis and its Impact on Asthma" Initiative documents to the Brazilian scenario, bringing new concepts such as local allergic rhinitis, new drugs and treatment evaluation methods. A flowchart for allergic rhinitis treatment has been proposed. Copyright © 2017. Published by Elsevier Editora Ltda.

  16. Breast cancer screening: updated recommendations of the Brazilian College of Radiology and Diagnostic Imaging, Brazilian Breast Disease Society, and Brazilian Federation of Gynecological and Obstetrical Associations

    Directory of Open Access Journals (Sweden)

    Linei Augusta Brolini Dellê Urban

    Full Text Available Abstract Objective: To present the current recommendations for breast cancer screening in Brazil, as devised by the Brazilian College of Radiology and Diagnostic Imaging, the Brazilian Breast Disease Society, and the Brazilian Federation of Gynecological and Obstetrical Associations. Materials and methods: We analyzed scientific studies available in the Medline and Lilacs databases. In the absence of evidence, the recommendations reflected the consensus of a panel of experts. Recommendations: Annual mammography screening is recommended for women 40-74 years of age. Among women ≥ 75 years of age, annual mammography screening should be reserved for those with an expected survival > 7 years. Complementary ultrasound should be considered for women with dense breasts. Complementary magnetic resonance imaging is recommended for women at high risk. When available, an advanced form of mammography known as tomosynthesis can be considered as a means of screening for breast cancer.

  17. The regional (state level) importance of the agribusiness GDP in the Brazilian economy

    OpenAIRE

    Guilhoto, J. J. M.

    2004-01-01

    Following Furtuoso and Guilhoto (2003) the GDP of the Brazilian Agribusiness is estimated to be around 27% of the Brazilian GDP in 2000, and the latest numbers show that it could be reaching 30% of the Brazilian GDP in 2003. Despite its importance for the Brazilian economy as a whole, the size of the Brazilian territory and the regional differences draws attention for the fact that the importance of the agribusiness is not uniform over the Brazilian regions, and if the agribusiness is also di...

  18. ERICA: prevalence of asthma in Brazilian adolescents.

    Science.gov (United States)

    Kuschnir, Fábio Chigres; Gurgel, Ricardo Queiroz; Solé, Dirceu; Costa, Eduardo; Felix, Mara Morelo Rocha; de Oliveira, Cecília Lacroix; de Vasconcellos, Maurício Teixeira Leite; Kuschnir, Maria Cristina Caetano

    2016-02-01

    OBJECTIVE To describe the prevalence of asthma and physician-diagnosed asthma in Brazilian adolescents. METHODS Cross-sectional, national, school-based study with adolescents from 12 to 17 years old, participants in the Study of Cardiovascular Risks in Adolescents (ERICA). The study stratified the sample by region and grouped according to schools and classes with representativeness to the set of cities with more than 100,000 inhabitants of the Country, macro-regions, capitals, and Federal District. A questionnaire collected data through a self-filled in method. We calculated the prevalences and their confidence intervals of 95% (95%CI) according to sex, age group, type of school and skin color. RESULTS Between 2013 and 2014, 74,589 adolescents were evaluated, 55.3% of the female sex. The total prevalence of active asthma was of 13.1% (95%CI 12.1-13.9), being higher in girls (14.8%; 95%CI 13.7-16.0) when compared to boys (11.2%; 95%CI 10.3-12.2) in all geographical strata examined. It was also higher between students of private schools (15.9%; 95%CI 14.2-17.7) when compared to public ones (12.4%; 95%CI 11.4-13.4). It was higher in the Southeast region (14.5%; 95%CI 12.9-16.1), and in the city of Sao Paulo (16.7%; 95%CI 14.7-18.7). The lowest prevalence was observed in North region (9.7%; 95%CI 9.7-10.5), and in Teresina (6.3%; 95%CI 4.9-7.7). The prevalence of physician-diagnosed asthma was of 8.7% (95%CI 8.2-9.1); higher in the North region (13.5%; 95%CI 12.7-14.2), and in Porto Alegre (19.8%; 95%CI 17.5-22.3). It was lower in the Midwest (6.9%; 95%CI 6.0-7.8), and in Cuiaba (4.8%; 95%CI 3.8-5.9). We found no significant difference in the expression of this rate between the sexes, as well as in other variables evaluated by the study. CONCLUSIONS The prevalence of asthma in Brazilian adolescents is high. Rates of active asthma and physician-diagnosed asthma vary widely in different regions and capitals evaluated by the ERICA. These results may assist in the

  19. ERICA: prevalence of asthma in Brazilian adolescents

    Science.gov (United States)

    Kuschnir, Fábio Chigres; Gurgel, Ricardo Queiroz; Solé, Dirceu; Costa, Eduardo; Felix, Mara Morelo Rocha; de Oliveira, Cecília Lacroix; de Vasconcellos, Maurício Teixeira Leite; Kuschnir, Maria Cristina Caetano

    2016-01-01

    ABSTRACT OBJECTIVE To describe the prevalence of asthma and physician-diagnosed asthma in Brazilian adolescents. METHODS Cross-sectional, national, school-based study with adolescents from 12 to 17 years old, participants in the Study of Cardiovascular Risks in Adolescents (ERICA). The study stratified the sample by region and grouped according to schools and classes with representativeness to the set of cities with more than 100,000 inhabitants of the Country, macro-regions, capitals, and Federal District. A questionnaire collected data through a self-filled in method. We calculated the prevalences and their confidence intervals of 95% (95%CI) according to sex, age group, type of school and skin color. RESULTS Between 2013 and 2014, 74,589 adolescents were evaluated, 55.3% of the female sex. The total prevalence of active asthma was of 13.1% (95%CI 12.1-13.9), being higher in girls (14.8%; 95%CI 13.7-16.0) when compared to boys (11.2%; 95%CI 10.3-12.2) in all geographical strata examined. It was also higher between students of private schools (15.9%; 95%CI 14.2-17.7) when compared to public ones (12.4%; 95%CI 11.4-13.4). It was higher in the Southeast region (14.5%; 95%CI 12.9-16.1), and in the city of Sao Paulo (16.7%; 95%CI 14.7-18.7). The lowest prevalence was observed in North region (9.7%; 95%CI 9.7-10.5), and in Teresina (6.3%; 95%CI 4.9-7.7). The prevalence of physician-diagnosed asthma was of 8.7% (95%CI 8.2-9.1); higher in the North region (13.5%; 95%CI 12.7-14.2), and in Porto Alegre (19.8%; 95%CI 17.5-22.3). It was lower in the Midwest (6.9%; 95%CI 6.0-7.8), and in Cuiaba (4.8%; 95%CI 3.8-5.9). We found no significant difference in the expression of this rate between the sexes, as well as in other variables evaluated by the study. CONCLUSIONS The prevalence of asthma in Brazilian adolescents is high. Rates of active asthma and physician-diagnosed asthma vary widely in different regions and capitals evaluated by the ERICA. These results may assist in the

  20. Brazilian energy statistics - 1992. Annual bulletin of the Brazilian National Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1992-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydraulic energy, petroleum, natural gas and coal. It contains data on ethyl alcohol derived from sugar cane since it is of special importance in Brazil's energy scenario. A brief picture of Brazil's electric power status with regard to bordering countries is also presented, giving an idea of the prospects for progress in electric power integration through the implementation of new international electric power interconnection projects. (author). 13 figs., 19 tabs

  1. Brazilian energy statistics - 1993. Annual bulletin of the Brazilian Committee of the World Energy Council

    International Nuclear Information System (INIS)

    1993-01-01

    This bulletin deals with the primary sources that carry most weight in the Brazilian energy balance: hydraulic energy, petroleum, natural gas and coal. It contains data on ethyl alcohol derived from sugar cane since it is of special importance in Brazil's energy scenario. Some aspects about the opening or closing of the oil sector are also analysed, including the petroleum and petroleum products business; oil consumption issue; share of energy sources in world scenarios for the year 2020; reserves; prices and investments and the vulnerability of private companies. 12 figs., 16 tabs

  2. Accrual Anomaly in the Brazilian Capital Market

    Directory of Open Access Journals (Sweden)

    César Medeiros Cupertino

    2012-10-01

    Full Text Available This paper analyzes the phenomenon known as accrual anomaly in Brazil. In particular, we examine two hypotheses: (a that the earnings expectation included in the stock price fails to reflect the difference in persistence of the earnings components (accruals and cash flows; and (b that the construction of a hedge portfolio by taking a long (short position in assets with low (high accruals generates consistently abnormal returns. The data set includes nonfinancial firms listed on the BM&FBOVESPA between 1990 and 2008. The empirical tests required conducting panel data regressions to identify the persistence of earnings and theircomponents; the Mishkin test to identify whether the market rationally prices earnings; and the composition of a zero-investment (hedge portfolio to analyze whether a trading strategy based on accruals consistently provides abnormal positive returns. The results indicate that the accrual component is not mispriced by the Brazilian market, and that a trading strategy based on accruals does not provide consistently positive returns. Although this evidence does not encourage arbitrage, the results are relevant from various perspectives. The methodology applied permitted identifying the quality of earnings and of their components, as well as association between the components of earnings and returns.

  3. The territorial logic in brazilian health policy

    Directory of Open Access Journals (Sweden)

    Eliane Cristina Lopes Brevilheri

    2014-06-01

    Full Text Available This article aims to reflect on the territorial dimension has been addressed in the current Brazilian health policy. Provides an initial approximation of the theoretical discussion about the category territory and its implications for social policy. Then we analyze how this category was included in the principles and guidelines of the National Health System, deployed in key programs and normative instruments of health policy from 1990. It is concluded that: the territorial dimension was present from conception through SUS guideline regionalization of activities and services. In the main programs implemented in the 1990s, the territorial dimension had a character cutouts geographical and normative instruments gave centrality to the process of decentralization. However, from the 2000s, the regionalization strategy, pointing to the territorial perspective, gains greater significance. However, we still need to overcome the logic purely political-administrative and act so as to identify the real needs of the people, their potential, diversity and particularities, towards "used territory" referred to Milton Santos.

  4. Dental Anomalies in a Brazilian Cleft Population.

    Science.gov (United States)

    Sá, Jamile; Mariano, Lorena C; Canguçu, Daiane; Coutinho, Thaynara S L; Hoshi, Ryuichi; Medrado, Alena Peixoto; Martelli-Junior, Hercílio; Coletta, Ricardo D; Reis, Silvia R A

    2016-11-01

      The aim of this study was to radiographically investigate the prevalence of dental anomalies outside the cleft area in a group of Brazilian patients with nonsyndromic cleft lip and/or palate (NSCL/P).   A retrospective analysis of 207 panoramic radiographs of patients with NSCL/P aged 12 to 45 years without history of tooth extraction and orthodontic treatment was performed.   Dental anomalies were found in 75.4% of the patients, and tooth agenesis (29.2%) and supernumerary tooth (2.6%) were the most common anomalies. The risk of agenesis was higher among the individuals with cleft palate (CP) compared with individuals with cleft lip (CL) and cleft lip and palate (CLP) (agenesis: CP versus CL: odds ratio 6.27, 95% confidence interval 2.21-17.8, P = .0003; CP versus CLP: odds ratio 2.94; 95% confidence interval 1.27-6.81, P = .01). The frequency of dental agenesis was higher in patients with unilateral complete CLP (agenesis: P agenesis: P = .0013), complete CP (agenesis: P agenesis: P dental agenesis (P dental anomalies in patients with NSCL/P was higher than that reported in overall population. This study found preferential associations between dental anomalies and specific extensions of NSCL/P, suggesting that dental agenesis and ectopic tooth may be part of oral cleft subphenotypes.

  5. Brazilian Resorts: an overall performance evaluation

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Bonfato

    2016-05-01

    Full Text Available This scientific article is about resort’s operations in Brazil. The main goal was to identify the financial key performance indicators, so that it could contribute to a better comprehension about how the resorts area acts in Brazil. To achieve this goal, this study took researches which generated numbers and indicators that could establish a comparison between 2013 and 2014. The main sources were token from all resorts from the Associação Brasileira de Resorts - Resorts Brasil, as well as an interview with a renowned area professional. Other sources were token by the most important resorts books. There are actually 49 resorts which are part of the Brazilian Resorts Association-ABR/Resorts Brasil. This institution allowed the access to all its database, in which the associated resorts give numerical informations about its own performance. The resorts studied in this article were divided and studied in four big groups. The results showed that the national resorts market keeps increasing its statistics and improving its internal management processes and sales distribution. Revenues increased 6.34% in the main analysed indicator during the years of 2013 and 2014. It was also observed that beach and all inclusive resorts tend to have better results.

  6. The configuration of the Brazilian scientific field.

    Science.gov (United States)

    Barata, Rita B; Aragão, Erika; de Sousa, Luis E P Fernandes; Santana, Taris M; Barreto, Mauricio L

    2014-03-01

    This article describes the configuration of the scientific field in Brazil, characterizing the scientific communities in every major area of knowledge in terms of installed capacity, ability to train new researchers, and capacity for academic production. Empirical data from several sources of information are used to characterize the different communities. Articulating the theoretical contributions of Pierre Bourdieu, Ludwik Fleck, and Thomas Kuhn, the following types of capital are analyzed for each community: social capital (scientific prestige), symbolic capital (dominant paradigm), political capital (leadership in S & T policy), and economic capital (resources). Scientific prestige is analyzed by taking into account the volume of production, activity index, citations, and other indicators. To characterize symbolic capital, the dominant paradigms that distinguish the natural sciences, the humanities, applied sciences, and technology development are analyzed theoretically. Political capital is measured by presidency in one of the main agencies in the S & T national system, and research resources and fellowships define the economic capital. The article discusses the composition of these different types of capital and their correspondence to structural capacities in various communities with the aim of describing the configuration of the Brazilian scientific field.

  7. COMPETITIVE INTELLIGENCE AT BRAZILIAN INDUSTRIAL MAINTENANCE DEPARTMENTS

    Directory of Open Access Journals (Sweden)

    Robson Quinello

    2006-11-01

    Full Text Available The industrial maintenance activities, generally, were considered as more one problem to the organizations. This image needs to change in Brazil , because this sector is part of the companies supply chain, is responsible to maintain equipments reliability and availability and it is a generator of the companies costs. This responsibility increases in a country where the productive capacity is in the limit, demanding extra efforts and where increasing pressures for reductions of the costs and restrictions techniques and human beings are increasing, ask to paradigms changes. The present study had for purpose to identify main canals of captation of the information used by the Brazilian industrial maintenance professionals, demonstrating systematic use of Competitive Intelligence can bring technological advance and profit of competitive advantage. For this, a qualitative research was made, using as research instruments the Delphi method, interviews with professionals and an experimental delineation C.I- Competitive Intelligence in a department-pilot (automotive sector.The results had shown to the use of formal and informal sources in different frequencies of access and the fragility in these departments in the not-systematic use of C.I, harming the above-mentioned challenges.

  8. Hydropower Resource Assessment of Brazilian Streams

    Energy Technology Data Exchange (ETDEWEB)

    Douglas G. Hall

    2011-09-01

    The Idaho National Laboratory (INL) in collaboration with the U.S. Geological Survey (USGS) with the assistance of the Empresa de Pesquisa Energetica (EPE) and the Agencia Nacional de Energia Electrica (ANEEL) has performed a comprehensive assessment of the hydropower potential of all Brazilian natural streams. The methodology by which the assessment was performed is described. The results of the assessment are presented including an estimate of the hydropower potential for all of Brazil, and the spatial distribution of hydropower potential thus providing results on a state by state basis. The assessment results have been incorporated into a geographic information system (GIS) application for the Internet called the Virtual Hydropower Prospector do Brasil. VHP do Brasil displays potential hydropower sites on a map of Brazil in the context of topography and hydrography, existing power and transportation infrastructure, populated places and political boundaries, and land use. The features of the application, which includes tools for finding and selecting potential hydropower sites and other features and displaying their attributes, is fully described.

  9. Semantic dementia: Brazilian study of nineteen cases

    Directory of Open Access Journals (Sweden)

    Mirna Lie Hosogi Senaha

    Full Text Available Abstract The term semantic dementia was devised by Snowden et al. in 1989 and nowadays, the semantic dementia syndrome is recognized as one of the clinical forms of frontotemporal lobar degeneration (FTLD and is characterized by a language semantic disturbance associated to non-verbal semantic memory impairment. Objectives: The aim of this study was to describe a Brazilian sample of 19 semantic dementia cases, emphasizing the clinical characteristics important for differential diagnosis of this syndrome. Methods: Nineteen cases with semantic dementia were evaluated between 1999 and 2007. All patients were submitted to neurological evaluation, neuroimaging exams and cognitive, language and semantic memory evaluation. Results: All patients presented fluent spontaneous speech, preservation of syntactic and phonological aspects of the language, word-finding difficulty, semantic paraphasias, word comprehension impairment, low performance in visual confrontation naming tasks, impairment on tests of non-verbal semantic memory and preservation of autobiographical memory and visuospatial skills. Regarding radiological investigations, temporal lobe atrophy and/or hypoperfusion were found in all patients. Conclusions: The cognitive, linguistic and of neuroimaging data in our case series corroborate other studies showing that semantic dementia constitutes a syndrome with well defined clinical characteristics associated to temporal lobe atrophy.

  10. Implementing the Brazilian Database on Orofacial Clefts

    Directory of Open Access Journals (Sweden)

    Isabella Lopes Monlleó

    2013-01-01

    Full Text Available Background. High-quality clinical and genetic descriptions are crucial to improve knowledge of orofacial clefts and support specific healthcare polices. The objective of this study is to discuss the potential and perspectives of the Brazilian Database on Orofacial Clefts. Methods. From 2008 to 2010, clinical and familial information on 370 subjects was collected by geneticists in eight different services. Data was centrally processed using an international system for case classification and coding. Results. Cleft lip with cleft palate amounted to 198 (53.5%, cleft palate to 99 (26.8%, and cleft lip to 73 (19.7% cases. Parental consanguinity was present in 5.7% and familial history of cleft was present in 26.3% subjects. Rate of associated major plus minor defects was 48% and syndromic cases amounted to 25% of the samples. Conclusions. Overall results corroborate the literature. Adopted tools are user friendly and could be incorporated into routine patient care. The BDOC exemplifies a network for clinical and genetic research. The data may be useful to develop and improve personalized treatment, family planning, and healthcare policies. This experience should be of interest for geneticists, laboratory-based researchers, and clinicians entrusted with OC worldwide.

  11. Brazilian Propolis Antileishmanial and Immunomodulatory Effects

    Science.gov (United States)

    da Silva, Suelen Santos; Thomé, Graciele da Silva; Cataneo, Allan Henrique Depieri; Miranda, Milena Menegazzo; Felipe, Ionice; Andrade, Célia Guadalupe Tardeli de Jesus; Watanabe, Maria Angélica Ehara; Piana, Gilce Maria; Sforcin, José Maurício; Pavanelli, Wander Rogério; Conchon-Costa, Ivete

    2013-01-01

    The antileishmanial and immunomodulatory effects of propolis collected in Botucatu, São Paulo State, Brazil, were evaluated in Leishmania (Viannia) braziliensis experimental infection. The antileishmanial effect of propolis on promastigote forms was verified by reducing growth and by promoting morphologic alterations observed by scanning electron microscopy. In in vitro immunomodulatory assays, macrophages were pretreated with propolis and then infected with L. (V.) braziliensis. In vivo, supernatants from liver cells and peritoneal exudate of BALB/c mice pretreated with propolis and infected with Leishmania (107/mL promastigotes) were collected, and TNF-α and IL-12 were measured by ELISA. Macrophages incubated with propolis showed a significant increase in interiorization and further killing of parasites. An increased TNF-α production was seen in mice pretreated with propolis, whereas IL-12 was downregulated during the infection. In conclusion, Brazilian propolis showed a direct action on the parasite and displayed immunomodulatory effects on murine macrophages, even though the parasite has been reported to affect the activation pathways of the cell. The observed effects could be associated with the presence of phenolic compounds (flavonoids, aromatic acids, and benzopyranes), di- and triterpenes, and essential oils found in our propolis sample. PMID:23762152

  12. Brazilian Decimetric Array (BDA) project - Phase II

    Science.gov (United States)

    Faria, C.; Stephany, S.; Sawant, H. S.; Cecatto, J. R.; Fernandes, F. C. R.

    2010-02-01

    The configuration of the second phase of the Brazilian Decimetric Array (BDA), installed at Cachoeira Paulista, Brazil (Longitude 45° 0‧ 20″ W and Latitude 22° 41‧ 19″ S), is a T-shaped array where 21 antennas are being added to existing 5 antennas of the first phase. In the third phase, in each arm of the T array, four more antennas will be added and baselines will be increased to 2.5 × 1.25 km in east-west and south directions, respectively. The antennas will be equally spaced at the distances of 250 meters from the central antenna of the T-array. Also, the frequency range will be increased to 1.2-1.7, 2.8 and 5.6 GHz. The Second phase of the BDA should be operational by the middle of 2010 and will operate in the frequency range of (1.2-1.7) GHz for solar and non solar observations. Here, we present the characteristics of the second phase of the BDA project, details of the array configuration, the u-v coverage, the synthesized beam obtained for the proposed configuration.

  13. Sleep habits in native brazilian bororo children

    Directory of Open Access Journals (Sweden)

    REIMÃO RUBENS

    1999-01-01

    Full Text Available Sleep behavior patterns in childhood are influenced by familial, cultural and environmental factors. In understanding sleep in Native Brazilian Bororo children, one should consider the influence of their culture on the child's sleep. This research analyzes sleep habits of Native Bororo children from the Meruri village, located in an Indian Reservation in the state of Mato Grosso. Fourty four children ( 24 M; 20 F were evaluated; ages ranged from one month to 10 years, with a mean age of 4.9 years. Sleep characteristics were assessed by means of a standard questionnaire applied to the mothers. Cosleeping - sleeping together with family members - was a remarkable finding, in every child 0-2 year old and in 81.5% in the 2-10 years group. The second characteristic was sleeping with many people in the same room. There was an average of 5.1 people per room in the younger group and 3.9 people in the older group

  14. Brazilian energy balance 2010 - year 2009

    International Nuclear Information System (INIS)

    2010-01-01

    The Brazilian energy balance - BEB - is divided into eight chapters and ten annexes, whose contents are as follow: chapter 1 - energy analysis and aggregated data - presents energy highlights per source in 2009 and analyses the evolution of the internal offer of energy and its relationship with economic growth in 2009; chapter 2 - energy supply and demand by source - has the accountancy, per primary and secondary energy sources, of the production, import, export, variation of stocks, losses, adjustments, disaggregated total per socioeconomic sector in the country; chapter 3 - energy consumption by sector - presents the final energy consumption classified by primary and secondary source for each sector of the economy; chapter 4 - energy imports and exports - presents the evolution of the data on the import and export of energy and the dependence on external energy; chapter 5 - balance of transformation centers - presents the energy balances for the energy transformation centers including their losses; chapter 6 - energy resources and reserves - has the basic concepts use in the survey of resources and reserves of primary energy sources, with the evolution of the data from 1974 to 2009, through graphs and tables; chapter 7 - energy and socioeconomics - contains a comparison of energy, economic and population parameters, specific consumption, energy intensities, average prices and spending on petroleum imports; Chapter 8 - state energy data - presents energy data for the states by Federal Unit, main energy source production, energy installations, reserves and hydraulic potential. (author)

  15. Brazilian energy balance 2009 - year 2008

    International Nuclear Information System (INIS)

    2009-01-01

    The Brazilian energy balance - BEB - is divided into eight chapters and ten annexes, whose contents are as follow: Chapter 1 - Energy Analysis and Aggregated Data - presents energy highlights per source in 2008 and analyses the evolution of the internal offer of energy and its relationship with economic growth in 2008; Chapter 2 - Energy Supply and Demand by Source - has the accountancy, per primary and secondary energy sources, of the production, import, export, variation of stocks, losses, adjustments, disaggregated total per socioeconomic sector in the country; Chapter 3 - Energy Consumption by Sector - presents the final energy consumption classified by primary and secondary source for each sector of the economy; Chapter 4 - Energy Imports and Exports - presents the evolution of the data on the import and export of energy and the dependence on external energy; Chapter 5 - Balance of Transformation Centers - presents the energy balances for the energy transformation centers including their losses; Chapter 6 - Energy Resources and Reserves - has the basic concepts use in the survey of resources and reserves of primary energy sources, with the evolution of the data from 1974 to 2008, through graphs and tables; Chapter 7 - Energy and Socioeconomics - contains a comparison of energy, economic and population parameters, specific consumption, energy intensities, average prices and spending on petroleum imports; Chapter 8 - State Energy Data - presents energy data for the states by Federal Unit, main energy source production, energy installations, reserves and hydraulic potential. (author)

  16. Visual sonority in Brazilian Sign Language literature

    Directory of Open Access Journals (Sweden)

    Marilyn Mafra Klamt

    2017-03-01

    Full Text Available ABSTRACT The idea of sonority in sign languages was treated by Perlmutter (1992 as perceptibility, a property of a segment that uses movement rather than one in which the hands stay in the same position. Sandler (1993 states that the visual salience of movement in sign languages plays a role similar to sonority in spoken languages. For Brentari (1998, perceptually, a sign is visible from considerable distances, and measurement of its visual sonority is based on the joints involved in its production. This work focuses on visual sonority in literature in Brazilian Sign Language and considers the relevance of manual and non-manual elements, rhythm, symmetry, the scale of signs, and the effect of video on this concept. Two signed stories “The King’s Parrot” and “Little Ping Pong Ball” were analysed, highlighting specific signs in which the use of joints, non-manual features, and other resources are influenced by the size of the performance space and the distance of the audience from the signing. Three types of ‘sonority’ were observed: in the movement of the whole body on the stage, in the size of arms and trunk movement, and in the hands. In addition to the joints, non-manual features, rhythm and symmetry play an important role in visual sonority and influence the viewer’s experience.

  17. Brazilian biodiversity for ornamental use and conservation

    Directory of Open Access Journals (Sweden)

    Roberto Romão

    2015-04-01

    Full Text Available The exuberance of Brazilian flora has caused admiration since the arrival of the first navigators. Fifteen to twenty percent of plant species estimated for the planet are found in this country. Plant genetic resources are part of biodiversity with potential for use by human populations, and are linked to the culture of the people, establishing the traditional use or enabling an innovative use. In Brazil, the landscape architect Roberto Burle Marx was a pioneer in collecting, using, valuing and preserving native species that have been admired since the 16th century, although they were neglected in the following centuries due to the valuation of ornamental plants from Europe. Between 1930 and 1960, he carried out landscaping projects that became emblematic for the development of landscaping in the 20th century. The analysis of the trajectory of the landscape architect, the 22 projects he carried out during that period, as well as the genebank structured by him, reveal significant numbers in terms of conservation.

  18. Food in African Brazilian Candomblé

    Directory of Open Access Journals (Sweden)

    Patricia Rodrigues de Souza

    2015-01-01

    Full Text Available The aim of this article is to highlight the importance of food in the rituals of African Brazilian Candomblé, as well as in its cosmovision (world view. A brief description of Candomblé’s historical trajectory is provided in order to show how food offerings became part of its rituals and how specific ingredients became symbolically significant in this belief system. According to the theories applied, it is possible that food has at least two functions in Candomblé: to materialize principles and also to work as a ritual language. To show the role of food in Candomblé the state of Bahia was taken as a case study – firstly because Candomblé started there and secondly because, as this article shows, the sacred foods of Candomblé are also consumed in everyday life, outside of religious situations, but just as importantly constituting a part of Bahian cultural identity. The dishes that feature in the ritualised meals and at the same time in Bahians’ everyday eating are described at the conclusion of the article, with a mention of their ingredients and to whom they are offered. The research sources included publications by Candomblé believers and scholars of religion, as well as cooks and journalists specialising in Bahian cuisine.

  19. [Lobotomy and leucotomy in Brazilian mental hospitals].

    Science.gov (United States)

    Masiero, André Luis

    2003-01-01

    Lobotomy and leucotomy were used in Brazilian mental institutions from 1936 to 1956. Also called psycho-surgeries, they were operations that separated the right and left frontal lobes and pre-frontal lobes from the rest of the brains, aiming at modifying behavior or curing mental diseases. The technique, created by the Portuguese neurologist Egas Moniz in 1935 and developed by Walter Freeman from the United States, arrived in Brazil through the hands of Aloysio Mattos Pimenta, neurologist from Hospital PsiquiátricoJuquely in São Paulo. Soon, many doctors followed suit. These procedures were used on more than a thousand in-patients aiming at not only healing results, but also the technical improvement of the surgical technique, since preliminary experiments with animals were quite rare at the time. In Brazil, the technique was used until 1956, when it was considered as going against the 1947 Nuremberg Code, whose objective was to detain and regulate the medical experiments with human beings made during the Second World War.

  20. Brazilian caregiver version of the Apathy Scale

    Science.gov (United States)

    Guimarães, Henrique Cerqueira; Fialho, Patricia Paes Araujo; Carvalho, Viviane Amaral; dos Santos, Etelvina Lucas; Caramelli, Paulo

    2009-01-01

    No Brazilian version of a specific scale for evaluating apathy in dementia is available. Objectives To introduce a translated version of the Apathy Scale (AS) for use with caregivers. Methods The instrument was formally translated and then administered to the caregivers of a small sample of dementia patients, in order to assess scale comprehensibility and make final adjustments. The scale was subsequently administered to the caregivers of a second, independent sample of Alzheimer’s disease (AD) patients. The content validity of the scale was tested by correlating the AS scores with the Neuropsychiatric Inventory (NPI) - apathy sub-score and Disability Assessment in Dementia (DAD) total scores. Results The first sample consisted of eleven subjects with dementia, most of whom had AD. The second sample comprised twenty patients with probable or possible AD (10 with mild dementia), a mean age of 84.1±5.8 years, and 2.2±1.6 years of schooling. The AS scores correlated with both NPI-apathy sub-score (r=0.756, p=0.001) and DAD total scores (r=–0.793, p=0.0005). Conclusions The final version had good comprehensibility and correlated strongly with standardized apathy and functional activities of daily living measures. PMID:29213647

  1. Brazilian caregiver version of the Apathy Scale

    Directory of Open Access Journals (Sweden)

    Henrique Cerqueira Guimarães

    Full Text Available Abstract No Brazilian version of a specific scale for evaluating apathy in dementia is available. Objectives: To introduce a translated version of the Apathy Scale (AS for use with caregivers. Methods: The instrument was formally translated and then administered to the caregivers of a small sample of dementia patients, in order to assess scale comprehensibility and make final adjustments. The scale was subsequently administered to the caregivers of a second, independent sample of Alzheimer's disease (AD patients. The content validity of the scale was tested by correlating the AS scores with the Neuropsychiatric Inventory (NPI - apathy sub-score and Disability Assessment in Dementia (DAD total scores. Results: The first sample consisted of eleven subjects with dementia, most of whom had AD. The second sample comprised twenty patients with probable or possible AD (10 with mild dementia, a mean age of 84.1±5.8 years, and 2.2±1.6 years of schooling. The AS scores correlated with both NPI-apathy sub-score (r=0.756, p=0.001 and DAD total scores (r=-0.793, p=0.0005. Conclusions: The final version had good comprehensibility and correlated strongly with standardized apathy and functional activities of daily living measures.

  2. Older adults abuse in three Brazilian cities

    Directory of Open Access Journals (Sweden)

    Rosalina Aparecida Partezani Rodrigues

    Full Text Available ABSTRACT Objective: To analyze the police reports filed by older adults who suffered abuse in order to identify the socio-demographic characteristics of victims and aggressors, type of violence, location, as well as to compare rates in three Brazilian cities in the period from 2009 to 2013. Method: Ecological study, in which 2,612 police reports registered in Police Stations were analyzed. An instrument was used to obtain data from the victim, the aggressor and the type of violence. Results: Psychological abuse predominated and most cases occurred in the older adults own home. In the cities of Ribeirão Preto and João Pessoa, the older adults presented similar rates for both gender. Regarding the standardized rates, in João Pessoa, there was a rise of this type of abuse in the two first years, and later there was a certain stability. In the city of Teresina, there was an increase, also observed in the city of Ribeirão Preto in the three first years, followed by a decrease. Conclusion: Older adults abuse is a cultural phenomenon difficult to be reported by them, since it occurs in the family context.

  3. REPRESENTATION OF DIFFERENCES IN BRAZILIAN JOURNALISTIC DISCOURSE

    Directory of Open Access Journals (Sweden)

    Fernando Resende

    2011-02-01

    Full Text Available Considering the technological advance, which enhances the
    production of mediatic discourses, and the notion of a libidinal power installed in our globalized societies, reflecting upon representation of differences seems to be a major issue. This essay discusses the production of journalistic discourses from an epistemological perspective. The field of media is taken as constituted by a triple component – discourse/narrative/machines – and we suggest that this triad has proved to be incomplete: discourse and narrative, once they really are vertexes of the triangle, are absences. Two journalistic-documentary productions – which intend to represent life in the slums of Brazil – are compared in order to reflect upon representation of differences in Brazilian journalistic discourse. In view of the up-to-date polarization and pulverization of discourses, we suggest that in the perspective of the journalistic discourse, one can only speak about alterity if one tries to comprehend the ways news is staged.

  4. Learning experience in endodontics: Brazilian students' perceptions.

    Science.gov (United States)

    Seijo, Marilia O S; Ferreira, Efigênia F; Ribeiro Sobrinho, Antônio P; Paiva, Saul M; Martins, Renata C

    2013-05-01

    Including students' perceptions in the educational process is considered a key component in monitoring the quality of academic programs. This study aimed to evaluate the concept of one's learning experience in endodontic teaching from the perspective of a group of Brazilian students. A total of 126 self-administered, structured questionnaires were distributed to undergraduate dental students enrolled in endodontics courses during the second semester of the 2009 academic year. The questionnaires were administered during final examinations and focused on students' opinions concerning learning during endodontic treatments, time spent during endodontic treatments, difficulties found during endodontic treatments, quality of endodontic treatments performed, characteristics of the technique employed, and suggestions to improve endodontic teaching. Ninety-one percent of the questionnaires were returned for evaluation. The obtained answers were discussed and analyzed, thereby generating quantitative and qualitative data showing students' perceptions of their experiences in endodontics courses. The main points that can affect the teaching of endodontics, according to the undergraduate students, included patients' absences and delays, selection of patients, preclinical and clinical training, difficulties found, type of technique employed, and teachers' orientation during endodontic treatment. The students' perceptions provided valuable information about the development of the course and the teacher-student relationship, together with the added intention of enhancing the teaching of endodontics as well as other courses.

  5. Factors influencing competitive anxiety in Brazilian athletes

    Directory of Open Access Journals (Sweden)

    Marcos Gimenes Fernandes

    2013-08-01

    Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2013v15n6p705 The study of factors influencing competitive anxiety, according to a multidimensional perspective and supported by valid instruments, is scarce among Brazilian athletes of different sports. The present study aims to: i investigate the theoretical relationship between the different dimensions of the multidimensional theory of anxiety (i.e., cognitive anxiety, somatic anxiety and self-confidence; and ii investigate the effects of gender, type of sport (individual or collective and competitive experience levels on cognitive anxiety, somatic anxiety and self-confidence. A total of 303 athletes (233 males and 70 females, from different sports, aged between 18 and 40 years (M =24.22, SD = 5.07 completed a shortened version of CSAI-2 (i.e., CSAI-2R, about one hour before the start of competitions. Results revealed significant correlations between cognitive anxiety, somatic anxiety and self-confidence dimensions, in accordance with the assumptions of the multidimensional theory. Additionally, comparative analyses indicated that female athletes and athletes from collective sports showed higher levels of cognitive anxiety, while male athletes and athletes with high competitive experience reported higher levels of self-confidence. These results were discussed taking into account the theoretical and practical implications of these findings for planning interventions of sport psychology in Brazil with athletes of different contexts.

  6. Factors influencing competitive anxiety in Brazilian athletes

    Directory of Open Access Journals (Sweden)

    Marcos Gimenes Fernandes

    2013-09-01

    Full Text Available The study of factors influencing competitive anxiety, according to a multidimensional perspective and supported by valid instruments, is scarce among Brazilian athletes of different sports. The present study aims to: i investigate the theoretical relationship between the different dimensions of the multidimensional theory of anxiety (i.e., cognitive anxiety, somatic anxiety and self-confidence; and ii investigate the effects of gender, type of sport (individual or collective and competitive experience levels on cognitive anxiety, somatic anxiety and self-confidence. A total of 303 athletes (233 males and 70 females, from different sports, aged between 18 and 40 years (M =24.22, SD = 5.07 completed a shortened version of CSAI-2 (i.e., CSAI-2R, about one hour before the start of competitions. Results revealed significant correlations between cognitive anxiety, somatic anxiety and self-confidence dimensions, in accordance with the assumptions of the multidimensional theory. Additionally, comparative analyses indicated that female athletes and athletes from collective sports showed higher levels of cognitive anxiety, while male athletes and athletes with high competitive experience reported higher levels of self-confidence. These results were discussed taking into account the theoretical and practical implications of these findings for planning interventions of sport psychology in Brazil with athletes of different contexts.

  7. Antigenotoxicity of Depsidones Isolated from Brazilian Lichens

    Directory of Open Access Journals (Sweden)

    Zaira da Rosa Guterres

    2017-04-01

    Full Text Available Although phenolic compounds produced by lichens have been widely investigated in antitumor assays, only a small number have been evaluated for mutagenicity and genotoxicity. This study evaluated protocetraric, hypostictic, psoromic, and salazinic acids for their potential genotoxic or antigenotoxic activity against somatic cells of Drosophila melanogaster. These compounds were isolated from the lichens Parmotrema dilatatum, Pseudoparmelia sphaerosphora, Usnea jamaicensis, and Parmotrema cetratum, respectively, collected from the Brazilian Cerrado biome. The compounds were evaluated at 0.75, 1.5, 3.0, and 6.0 mmol L–1 using the SMART test, employing standard and high-bioactivation crosses of Drosophila melanogaster. Doxorubicin (DXR was the positive control. Psoromic and salazinic acids proved toxic at 6.0 mM. None of the compounds evaluated exhibited mutagenicity, but each of them significantly reduced genetic damage caused by DXR, proving antigenotoxic when tested on somatic cells of D. melanogaster. DOI: http://dx.doi.org/10.17807/orbital.v9i1.897

  8. Brazilian Academy of Neurology (2006 - 2016).

    Science.gov (United States)

    Coelho, Fernando Morgadinho; Castro, Luiz Henrique de; Fukujima, Marcia Maiumi; Adoni, Tarso; Rieder, Carlos Roberto de Mello; Bichuetti, Denis Bernardi; Prado, Gilmar Fernandes do; Gagliardi, Rubens Jose

    2017-09-01

    Brazil is a heterogeneous country with continental dimensions. The different characteristics of cultural, socioeconomic, and demographic status of the population drive different strategies for neurological care. This knowledge helps the understanding of the current scenario with the consequent possibility of preparing for future challenges. We used data from annual internal forms of the Brazilian Academy of Neurology (BAN) since 2006 and the survey for all BAN members (3,240) in 2016. The geographic distribution of BAN members in Brazil follows the demographic concentration of the population. Participation of members from big cities was the most prevalent, 18.7% of participants were young neurologists, and 36.7% of neurologists had more than of 20 years of neurological practice. The improvement of knowledge of neurological practice in Brazil will be useful for BAN leadership in planning future actions. The BAN must make an effort to aggregate a greater number of neurologists, offering updating support contributing to health policies to disseminate neurological care in Brazil.

  9. Uncited articles in Brazilian public health journals.

    Science.gov (United States)

    Cuenca, Angela Maria Belloni; Barbosa, Milena Maria de Araújo Lima; Oliveira, Karoline de; Quinta, Fernanda Paranhos; Alvarez, Maria do Carmo Avamilano; França, Ivan

    2017-12-04

    Here, we describe the percentage of non-citation in Brazilian public health journals, a field that, until now, had not been investigated nationally or internationally. We analyzed articles, published between 2008 and 2012, of eight public health journals indexed in the scopus database. The percentage of non-citation differs between journals (from 5.7% to 58.1%). We identified four statistically distinct groups: História, Ciência, Saúde - Manguinhos (58% uncited articles); Physis: Revista de Saúde Coletiva, Interface, and Saúde e Sociedade (32% to 37%); Ciência & Saúde Coletiva and Revista Brasileira de Epidemiologia (16% to 17%); and Cadernos de Saúde Pública and Revista de Saúde Pública (6%). The non-citation in the first three years post-publication also varies according to journal. Four journals have shown a clear decline of non-citation: Cadernos de Saúde Pública, Ciência & Saúde Coletiva, Revista Brasileira de Epidemiologia, and Physis. Another three (Revista de Saúde Pública, Saúde e Sociedade, and Interface) presented an oscillation in non-citation, but the rates of 2008 and 2012 are similar, with different magnitudes. In turn, the journal História, Ciência, Saúde - Manguinhos maintains high rates of non-citation. Multidisciplinary journals attract more citation, but a comprehensive citation model still needs to be formulated and tested.

  10. MODEL OF BRAZILIAN URBANIZATION: GENERAL NOTES

    Directory of Open Access Journals (Sweden)

    Leandro da Silva Guimarães

    2016-07-01

    Full Text Available The full text format seeks to analyze the social inequality in Brazil through the spatial process of that inequality in this sense it analyzes, scratching the edges of what is known of the Brazilian urbanization model and how this same model produced gentrification cities and exclusive. So search the text discuss the country’s urban exclusion through consolidation of what is conventionally called peripheral areas, or more generally, of peripheries. The text on screen is the result of research carried out at the Federal Fluminense University in Masters level. In this study, we tried to understand the genesis of an urban housing development located in São Gonçalo, Rio de Janeiro called Jardim Catarina. Understand what the problem space partner who originated it. In this sense, his analysis becomes consubstantial to understand the social and spatial inequalities in Brazil, as well as the role of the state as planning manager socio-spatial planning and principal agent in the solution of such problems. It is expected that with the realization of a study of greater amounts, from which this article is just a micro work can contribute subsidies that contribute to the arrangement and crystallization of public policies that give account of social inequalities and serve to leverage a country more fair and equitable cities.

  11. Null Subjects in European and Brazilian Portuguese

    Directory of Open Access Journals (Sweden)

    Pilar Barbosa

    2005-12-01

    Full Text Available The goals of this paper are twofold: a to provide a structural account of the effects of the informal ‘Avoid Pronoun Principle’, proposed in Chomsky (1981: 65 for the Null Subject Languages (NSLs, and b to compare, in European and Brazilian Portuguese (EP and BP, the distribution of the third person pronouns in its full and null forms, to check whether in written corpora BP incorporates signs of the ongoing loss of the null subject, largely attested in its contemporary spoken language. The strong theoretical claim is that in the Romance non-NSLs the pre-verbal subject is sitting in Spec of IP, while in the Romance NSLs it is Clitic Left-Dislocated (or is extracted by A-bar movement if it belongs to a restricted set of non-referential quantified expressions. The paper provides quantitative evidence that BP is losing the properties associated with the Null Subject Parameter. In its qualitative analysis, it shows that the contrasts between EP and BP are easily accounted for if the two derivations are assumed and if the null subjects in the two varieties are considered to be of a different nature: a pronoun in EP and a pronominal anaphor in BP.

  12. Astronomy in Brazilian music and poetry

    Science.gov (United States)

    de Freitas Mourão, Ronaldo Rogério

    2011-06-01

    The rôle of astronomy in the Brazilian cultural diversity -though little known world- has been enormous. Thus, the different forms of popular music and erudite, find musical compositions and lyrics inspired by the stars, the eclipses in rare phenomena such as the transit of Venus in front of the sun in 1882, the appearance of Halley's Comet in 1910, in the Big Bang theory. Even in the carnival parades of the blocks at the beginning of the century astronomy was present. More recently, the parade of 1997, the samba school Unidos do Viradouro, under the direction of Joãozinho Trinta, offered a new picture of the first moments of the creation of the universe to join in the white and dark in the components of their school, the idea of matter and anti-matter that reigned in the early moments of the creation of the universe in an explosion of joy. Examples in classical music include Dawn of Carlos Gomes and Carta Celeste by Almeida Prado. Unlike The Planets by Gustav Holst -who between 1914 and 1916 composed a symphonical tribute to the solar system based on astrology- Almeida Prado composed a symphony that is not limited to the world of planets, penetrating the deep cosmos of galaxies. Using various resources of the technique for the piano on the clusters and static movements, violent conflicts between the records of super acute and serious instrument, harpejos cross, etc . . .

  13. DISPOSITION EFFECT AMONG BRAZILIAN EQUITY FUND MANAGERS

    Directory of Open Access Journals (Sweden)

    Eduardo Pozzi Lucchesi

    2015-01-01

    Full Text Available The disposition effect predicts that investors tend to sell winning stocks too soon and ride losing stocks too long. Despite the wide range of research evidence about this issue, the reasons that lead investors to act this way are still subject to much controversy between rational and behavioral explanations. In this article, the main goal was to test two competing behavioral motivations to justify the disposition effect: prospect theory and mean reversion bias. To achieve it, an analysis of monthly transactions for a sample of 51 Brazilian equity funds from 2002 to 2008 was conducted and regression models with qualitative dependent variables were estimated in order to set the probability of a manager to realize a capital gain or loss as a function of the stock return. The results brought evidence that prospect theory seems to guide the decision-making process of the managers, but the hypothesis that the disposition effect is due to mean reversion bias could not be confirmed.

  14. Dominance of foreign citations in Brazilian orthopedics journals☆☆☆

    Science.gov (United States)

    Teixeira, Renan Kleber Costa; Yamaki, Vitor Nagai; Rosa, Rita de Cássia Rodrigues; de Barros, Rui Sergio Monteiro; Botelho, Nara Macedo

    2014-01-01

    Objective To evaluate whether there is any preference for citing journals from other countries to the detriment of Brazilian journals, in three Brazilian orthopedics journals. Methods All the references of articles published in 2011 by the journals Acta Ortopédica Brasileira, Coluna/Columna and Revista Brasileira de Ortopedia were evaluated to as certain how many of these came from Brazilian journals and how many from foreign journals. Results 3813 references distributed among 187 articles were analyzed. Out of this total, 306 (8.02%) were from Brazilian journals. There was no difference between the three journals analyzed. There were 76 articles (40.64%) without any citations of articles in Brazilian journals and only two articles (1%) cited more Brazilian articles than articles published elsewhere. Conclusion There is a need for Brazilian researchers to cite articles from Brazilian journals more often. PMID:26229879

  15. Comparative evaluation of two populations of Pseudophilothrips ichini as candidates for biological control of Brazilian peppertree

    Science.gov (United States)

    Brazilian peppertree, Schinus terebinthifolius Raddi (Sapindales: Anacardiaceae) is one of the worst invasive species in Florida. The thrips Pseudophilothrips ichini Hood (Thysanoptera: Phlaeothripidae) is being considered as a potential biological control agent of Brazilian peppertree. Two populati...

  16. [Citing of national articles: the (de)valuation of Brazilian journals].

    Science.gov (United States)

    Teixeira, Renan Kleber Costa; Silveira, Tiago Santos; Botelho, Nara Macedo; Petroianu, Andy

    2012-01-01

    To evaluate whether there is a preference for foreign periodicals over Brazilian one. We evaluated all references of articles published in the years 2011 and 2007 in the journals Acta Cirúrgica Brasileira, Arquivos Brasileiros de Cirurgia Digestiva and the Journal of the Brazilian College of Surgeons, verifying the quantity of papers from Brazilian and foreign publications. We analyzed a total of 7,343 references arranged in 348 articles in those three journals; of these, 856 (11.65%) were from Brazilian journals. There was no difference between the three magazines, nor between the two periods. One hundred and eleven (31.9%) articles did not cite any Brazilian journal article and 36 (10.34%) cited Brazilian articles more than foreign ones. There is need for the Brazilian researcher to appreciate more the Brazilian journals, increasing citation from Brazil, without a scientific xenophobia.

  17. Assessment of the Economic Structure of Brazilian Agribusiness.

    Science.gov (United States)

    Rodrigues Moreira, Vilmar; Kureski, Ricardo; Pereira da Veiga, Claudimar

    2016-01-01

    This paper presents an economic assessment of Brazilian agribusiness and its relationship with other economic sectors. It was found that, in 2011, agribusiness had a share of 18.45% (basic prices) and 19.77% (market prices) of Brazilian GDP. The tax burden of agribusiness (20.68%) was higher than that of other sectors (13.59%), despite agribusiness being a major contributor to the generation of foreign exchange, employment, and essential products, such as food. Brazilian agribusiness is a major employer, responsible for 29.39% of national employment. However, its average income is lower than in the other sectors of the Brazilian economy. Finally, agribusiness was found to be the biggest generator of foreign exchange, with a positive balance of trade. It was possible to conclude that agribusiness forms a strong link between agriculture and livestock, industry, and services in other economic sectors. For this reason, it can be said that the development of agribusiness is highly relevant to the process of Brazilian economic development and is therefore important to the progress of economic policies.

  18. The scientific production of Brazilian neurologists: 1995-2004.

    Science.gov (United States)

    Nitrini, Ricardo

    2006-06-01

    The Brazilian scientific production saw more than a four-fold increase from the 1990s onwards. The aim of this study was to evaluate the evolution of scientific production by Brazilian clinical neuroscientists over the last 10 years. A search in the PubMed identified 295 clinical neuroscientists and their publications. Brazilian production corresponded to 2.37% of the papers published by the 20 indexed periodicals that regularly publish clinical neuroscience research. If only the first and last two years are compared, there was a real growth of 75.1%. More than 40% of the Brazilian papers were published in Arquivos de Neuro-Psiquiatria, the official journal of the Brazilian Academy of Neurology. When only those periodicals with impact factor higher than one are considered, the percentage falls to 0.86% in the whole 10-year period, but attains 1.23% in 2004. Epilepsy and infectious diseases were the sub-areas with the highest scientific production.

  19. The dynamics of Brazilian protozoology over the past century

    Science.gov (United States)

    Elias, M Carolina; Floeter-Winter, Lucile M; Mena-Chalco, Jesus P

    2016-01-01

    Brazilian scientists have been contributing to the protozoology field for more than 100 years with important discoveries of new species such asTrypanosoma cruzi and Leishmania spp. In this work, we used a Brazilian thesis database (Coordination for the Improvement of Higher Education Personnel) covering the period from 1987-2011 to identify researchers who contributed substantially to protozoology. We selected 248 advisors by filtering to obtain researchers who supervised at least 10 theses. Based on a computational analysis of the thesis databases, we found students who were supervised by these scientists. A computational procedure was developed to determine the advisors’ scientific ancestors using the Lattes Platform. These analyses provided a list of 1,997 researchers who were inspected through Lattes CV examination and allowed the identification of the pioneers of Brazilian protozoology. Moreover, we investigated the areas in which researchers who earned PhDs in protozoology are now working. We found that 68.4% of them are still in protozoology, while 16.7% have migrated to other fields. We observed that support for protozoology by national or international agencies is clearly correlated with the increase of scientists in the field. Finally, we described the academic genealogy of Brazilian protozoology by formalising the “forest” of Brazilian scientists involved in the study of protozoa and their vectors over the past century. PMID:26814646

  20. Cited Brazilian papers in general surgery between 1970 and 2009

    Directory of Open Access Journals (Sweden)

    Flavio L. Heldwein

    2010-01-01

    Full Text Available OBJECTIVES: To identify the most cited articles in general surgery published by Brazilian authors. INTRODUCTION: There are several ways for the international community to recognize the quality of a scientific article. Although controversial, the most widely used and reliable methodology to identify the importance of an article is citation analysis. METHODS: A search using the Institute for Scientific Information citation database (Science Citation Index Expanded was performed to identify highly cited Brazilian papers published in twenty-six highly cited general surgery journals, selected based on their elevated impact factors, from 1970 to 2009. Further analysis was done on the 65 most-cited papers. RESULTS: We identified 1,713 Brazilian articles, from which nine papers emerged as classics (more than 100 citations received. For the Brazilian contributions, a total increase of about 21-fold was evident between 1970 and 2009. Although several topics were covered, articles covering trauma, oncology and organ transplantation were the most cited. The majority of classic studies were done with international cooperation. CONCLUSIONS: This study identified the most influential Brazilian articles published in internationally renowned general surgery journals.

  1. Comparative Chemistry of Propolis from Eight Brazilian Localities

    Directory of Open Access Journals (Sweden)

    A. A. Righi

    2013-01-01

    Full Text Available Propolis is a complex honeybee product with resinous aspect, containing plant exudates and beeswax. Their color, texture, and chemical composition vary, depending on the location of the hives and local flora. The most studied Brazilian propolis is the green (alecrim-do-campo type, which contains mainly prenylated phenylpropanoids and caffeoylquinic acids. Other types of propolis are produced in Brazil, some with red color, others brown, grey, or black. The aim of the present work was to determine the chemical profiles of alcohol and chloroform extracts of eight samples of propolis, corresponding to six Brazilian regions. Methanol and chloroform extracts were obtained and analyzed by HPLC/DAD/ESI/MS and GC/MS. Two chemical profiles were recognized among the samples analyzed: (1 black Brazilian propolis, characterized chiefly by flavanones and glycosyl flavones, stemming from Picos (Piauí state and Pirenópolis (Goiás state; (2 green Brazilian propolis, characterized by prenylated phenylpropanoids and caffeoylquinic acids, stemming from Cabo Verde (Bahia state, Lavras and Mira Bela (Minas Gerais state, Pariquera-Açu and Bauru (São Paulo state, and Ponta Grossa (Paraná state. The present work represents the first report of prenylated flavonoids in Brazilian propolis and schaftoside (apigenin-8-C-glucosyl-6-C-arabinose in green propolis.

  2. The Corporate Governance of Privately Controlled Brazilian Firms

    Directory of Open Access Journals (Sweden)

    Érica C. R. Gorga

    2009-09-01

    Full Text Available We provide an overview of the corporate governance practices of Brazilian public companies, based primarily on an extensive 2005 survey of 116 companies. We focus on the 88 responding Brazilian private firms which are not majority owned by the state or a foreign company. We identify areas where Brazilian corporate governance is relatively strong and weak. Board independence is an area of weakness: The boards of most Brazilian private firms are comprised entirely or almost entirely of insiders or representatives of the controlling family or group. Many firms have zero independent directors. At the same time, minority shareholders have legal rights to representation on the boards of many firms, and this representation is reasonably common. Financial disclosure lags behind world standards. Only a minority of firms provide a statement of cash flows or consolidated financial statements. However, many provide English language financial statements, and an English language version of their website. Audit committees are uncommon, but many Brazilian firms use an alternate approach to ensuring financial statement accuracy – establishing a fiscal board. A minority of firms provide takeout rights to minority shareholders on a sale of control. Controlling shareholders often use shareholders agreements to ensure control.

  3. Brazilian scientific production on herbal medicines used in dentistry

    Directory of Open Access Journals (Sweden)

    R.D. Castro

    2014-09-01

    Full Text Available The objective of this study was to critically analyze the scientific production published in specialized Brazilian journals concerning the use of medicinal plants in dentistry. A literature review was carried out using an indirect documentation technique by means of a bibliographical study. Four examiners performed independent searches in Brazilian journals of medicinal plants indexed in the database SciELO (Brazilian Journal of Pharmacognosy; Brazilian Journal of Medicinal Plants; Brazilian Journal of Pharmaceutical Sciences; and Acta Botanica Brasilica using the descriptors "herbal medicine/phytotherapy" or "medicinal plants" and "dentistry ". The articles published from 2002 to 2012 addressing the use of medicinal plants in dentistry were included and analyzed. The searches based on the descriptors and reading of abstracts, resulted in 155 articles. Of these, 44 were read in full and a total of 16 publications met the eligibility criteria and were selected. Laboratory studies predominated (10 and were limited to the evaluation of antimicrobial properties by means of tests for determining inhibitory, fungicidal and bactericidal concentrations. Three literature reviews and only one clinical trial with no blinding and randomization were found. It is highlighted the need for better methodological designs in the researches and greater production of clinical or in vivo studies.

  4. Health service quality scale: Brazilian Portuguese translation, reliability and validity

    Science.gov (United States)

    2013-01-01

    Background The Health Service Quality Scale is a multidimensional hierarchical scale that is based on interdisciplinary approach. This instrument was specifically created for measuring health service quality based on marketing and health care concepts. The aim of this study was to translate and culturally adapt the Health Service Quality Scale into Brazilian Portuguese and to assess the validity and reliability of the Brazilian Portuguese version of the instrument. Methods We conducted a cross-sectional, observational study, with public health system patients in a Brazilian university hospital. Validity was assessed using Pearson’s correlation coefficient to measure the strength of the association between the Brazilian Portuguese version of the instrument and the SERVQUAL scale. Internal consistency was evaluated using Cronbach’s alpha coefficient; the intraclass (ICC) and Pearson’s correlation coefficients were used for test-retest reliability. Results One hundred and sixteen consecutive postoperative patients completed the questionnaire. Pearson’s correlation coefficient for validity was 0.20. Cronbach's alpha for the first and second administrations of the final version of the instrument were 0.982 and 0.986, respectively. For test-retest reliability, Pearson’s correlation coefficient was 0.89 and ICC was 0.90. Conclusions The culturally adapted, Brazilian Portuguese version of the Health Service Quality Scale is a valid and reliable instrument to measure health service quality. PMID:23327598

  5. The dynamics of Brazilian protozoology over the past century

    Directory of Open Access Journals (Sweden)

    M Carolina Elias

    2016-01-01

    Full Text Available Brazilian scientists have been contributing to the protozoology field for more than 100 years with important discoveries of new species such asTrypanosoma cruzi and Leishmania spp. In this work, we used a Brazilian thesis database (Coordination for the Improvement of Higher Education Personnel covering the period from 1987-2011 to identify researchers who contributed substantially to protozoology. We selected 248 advisors by filtering to obtain researchers who supervised at least 10 theses. Based on a computational analysis of the thesis databases, we found students who were supervised by these scientists. A computational procedure was developed to determine the advisors’ scientific ancestors using the Lattes Platform. These analyses provided a list of 1,997 researchers who were inspected through Lattes CV examination and allowed the identification of the pioneers of Brazilian protozoology. Moreover, we investigated the areas in which researchers who earned PhDs in protozoology are now working. We found that 68.4% of them are still in protozoology, while 16.7% have migrated to other fields. We observed that support for protozoology by national or international agencies is clearly correlated with the increase of scientists in the field. Finally, we described the academic genealogy of Brazilian protozoology by formalising the “forest” of Brazilian scientists involved in the study of protozoa and their vectors over the past century.

  6. Assessment of the Economic Structure of Brazilian Agribusiness

    Directory of Open Access Journals (Sweden)

    Vilmar Rodrigues Moreira

    2016-01-01

    Full Text Available This paper presents an economic assessment of Brazilian agribusiness and its relationship with other economic sectors. It was found that, in 2011, agribusiness had a share of 18.45% (basic prices and 19.77% (market prices of Brazilian GDP. The tax burden of agribusiness (20.68% was higher than that of other sectors (13.59%, despite agribusiness being a major contributor to the generation of foreign exchange, employment, and essential products, such as food. Brazilian agribusiness is a major employer, responsible for 29.39% of national employment. However, its average income is lower than in the other sectors of the Brazilian economy. Finally, agribusiness was found to be the biggest generator of foreign exchange, with a positive balance of trade. It was possible to conclude that agribusiness forms a strong link between agriculture and livestock, industry, and services in other economic sectors. For this reason, it can be said that the development of agribusiness is highly relevant to the process of Brazilian economic development and is therefore important to the progress of economic policies.

  7. Investigating Responses to Compliments by Brazilian Portuguese Speaking EFL Learners: A Contrastive Analysis

    Science.gov (United States)

    de Lima Zanella, Marisa

    2017-01-01

    This paper reports a study on politeness strategies of Brazilian Portuguese speakers and American English speakers regarding their responses to compliments. The aim of this research is to gain an insight into the politeness characteristics of Brazilian Portuguese speakers by analyzing how Brazilian students react when receiving compliments. It…

  8. The Brazilian Organic Food Sector: Prospects and Constraints of Facilitating the Inclusion of Smallholders

    Science.gov (United States)

    Blanc, Julien; Kledal, Paul R.

    2012-01-01

    The Brazilian organic food sector has experienced important growth during the last two decades. Brazilian smallholders, however, are facing huge challenges to enter and benefit from this growth in a sustainable way. Combining the lens of New Institutional Economics and socio-anthropology, we analyze six experiences of Brazilian smallholders who…

  9. "I'm Your Teacher, I'm Brazilian!" Authenticity and Authority in European "Capoeira"

    Science.gov (United States)

    de Campos Rosario, Claudio; Stephens, Neil; Delamont, Sara

    2010-01-01

    "Capoeira," the Brazilian dance and martial art is now globalised and taught widely outside Brazil. Instruction is provided by Brazilians who are living in self-imposed exile from their homeland. The authentic "capoeira" that such teachers provide is a major attraction for non-Brazilian students. However, there is little…

  10. 2 nd Brazilian Consensus on Chagas Disease, 2015

    Directory of Open Access Journals (Sweden)

    João Carlos Pinto Dias

    Full Text Available Abstract Chagas disease is a neglected chronic condition with a high burden of morbidity and mortality. It has considerable psychological, social, and economic impacts. The disease represents a significant public health issue in Brazil, with different regional patterns. This document presents the evidence that resulted in the Brazilian Consensus on Chagas Disease. The objective was to review and standardize strategies for diagnosis, treatment, prevention, and control of Chagas disease in the country, based on the available scientific evidence. The consensus is based on the articulation and strategic contribution of renowned Brazilian experts with knowledge and experience on various aspects of the disease. It is the result of a close collaboration between the Brazilian Society of Tropical Medicine and the Ministry of Health. It is hoped that this document will strengthen the development of integrated actions against Chagas disease in the country, focusing on epidemiology, management, comprehensive care (including families and communities, communication, information, education, and research .

  11. The Brazilian Nuclear Energy Commission and the health

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The Program of Health Section / Brazilian Cnen, which was elaborated to promote the use of ionizing radiations (nuclear and x-ray techniques) in benefit of Brazilian health, with safety assurance of patients, personnels, population and environment, is presented. The Ministry of Health, industries, Medical and Physicist Associations, Universities and Research Centers are participants of this program. The activities involved in the program are: production of isotopes and radiopharmaceuticals; radiation detectors and nuclear instrumentation; radiation protection and dosimetry; education and training of human resources; applied research and new technologies. The guiding and actions that the section will adopt to attend the growing necessities of Brazilian society, considering technological powers, management, available substructure and associated difficulties are defined. (M.C.K.) [pt

  12. Polypropylene reinforced with organophilic clay and brazilian nut fibers

    International Nuclear Information System (INIS)

    Rocha-Gomes, L.V.; Mondelo-Garcia, F.J.; Vaccioli, K.; Valera, S.T.; Silva-Valenzuela, M.G.; Valenzuela-Diaz, F.R.

    2014-01-01

    Polymer nanocomposites have been shown to possess better properties when compared with traditional composites. This study aims to investigate the effects of the addition of organophilic clay and Brazilian nut fiber on the polypropylene (PP). First, 5%, 10% and 20% PP/compatibilizer maleic anhydride (PP-g-MA) by weight was added to Pure PP, respectively. From the results, 5% PP-g-MA was defined for preparing the nanocomposites. Samples were prepared containing 5% PP / PP-g-MA reinforced with 5% organophilic Brazilian smectite clay and 5%, 10% and 15% Brazilian nut fiber. Specimens were tested for tensile strength and impact. The materials were characterized by laser diffraction particle size and X-ray diffraction, and the nanocomposites, by mechanical strength and impact. The best result was obtained by inserting 15% fiber. (author)

  13. Systematic risk variations (beta convertible debenture brazilian companies

    Directory of Open Access Journals (Sweden)

    Renata Drumond Pinto Coelho Antonino

    2010-01-01

    Full Text Available purpose of this article is to analyze the impact of issuing convertible debentures on the systematic risk of Brazilian companies. Some applied researches in the U.S. capital market (STEIN, 1992; LEWIS et al, 2002; RAI, 2005 indicate that convertible debentures may be used as an alternative financing source when adverse selection problem makes stock issuing unattractive financing source. The analysis of Brazilian companies that issued convertible debentures recorded in the period from 1998 to 2006 and that presented liquidity on the market indicated that variation in beta, on average, is positive. These results are coherent with the signaling hypothesis and with the absence of convertible debenture issuing in 2005 and 2006 on the Brazilian market. They also may be related to the precarious financial situation of issuing companies, observed by the analysis of some financial indicators in year of issue and in two pre- e post-issuing years.

  14. Topic theory and Brazilian musicality: Considerations on rhetoricity in music

    Directory of Open Access Journals (Sweden)

    Acácio T. C. Piedade

    2013-02-01

    Full Text Available This article presents an application of the topic theory to the analyses of Brazilian music. It starts with a reflection on the concepts of musicality, friction of musicalities in Brazilian jazz, and the fusion of musicalities that emerges from the invention of tradition. The discussion follows with the question of the adaptability of topic theory to national musics. Then, some musical examples are used in order to present some of the universes of topics of Brazilian music. In this article I argue that the concept of rhetoricity brings good results to the study of musical signification, and that the theory of topics is useful for other contexts than classical music, being an interesting route to the investigation of sociocultural connections in musicalities.

  15. Strategies for Sustainable Business and Performance in Brazilian Industrial Companies

    Directory of Open Access Journals (Sweden)

    Clandia Maffini Gomes

    2013-04-01

    Full Text Available The study looks to analyze the adoption of strategies for sustainable business and the performance of Brazilian industrial companies. The quantitative character research has involved the execution of a survey. The results have permitted to conclude that the Brazilian companies are enlarging their participation in the international market. However, one must observe that some factors still limit this performance in terms of innovation management and socio-environmental management. Concerning the technological innovation management, one observes that, in spite of the growth of use of external sources of innovation over the last few years, one must still go a long way in the sense of developing a corporate culture that may value the partnership and the collaboration between the companies. Concerning socio-environmental management, the research data confirm the studies by authors mentioned in the literature review who maintain that most Brazilian companies still adopt a reactive stance in relation to these issues.

  16. EMPHASIZING SOCIAL ISSUES TOWARD SUSTAINABLE SUPPLY CHAIN: A BRAZILIAN PERSPECTIVE

    Directory of Open Access Journals (Sweden)

    Minelle Enéas da Silva

    2015-06-01

    Full Text Available From sustainability perspective, the supply chain management strategy can use different indicators related to Triple Bottom Line to improve its practices. Some studies in the topic have focused only environmental issues; however in some cases the social issues should be considered as a core of the sustainable strategies. Considering this view, the paper aims to highlight the relevance of social issues in the Brazilian context toward sustainable supply chain. Therefore, a theoretical essay was conducted using the literature about sustainable supply chain in relation to the Brazilian perspective to understand how it is possible to use new approaches for a more emphasis on social issues. The discussions indicates that to re-conceptualize the social relations in supply chains, it's necessary to use corporate social responsibility and social capital approaches to create a better discussion about sustainable supply chain. The proposal starts a discussion in the Brazilian context to stimulate new scholars to study this topic.

  17. The 2014 Elections and the Brazilian Party System

    Directory of Open Access Journals (Sweden)

    Carlos Ranulfo Melo

    2015-04-01

    Full Text Available The Brazilian party system presents a paradox. Although the Workers Party (PT and the Brazilian Social Democratic Party (PSDB have controlled presidential elections for the last 20 years, their force at the other levels of electoral competition has not grown. The objective of this study is to undertake a discussion of this situation through the 2014 general elections. After attempting to explain why successive challengers have not been able to change the structure of competition for the Brazilian presidency, I will analyze the relation established between the pattern observed at this level and the other “connected” electoral disputes—both those for state executive and federal legislative office. The general conclusion is that even if the pattern continues, it is quite improbable that this will significantly impact the other levels of national political party competition.

  18. Chemical composition of cold pressed Brazilian grape seed oil

    Directory of Open Access Journals (Sweden)

    Fernanda Branco SHINAGAWA

    2017-10-01

    Full Text Available Abstract Grape seed oil (GSO is an important by-product of the wine-making industry which has received attention as an alternative source of vegetable oils; its chemical compounds can be influenced by agricultural practices and industrial processing. Knowledge of the composition of Brazilian GSO is scarce; thus, this study aimed to analyze the chemical characteristics, as well as the antioxidant activity of these oils. GSO samples were obtained from Brazilian markets and showed significantly high amounts of phenolic, γ-tocotrienol and phytosterols as well as, the presence of several volatile compounds. Based on these results, is possible to show that oils exhibited good antioxidant activity. Therefore, it can be inferred that Brazilian GSO had a considerable content of phytochemical compounds with biological activity, which allows its association with other vegetable oils.

  19. 2 nd Brazilian Consensus on Chagas Disease, 2015.

    Science.gov (United States)

    Dias, João Carlos Pinto; Ramos, Alberto Novaes; Gontijo, Eliane Dias; Luquetti, Alejandro; Shikanai-Yasuda, Maria Aparecida; Coura, José Rodrigues; Torres, Rosália Morais; Melo, José Renan da Cunha; Almeida, Eros Antonio de; Oliveira, Wilson de; Silveira, Antônio Carlos; Rezende, Joffre Marcondes de; Pinto, Fabiane Scalabrini; Ferreira, Antonio Walter; Rassi, Anis; Fragata, Abílio Augusto; Sousa, Andréa Silvestre de; Correia, Dalmo; Jansen, Ana Maria; Andrade, Glaucia Manzan Queiroz; Britto, Constança Felícia De Paoli de Carvalho; Pinto, Ana Yecê das Neves; Rassi, Anis; Campos, Dayse Elisabeth; Abad-Franch, Fernando; Santos, Silvana Eloi; Chiari, Egler; Hasslocher-Moreno, Alejandro Marcel; Moreira, Eliane Furtado; Marques, Divina Seila de Oliveira; Silva, Eliane Lages; Marin-Neto, José Antonio; Galvão, Lúcia Maria da Cunha; Xavier, Sergio Salles; Valente, Sebastião Aldo da Silva; Carvalho, Noêmia Barbosa; Cardoso, Alessandra Viana; Silva, Rafaella Albuquerque E; Costa, Veruska Maia da; Vivaldini, Simone Monzani; Oliveira, Suelene Mamede; Valente, Vera da Costa; Lima, Mayara Maia; Alves, Renato Vieira

    2016-12-01

    Chagas disease is a neglected chronic condition with a high burden of morbidity and mortality. It has considerable psychological, social, and economic impacts. The disease represents a significant public health issue in Brazil, with different regional patterns. This document presents the evidence that resulted in the Brazilian Consensus on Chagas Disease. The objective was to review and standardize strategies for diagnosis, treatment, prevention, and control of Chagas disease in the country, based on the available scientific evidence. The consensus is based on the articulation and strategic contribution of renowned Brazilian experts with knowledge and experience on various aspects of the disease. It is the result of a close collaboration between the Brazilian Society of Tropical Medicine and the Ministry of Health. It is hoped that this document will strengthen the development of integrated actions against Chagas disease in the country, focusing on epidemiology, management, comprehensive care (including families and communities), communication, information, education, and research .

  20. Neotectonics in the northern equatorial Brazilian margin

    Science.gov (United States)

    Rossetti, Dilce F.; Souza, Lena S. B.; Prado, Renato; Elis, Vagner R.

    2012-08-01

    An increasing volume of publications has addressed the role of tectonics in inland areas of northern Brazil during the Neogene and Quaternary, despite its location in a passive margin. Hence, northern South America plate in this time interval might have not been as passive as usually regarded. This proposal needs further support, particularly including field data. In this work, we applied an integrated approach to reveal tectonic structures in Miocene and late Quaternary strata in a coastal area of the Amazonas lowland. The investigation, undertaken in Marajó Island, mouth of the Amazonas River, consisted of shallow sub-surface geophysical data including vertical electric sounding and ground penetrating radar. These methods were combined with morphostructural analysis and sedimentological/stratigraphic data from shallow cores and a few outcrops. The results revealed two stratigraphic units, a lower one with Miocene age, and an upper one of Late Pleistocene-Holocene age. An abundance of faults and folds were recorded in the Miocene deposits and, to a minor extent, in overlying Late Pleistocene-Holocene strata. In addition to characterize these structures, we discuss their origin, considering three potential mechanisms: Andean tectonics, gravity tectonics related to sediment loading in the Amazon Fan, and rifting at the continental margin. Amongst these hypotheses, the most likely is that the faults and folds recorded in Marajó Island reflect tectonics associated with the history of continental rifting that gave rise to the South Atlantic Ocean. This study supports sediment deposition influenced by transpression and transtension associated with strike-slip divergence along the northern Equatorial Brazilian margin in the Miocene and Late Pleistocene-Holocene. This work records tectonic evidence only for the uppermost few ten of meters of this sedimentary succession. However, available geological data indicate a thickness of up to 6 km, which is remarkably thick for

  1. The Brazilian Science Data Center (BSDC)

    Science.gov (United States)

    de Almeida, Ulisses Barres; Bodmann, Benno; Giommi, Paolo; Brandt, Carlos H.

    Astrophysics and Space Science are becoming increasingly characterised by what is now known as “big data”, the bottlenecks for progress partly shifting from data acquisition to “data mining”. Truth is that the amount and rate of data accumulation in many fields already surpasses the local capabilities for its processing and exploitation, and the efficient conversion of scientific data into knowledge is everywhere a challenge. The result is that, to a large extent, isolated data archives risk being progressively likened to “data graveyards”, where the information stored is not reused for scientific work. Responsible and efficient use of these large data-sets means democratising access and extracting the most science possible from it, which in turn signifies improving data accessibility and integration. Improving data processing capabilities is another important issue specific to researchers and computer scientists of each field. The project presented here wishes to exploit the enormous potential opened up by information technology at our age to advance a model for a science data center in astronomy which aims to expand data accessibility and integration to the largest possible extent and with the greatest efficiency for scientific and educational use. Greater access to data means more people producing and benefiting from information, whereas larger integration of related data from different origins means a greater research potential and increased scientific impact. The project of the BSDC is preoccupied, primarily, with providing tools and solutions for the Brazilian astronomical community. It nevertheless capitalizes on extensive international experience, and is developed in full cooperation with the ASI Science Data Center (ASDC), from the Italian Space Agency, granting it an essential ingredient of internationalisation. The BSDC is Virtual Observatory-complient and part of the “Open Universe”, a global initiative built under the auspices of the

  2. INNOVATION PROCESS IN OPEN CAPITAL BRAZILIAN COMPANIES

    Directory of Open Access Journals (Sweden)

    Ricardo Floriani

    2013-12-01

    Full Text Available This study aims to identify the innovation process used by the open capital Brazilian companies and establish a ranking of the potentially innovative ones. For this, a questionnaire was sent to 484 companies with shares traded in Bovespa, receiving a response from 22. The innovation process is based on the model of Barrett and Sexton (2006. A summary of the results is presented below. (i Organizational Capabilities – 95.5% answered that they have incentives for innovation activities and 68.2% reported having procedures for all services. The leadership has a facilitator role encouraging the initiative (86.4% and promotes the maintenance of the group relationship (72.7%. Value risk taking, even through failures and prioritize the learning and experimenting new ideas. (ii Background of the innovation – reveals aspects of the capacity (internal or (external. Of the respondents, 59.1% developed internal activities of continuing P & D. Training to innovate is present in a continuous or occasional basis in 81.8% of the companies. The respondents characterize the economic environment as dynamic and the majority purchased software and equipments. In only 12 opportunities was a reference to obtaining patents as innovation protection measure. (iii Focus of innovation – the majority of the companies mentioned process or product innovation. Rewards are offered when the objectives are met and it is brought to attention when this does not occur. (iv Highlighted performance – the innovations achieved the expectations and created effects. The relevant benefits noticed were: improvement in quality of goods and services, increase of market share, increase of goods and services, and increase of productive capacity.

  3. Hygienic behaviour in Brazilian stingless bees

    Directory of Open Access Journals (Sweden)

    Hasan Al Toufailia

    2016-11-01

    Full Text Available Social insects have many defence mechanisms against pests and pathogens. One of these is hygienic behaviour, which has been studied in detail in the honey bee, Apis mellifera. Hygienic honey bee workers remove dead and diseased larvae and pupae from sealed brood cells, thereby reducing disease transfer within the colony. Stingless bees, Meliponini, also rear broods in sealed cells. We investigated hygienic behaviour in three species of Brazilian stingless bees (Melipona scutellaris, Scaptotrigona depilis, Tetragonisca angustula in response to freeze-killed brood. All three species had high mean levels of freeze-killed brood removal after 48 h ∼99% in M. scutellaris, 80% in S. depilis and 62% in T. angustula (N=8 colonies per species; three trials per colony. These levels are greater than in unselected honey bee populations, ∼46%. In S. depilis there was also considerable intercolony variation, ranging from 27% to 100% removal after 2 days. Interestingly, in the S. depilis colony with the slowest removal of freeze-killed brood, 15% of the adult bees emerging from their cells had shrivelled wings indicating a disease or disorder, which is as yet unidentified. Although the gross symptoms resembled the effects of deformed wing virus in the honey bee, this virus was not detected in the samples. When brood comb from the diseased colony was introduced to the other S. depilis colonies, there was a significant negative correlation between freeze-killed brood removal and the emergence of deformed worker bees (P=0.001, and a positive correlation with the cleaning out of brood cells (P=0.0008. This shows that the more hygienic colonies were detecting and removing unhealthy brood prior to adult emergence. Our results indicate that hygienic behaviour may play an important role in colony health in stingless bees. The low levels of disease normally seen in stingless bees may be because they have effective mechanisms of disease management, not because

  4. Stylized Facts in Brazilian Vote Distributions

    Science.gov (United States)

    Calvão, Angelo Mondaini; Crokidakis, Nuno; Anteneodo, Celia

    2015-01-01

    Elections, specially in countries such as Brazil, with an electorate of the order of 100 million people, yield large-scale data-sets embodying valuable information on the dynamics through which individuals influence each other and make choices. In this work we perform an extensive analysis of data sets available for Brazilian proportional elections of legislators and city councilors throughout the period 1970–2014, which embraces two distinct political regimes: a military regime followed by a democratic one. We perform a comparative analysis of elections for legislative positions, in different states and years, through the distribution p(v) of the number of candidates receiving v votes. We show the impact of the different political regimes on the vote distributions. Although p(v) has a common shape, with a scaling behavior, quantitative details change over time and from one electorate to another. In order to interpret the observed features, we propose a multi-species model consisting in a system of nonlinear differential equations, with values of the parameters that reflect the heterogeneity of candidates. In its simplest setting, the model can not explain the cutoff, formed by the most voted candidates, whose success is determined mainly by their peculiar, intrinsic characteristics, such as previous publicity. However, the modeling allows to interpret the scaling of p(v), yielding a predictor of the degree of feedback in the interactions of the electorate. Knowledge of the feedback is relevant beyond the context of elections, since a similar interactivity may occur for other social contagion processes in the same population. PMID:26418863

  5. Natural radionuclides in Brazilian underground mines

    International Nuclear Information System (INIS)

    Santos, Talita de Oliveira

    2015-01-01

    Rock, soil and water contain 238 U and 232 Th and their decay products. The distribution of these radionuclides differs in terms of activity concentration depending on the mineral type and origin. All ore processing releases long and short half-life radionuclides, mainly radon and its progeny. It is important to monitor this gas and its decay products in underground mines in order to assess the radiological hazards of the exposed workers. On this concern, the present work outlines the characterization of brazilian underground mines with relation to natural radionuclides, specially radon and its progeny. The radon concentration was measured by using E-PERM Electrets Ion Chamber (Radelec), AlphaGUARD (Saphymo GmbH) and CR-39 (Landauer) track etch detectors. The radon progeny was determined by using DOSEman detector. The equilibrium state between radon and its progeny was calculated. Based on these data, the total effective dose for miners was estimated. Moreover, the contribution from the main sources to the radon level inside mines was evaluated. For this, the following detectors were used: measurements of radon concentrations in soil gas were carried out by using AlphaGUARD detector; 226 Ra ( 214 Bi), 232 Th e 40 K specific activity in ore and soil samples were determined by using gamma-ray spectrometry HPGe detector (Canberra); and radon concentration in groundwater samples was performed by using RAD7 (Durridge Inc.). The radon concentration ranged from 113 to 8171 Bq.m -3 and the Equilibrium Equivalent Concentration varied from 76 to 1174 Bq.m -3 . The equilibrium factor mean value was 0.4 (0.2 -0.7). The workers estimated total effective dose ranged from 1 to 22 mSv.a -1 (mean 10 mSv.a -1 ). Therefore, results show the importance to assess continually and permanently the radon and its progeny behavior and the need to adopt safety measurements against natural radiation in underground mines environment. (author)

  6. Hygienic behaviour in Brazilian stingless bees

    Science.gov (United States)

    Alves, Denise A.; Bento, José M. S.; Marchini, Luis C.; Ratnieks, Francis L. W.

    2016-01-01

    ABSTRACT Social insects have many defence mechanisms against pests and pathogens. One of these is hygienic behaviour, which has been studied in detail in the honey bee, Apis mellifera. Hygienic honey bee workers remove dead and diseased larvae and pupae from sealed brood cells, thereby reducing disease transfer within the colony. Stingless bees, Meliponini, also rear broods in sealed cells. We investigated hygienic behaviour in three species of Brazilian stingless bees (Melipona scutellaris, Scaptotrigona depilis, Tetragonisca angustula) in response to freeze-killed brood. All three species had high mean levels of freeze-killed brood removal after 48 h ∼99% in M. scutellaris, 80% in S. depilis and 62% in T. angustula (N=8 colonies per species; three trials per colony). These levels are greater than in unselected honey bee populations, ∼46%. In S. depilis there was also considerable intercolony variation, ranging from 27% to 100% removal after 2 days. Interestingly, in the S. depilis colony with the slowest removal of freeze-killed brood, 15% of the adult bees emerging from their cells had shrivelled wings indicating a disease or disorder, which is as yet unidentified. Although the gross symptoms resembled the effects of deformed wing virus in the honey bee, this virus was not detected in the samples. When brood comb from the diseased colony was introduced to the other S. depilis colonies, there was a significant negative correlation between freeze-killed brood removal and the emergence of deformed worker bees (P=0.001), and a positive correlation with the cleaning out of brood cells (P=0.0008). This shows that the more hygienic colonies were detecting and removing unhealthy brood prior to adult emergence. Our results indicate that hygienic behaviour may play an important role in colony health in stingless bees. The low levels of disease normally seen in stingless bees may be because they have effective mechanisms of disease management, not because they lack

  7. Low aerobic fitness in Brazilian adolescents

    Directory of Open Access Journals (Sweden)

    Diego Augusto Santos Silva

    2015-04-01

    Full Text Available INTRODUCTION: aerobic fitness is considered one of the most important components of health-related physical fitness, with low levels related to increased risk of premature death from all causes, especially cardiovascular diseases. OBJECTIVE: to identify the characteristics of adolescents at higher risk of low levels of aerobic fitness. METHODS: the study included 696 adolescents 15-17 years of age enrolled in public high schools of Florianópolis, southern Brazil. This cross-sectional epidemiological study was conducted in Florianópolis, Santa Catarina, Brazil. Aerobic fitness was measured using the modified Canadian Aerobic Fitness Test mCAFT. Sociodemographic gender, age, school grade, paternal and maternal schooling, socioeconomic status, and anthropometric variables body weight, height, triceps and subscapular skinfold thickness, sexual maturation, physical activity, sedentary behavior, and eating habits were collected. RESULTS: it was found that 31.5% of adolescents had low aerobic fitness levels, being higher in boys 49.2% compared to girls 20.6%. Moreover, girls with sedentary behavior, overweight and high body fat percentage were the groups most likely to have inadequate aerobic fitness. In males, the groups most likely to have inadequate aerobic fitness were those whose parents studied more than eight years, those with low levels of physical activity, and those with inadequate nutrition and excessive body fat. CONCLUSION: low aerobic fitness levels were present in one third of adolescents and was more prevalent in boys. Lifestyle changes, including replacement of sedentary behaviors by physical and sport activities , may assist in improving the aerobic fitness of Brazilian adolescents.

  8. I RBH - First Brazilian Hypertension Registry

    Directory of Open Access Journals (Sweden)

    Paulo César Brandão Veiga Jardim

    Full Text Available Abstract Background: A registry assessing the care of hypertensive patients in daily clinical practice in public and private centers in various Brazilian regions has not been conducted to date. Such analysis is important to elucidate the effectiveness of this care. Objective: To document the current clinical practice for the treatment of hypertension with identification of the profile of requested tests, type of administered treatment, level of blood pressure (BP control, and adherence to treatment. Methods: National, observational, prospective, and multicenter study that will include patients older than 18 years with hypertension for at least 4 weeks, following up in public and private centers and after signing a consent form. The study will exclude patients undergoing dialysis, hospitalized in the previous 30 days, with class III or IV heart failure, pregnant or nursing, with severe liver disease, stroke or acute myocardial infarction in the past 30 days, or with diseases with a survival prognosis < 1 year. Evaluations will be performed at baseline and after 1 year of follow-up. The parameters that will be evaluated include anthropometric data, lifestyle habits, BP levels, lipid profile, metabolic syndrome, and adherence to treatment. The primary outcomes will be hospitalization due to hypertensive crisis, cardiocirculatory events, and cardiovascular death, while secondary outcomes will be hospitalization for heart failure and requirement of dialysis. A subgroup analysis of 15% of the sample will include noninvasive central pressure evaluation at baseline and study end. The estimated sample size is 3,000 individuals for a prevalence of 5%, sample error of 2%, and 95% confidence interval. Results: The results will be presented after the final evaluation, which will occur at the end of a 1-year follow-up. Conclusion: The analysis of this registry will improve the knowledge and optimize the treatment of hypertension in Brazil, as a way of

  9. Brazilian union actions for workers' health protection.

    Science.gov (United States)

    Repullo Junior, Rodolpho; Gomes, Jorge da Rocha

    2005-01-02

    Many authors have emphasized the importance of worker strength through unionized organizations, in relation to the improvement of working procedures, and have reported on the decisiveness of labor movement actions in achieving modifications within the field of work and health. To describe the ways in which Brazilian unions have tried to intervene in health-illness and work processes, identifying the existence of commonality in union actions in this field. Qualitative study. Postgraduate Program, Environmental Health Department, Faculdade de Saúde Publica, Universidade de São Paulo, São Paulo, Brazil. Union health advisers and directors were interviewed. Documents relating to union action towards protecting workers' health were collected and analyzed. Unions articulate actions regarding workers' health of a technical and political nature that involve many aspects and high complexity. These have been divided into thematic categories for better analysis. Union actions regarding workers' health in Brazil are restricted to some unions, located mainly in the southern, southeastern and northeastern regions of the country. Nonetheless, the unions undertaking such actions represent many professions of great economic and political importance. The recent changes in health and safety at work regulations, recognition of professional diseases, creation of workers' health services and programs within the unified health system, and operational improvements in companies' specialized safety and occupational medicine services, all basically result from union action. There is commonality of union action in this field in its seeking of technical and political strengthening for all workers and their general and local representation. This has the objective of benefiting collective bargaining between employers and workers. Inter-institutional action on behalf of workers' rights guarantees and amplifies the improvement of health and working conditions.

  10. Brazilian union actions for workers' health protection

    Directory of Open Access Journals (Sweden)

    Rodolpho Repullo Junior

    Full Text Available CONTEXT: Many authors have emphasized the importance of worker strength through unionized organizations, in relation to the improvement of working procedures, and have reported on the decisiveness of labor movement actions in achieving modifications within the field of work and health. OBJECTIVE: To describe the ways in which Brazilian unions have tried to intervene in health-illness and work processes, identifying the existence of commonality in union actions in this field. TYPE OF STUDY: Qualitative study. SETTING: Postgraduate Program, Environmental Health Department, Faculdade de Saúde Pública, Universidade de São Paulo, São Paulo, Brazil. METHODS: Union health advisers and directors were interviewed. Documents relating to union action towards protecting workers' health were collected and analyzed. RESULTS: Unions articulate actions regarding workers' health of a technical and political nature that involve many aspects and high complexity. These have been divided into thematic categories for better analysis. DISCUSSION: Union actions regarding workers' health in Brazil are restricted to some unions, located mainly in the southern, southeastern and northeastern regions of the country. Nonetheless, the unions undertaking such actions represent many professions of great economic and political importance. CONCLUSIONS: The recent changes in health and safety at work regulations, recognition of professional diseases, creation of workers' health services and programs within the unified health system, and operational improvements in companies' specialized safety and occupational medicine services, all basically result from union action. There is commonality of union action in this field in its seeking of technical and political strengthening for all workers and their general and local representation. This has the objective of benefiting collective bargaining between employers and workers. Inter-institutional action on behalf of workers' rights

  11. The Brazilian Portuguese Lexicon: An Instrument for Psycholinguistic Research.

    Science.gov (United States)

    Estivalet, Gustavo L; Meunier, Fanny

    2015-01-01

    In this article, we present the Brazilian Portuguese Lexicon, a new word-based corpus for psycholinguistic and computational linguistic research in Brazilian Portuguese. We describe the corpus development, the specific characteristics on the internet site and database for user access. We also perform distributional analyses of the corpus and comparisons to other current databases. Our main objective was to provide a large, reliable, and useful word-based corpus with a dynamic, easy-to-use, and intuitive interface with free internet access for word and word-criteria searches. We used the Núcleo Interinstitucional de Linguística Computacional's corpus as the basic data source and developed the Brazilian Portuguese Lexicon by deriving and adding metalinguistic and psycholinguistic information about Brazilian Portuguese words. We obtained a final corpus with more than 30 million word tokens, 215 thousand word types and 25 categories of information about each word. This corpus was made available on the internet via a free-access site with two search engines: a simple search and a complex search. The simple engine basically searches for a list of words, while the complex engine accepts all types of criteria in the corpus categories. The output result presents all entries found in the corpus with the criteria specified in the input search and can be downloaded as a.csv file. We created a module in the results that delivers basic statistics about each search. The Brazilian Portuguese Lexicon also provides a pseudoword engine and specific tools for linguistic and statistical analysis. Therefore, the Brazilian Portuguese Lexicon is a convenient instrument for stimulus search, selection, control, and manipulation in psycholinguistic experiments, as also it is a powerful database for computational linguistics research and language modeling related to lexicon distribution, functioning, and behavior.

  12. Spinopelvic parameters evaluation in a Brazilian population sample.

    Science.gov (United States)

    Jacob, C J; Cardoso, I M; Batista, J L J; Maia, T C; Roncaglio, B

    2015-07-01

    The morphology of the spine is variable within a population, and its maintenance in appropriate values implies a decrease in the energy expended. We need to know their normal values in population. This study aims to carry out a literature review and evaluate published papers on spinopelvic parameters in a Brazilian population sample. Eleven potentially eligible papers were initially identified for inclusion in this review: three papers from PubMed and eight from Medicine. Out of these, only five papers contained methodology and relevant significance level, and therefore, they were included in the final analytical run. According to a Brazilian study, Pratali mentions no significant difference in the average values of spinopelvic balance in the Brazilian population and those found in the literature; there was also no significant difference comparing Brazilian and Korean population; however, a difference was found in comparison with European population regarding PI parameters and SS, but the latter with higher values. According to Kulcheski (Column/Columna 12:224-227, 2013), the values of pelvic tilt in the Brazilian population evaluated in his research were 19° (10°-35°) and the sacral inclination was 38° (30°-55°), presenting similar values concerning the European population. In another Brazilian paper, Oliveira (Rev Bras Ort 49:189-193, 2014) reports that the research population had PI average of 45° (41.9°-48.1°). The values obtained are relatively minor when compared to the European population. However, all of these are within the normal margin considered in the worldwide literature.

  13. Brazilian research on extremophiles in the context of astrobiology

    Science.gov (United States)

    Duarte, Rubens T. D.; Nóbrega, Felipe; Nakayama, Cristina R.; Pellizari, Vivian H.

    2012-10-01

    Extremophiles are organisms adapted to grow at extreme ranges of environmental variables, such as high or low temperatures, acid or alkaline medium, high salt concentration, high pressures and so forth. Most extremophiles are micro-organisms that belong to the Archaea and Bacteria domains, and are widely spread across the world, which include the polar regions, volcanoes, deserts, deep oceanic sediments, hydrothermal vents, hypersaline lakes, acid and alkaline water bodies, and other extreme environments considered hostile to human life. Despite the tropical climate, Brazil has a wide range of ecosystems which include some permanent or seasonally extreme environments. For example, the Cerrado is a biome with very low soil pH with high Al+3 concentration, the mangroves in the Brazilian coast are anaerobic and saline, Pantanal has thousands of alkaline-saline lakes, the Caatinga arid and hot soils and the deep sea sediments in the Brazilian ocean shelf. These environments harbour extremophilic organisms that, coupled with the high natural biodiversity in Brazil, could be explored for different purposes. However, only a few projects in Brazil intended to study the extremophiles. In the frame of astrobiology, for example, these organisms could provide important models for defining the limits of life and hypothesize about life outside Earth. Brazilian microbiologists have, however, studied the extremophilic micro-organisms inhabiting non-Brazilian environments, such as the Antarctic continent. The experience and previous results obtained from the Brazilian Antarctic Program (PROANTAR) provide important results that are directly related to astrobiology. This article is a brief synopsis of the Brazilian experience in researching extremophiles, indicating the most important results related to astrobiology and some future perspectives in this area.

  14. Applied risk analysis to the future Brazilian electricity generation matrix

    Energy Technology Data Exchange (ETDEWEB)

    Maues, Jair; Fernandez, Eloi; Correa, Antonio

    2010-09-15

    This study compares energy conversion systems for the generation of electrical power, with an emphasis on the Brazilian energy matrix. The financial model applied in this comparison is based on the Portfolio Theory, developed by Harry Markowitz. The risk-return ratio related to the electrical generation mix predicted in the National Energy Plan - 2030, published in 2006 by the Brazilian Energy Research Office, is evaluated. The increase of non-traditional renewable energy in this expected electrical generating mix, specifically, residues of sugar cane plantations and wind energy, reduce not only the risk but also the average cost of the kilowatt-hour generated.

  15. Strategies practices of outstandings national wineries in the Brazilian market

    Directory of Open Access Journals (Sweden)

    Pisso Maximiliano Raúl Germán

    2016-01-01

    Full Text Available This work aimed to identify the strategies practices of outstanding national wineries on the Brazilian wine market from the perspective of Strategy as Practice. To conduct the survey, a multi-case study was developed in three Brazilian wineries, where the managers involved in strategic activities were interviewed and observed. Faithful to the recommendations of Strategy as Practice authors, this work sought to understand how context's forces, past experiences, and firms resources shape and guide the disposition of actors for a particular strategic choice that became ordinary practices.

  16. Overview of Brazilian industrial radiography accidents with cutaneous radiation syndrome

    International Nuclear Information System (INIS)

    Lima, C.M.A.; Silva, F.C.A. da

    2017-01-01

    It is well documented that industrial radiography is related to radiological accidents, which makes it the highest potential risk for human health. More than 80 radiological accidents happened in the world that includes 6 Brazilian accidents with Cutaneous Radiation Syndrome. Five of them happened with 192 Ir and one with 60 Co radioactive sources. Nineteen members of the public and 8 radiographers were involved. All of them suffered severe hands and fingers injuries. The Brazilian radiological accident happened in 1985 with 16 persons is analyzed showing causes, consequences, radiation doses and lessons learned. (author)

  17. Brazilian energy balance 1999: 1983 to 1998 period

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in every sector of the Brazilian economy, for the 1983 to 1998 period. It is divided into nine chapters, as follows: summary; energy supply and consumption by source; energy consumption by sector; energy import and export; transformation centers balances; energy resources and reserves; energy and socio economy; energy data relating to brazilian states; and appendices - installed capacity, world data, general structure of the balance, information processing, conversion units and consolidated energy balance.

  18. Brazilian energy balance 1999: 1983 to 1998 period

    International Nuclear Information System (INIS)

    1999-01-01

    This report shows the energy flows of different primary and secondary sources, from the production to the final consumption in every sector of the Brazilian economy, for the 1983 to 1998 period. It is divided into nine chapters, as follows: summary; energy supply and consumption by source; energy consumption by sector; energy import and export; transformation centers balances; energy resources and reserves; energy and socio economy; energy data relating to brazilian states; and appendices - installed capacity, world data, general structure of the balance, information processing, conversion units and consolidated energy balance

  19. The Raven and its flight to the Brazilian sing Language

    Directory of Open Access Journals (Sweden)

    Emerson Cristian Pereira dos Santos

    2017-05-01

    Full Text Available Poe’s The raven has received several translations since it was first published in 1845, with many translators having already ventured into trying to understand its plot, which centers around a raven and its simple, albeit cold and terrifying, reply to a lonely bereaved lover, in an effort to transpose it into other languages and cultures. Now this enigmatic bird has come to visit the Brazilian deaf culture. This article discusses some strategies used in my translation of the poem into LIBRAS (Brazilian Sign Language

  20. The oil and gas sector in the brazilian economy

    OpenAIRE

    Guilhoto, Joaquim J.M.; Ichihara, Silvio Massaru; Postali, Fernando Antonio Slaibe

    2007-01-01

    This paper presents the results of a research conducted to measure the importance of the oil and gas complex in the Brazilian economy and in its states, henceforth called O&G. Initially, the efforts were concentrated on the construction of an interregional input-output system for the 27 states of the Brazilian economy at the level of 42 industries, for the year of 2002. By using this system, it was possible to make an analysis of the role played by the oil and gas complex in the Brazi...

  1. Economical and strategical aspects of Brazilian-Germany nuclear agreement

    International Nuclear Information System (INIS)

    Carvalho, J.F. de.

    1981-01-01

    The strategical and economical aspects of Brazilian-Germany nuclear agreement are analyzed in three aspects: 1) The nuclear agreement in the context of the Brazilian economic - and social development process, considering the availability of energetic resouces of the country. Political implications. Considerations about creation and transfer of technology. 2) The economy aspects involved in the agreement. Comparison costs of electrical energy generated in a nuclear power plants and hydroelectric plant in Brazil. Impacts on the industrial development. 3) Strategical aspects. (E.G.) [pt

  2. The Brazilian biofuels programme and trends for the future

    International Nuclear Information System (INIS)

    Penteado Neto, Renato de Arruda; Cunha, Ricardo Brasil Correa

    2008-01-01

    In Brazil the use of biofuels has increased along the last decades and the participation on the national energy matrix is expected to be more relevant in the near future. Ethanol and biodiesel are the main types of biofuel used in the transport sector. Brazil was responsible for 41% of the total world ethanol production in 2006. As far as vehicles are concerned, the participation of flexfuel cars in the Brazilian market in 2007 was 65%. The Brazilian Government implemented in 2005 its Biodiesel National Programme. In 2008 a mixture of 2% in diesel is mandatory, representing 840 million litres per year. (author)

  3. Where is the coffee?: Coffee and Brazilian identity

    Directory of Open Access Journals (Sweden)

    Steven Topik

    1998-12-01

    Full Text Available Brazil and Coffee. Historians tend to identify both. But coffee occupies a small place, even a negative one, in Brazilian national identity. This article shows that neither literature nor historical studies have focused their attention on it. The focus is always on colonial heritage, geography or racial mixture. Rural areas are seen as backward with no contributions to national identity, but rather hindering it. In colonial times coffee was unimportant. In the XIX century, it engendered slavery and latifundia. In our own century, coffee's most important role was that of being denied by urbanization and industry. If God is Brazilian, he does not drink coffee.

  4. Amateur filmmaking in the history of Brazilian cinema

    OpenAIRE

    Lila Silva Foster

    2016-01-01

    As in many national cinemas, the history of Brazilian amateur film is still in its early stages of investigation. In addition to this historiographical deficit, there are many ways in which amateur cinema is a small and less visible production: films shot in 16mm, 9.5mm and Super 8 are dispensable and Brazilian film archives and cinemateques only started cataloguing these materials in recent years. In the following paper we wish to establish a set of theoretic and historical guidelines to ana...

  5. Brazilian sardine (Sardinella brasiliensis spawning in the southeast Brazilian Bight over the period 1976-1993

    Directory of Open Access Journals (Sweden)

    Yasunobu Matsuura

    1998-01-01

    Full Text Available Based on sampling over the period 1976-1993 in the southeast Brazilian Bight, the distribution of spawning of the Brazilian sardine (Sardinella brasi/iensis is described in relation to environmental conditions. The area of intense spawning occurs in the southern part of the bight where coastal upwelling was less /Tequent. Spawning intensity showed high interannllal variation and the egg abundance in the survey area ranged /Tom 99 billion eggs in the January 1988 cruise to 4669 billion eggs in the January 1981 cruise. Peak spawning takes place one hour after midnight and eggs hatch . out within 19 hours with a water temperature of 24 °e.Baseado nos dados coletados durante nove cruzeiros oceanográficos realizados na região sudeste, as áreas de desova da sardinha-verdadeira (Sardinella brasiliensis foram apresentadas c discutidas em relação às condições oceanográficas. As áreas de desova intensiva foram localizadas na parte sul da área de investigação, onde a ressurgência costeira foi menos freqüente. A intensidade de desova demonstrou uma variação anual relativamente grande. A produção total de ovos da sardinha- ­verdadeira variou de 99 bilhões de ovos durante o cruzeiro de janeiro de 1988 para 4669 bilhões de ovos em janeiro de 1981. O pico de desova ocorre na camada de mistura de superfície uma hora após a meia noite e os ovos eclodem em 19 horas com a temperatura de água 24 °e.

  6. We, the others: construction of the exotic and consumption of brazilian fashion in France

    Directory of Open Access Journals (Sweden)

    Débora Krischke Leitão

    Full Text Available This article discusses the consumption of Brazilian products - especially fashion and clothing - in France as a way of consuming the exotic. Drawing on ten months of fieldwork in France, I engage data collected there with my experience from previous research carried out in Brazil. Firstly, this article discusses exoticism, a topic that invariably broaches a debate about identity and alterity. Then, some particularities of "consuming the other" in French discourses about Brazilian products are analyzed. Finally, I conclude that the construction of Brazilian fashion as exoticism is simultaneously situated in the French imaginary about the Brazilian other and in the very Brazilian production of garment fashion.

  7. Review of the Brazilian experience in the licensing of nuclear power plants

    International Nuclear Information System (INIS)

    Lederman, L.; Laborne, J.J.

    1983-01-01

    Survey of the licensing of the Brazilian Nuclear Power Plants (NPPs) is presented. The organization and technical expertise of the Comissao Nacional de Energia Nuclear, the Brazilian Regulatory Body, is reviewed with regard to in-house experience, foreign consultants, agreements with regulatory bodies of other countries and research contracts with Brazilian univerisities. The application of the two-stage licensing process and the stage of development of Brazilian nuclear standards is described. Finally, the paper speculates about the future role of probabilistic risk assessment in the Brazilian licensing process

  8. lon beam analysis of Brazilian coffee

    International Nuclear Information System (INIS)

    Debastiani, R.; Santos, C.E.I. dos; Ramos, M.M.; Souza, V.S.; Yoneama, M.L.; Amaral, L.; Dias, J.F.

    2013-01-01

    Full text: Coffee is one of the most popular and consumed beverages worldwide. Consumers can make the beverage from different types of coffee such as ground coffee, instant coffee or grinding roasted coffee beans. Each type of coffee leads to different characteristics in flavor and scent. The aim of this work is to perform an elemental analysis of ground coffee and roasted coffee beans. To that end, eight popular Brazilian ground coffee brands have been chosen to make a comparative study among brands. One of these brands was selected for a complete study of the beverage preparation process. This same brand offers packages of roasted coffee beans, which allowed the elemental comparison between ground coffee and roasted coffee beans. Roasted coffee beans were ground with a pestle and mortar. The beverage was prepared using a typical coffee pot. The spent and liquid coffees were submitted to a heat treatment and subsequently homogenized and pressed into pellets. The filters used in the coffee pot were analyzed as well. For micro-PIXE studies, coffee beans were cut in different parts for analysis. Samples of ground coffee and roasted coffee beans (grind) were analyzed by PIXE, while light elements like C, O and N were analyzed by RBS (Rutherford Backscattering Spectrometry). The roasted coffee beans were analyzed by micro-PIXE to check the elemental distribution in the beans. The elements found in powder coffee were Mg, AI, Si, P, S, CI, K, Ca, Ti, Mn, Fe, Cu, Zn and Rb. Potassium is the element with higher concentration, while Ti and Zn are trace elements. AI, Si and Ti showed the same concentration for all brands. Potassium and chlorine have high solubility, and about 80% of their concentration is transferred from the powder to the beverage during the infusion. Mg, P, CI, K, Mn, Fe, Zn and Rb showed significant variation between ground coffee and roasted coffee beans. The elemental maps show that potassium and phosphorus are correlated, and iron appears in particular

  9. Antileishmanial activity and cytotoxicity of Brazilian plants.

    Science.gov (United States)

    Ribeiro, Tatiana G; Chávez-Fumagalli, Miguel A; Valadares, Diogo G; Franca, Juçara R; Lage, Paula S; Duarte, Mariana C; Andrade, Pedro H R; Martins, Vivian T; Costa, Lourena E; Arruda, Ana L A; Faraco, André A G; Coelho, Eduardo A F; Castilho, Rachel O

    2014-08-01

    Leishmaniasis is a major public health problem, and the alarming spread of parasite resistance has increased the importance of discovering new therapeutic products. The present study aimed to investigate the in vitro leishmanicidal activity from 16 different Brazilian medicinal plants. Stationary-phase promastigotes of Leishmania amazonensis and murine macrophages were exposed to 44 plant extracts or fractions for 48 h at 37°C, in order to evaluate their antileishmanial activity and cytotoxicity, respectively. The most potent extracts against L. amazonensis were the hexanic extract of Dipteryx alata (IC50 of 0.08 μg/mL), the hexanic extract of Syzygium cumini (IC50 of 31.64 μg/mL), the ethanolic and hexanic extracts of leaves of Hymenaea courbaril (IC50 of 44.10 μg/mL and 35.84 μg/mL, respectively), the ethanolic extract of H. stignocarpa (IC50 of 4.69 μg/mL), the ethanolic extract of Jacaranda caroba (IC50 of 13.22 μg/mL), and the ethanolic extract of J. cuspidifolia leaves (IC50 of 10.96 μg/mL). Extracts of D. alata and J. cuspidifolia presented higher selectivity index, with high leishmanicidal activity and low cytotoxicity in the mammalian cells. The capacity in treated infected macrophages using the extracts and/or fractions of D. alata and J. cuspidifolia was also analyzed, and reductions of 95.80%, 98.31%, and 97.16%, respectively, in the parasite burden, were observed. No nitric oxide (NO) production could be observed in the treated macrophages, after stimulation with the extracts and/or fractions of D. alata and J. cuspidifolia, suggesting that the biological activity could be due to mechanisms other than macrophage activation mediated by NO production. Based on phytochemistry studies, the classes of compounds that could contribute to the observed activities are also discussed. In conclusion, the data presented in this study indicated that traditional medicinal plant extracts present effective antileishmanial activity. Future studies could focus on

  10. Older adults abuse in three Brazilian cities.

    Science.gov (United States)

    Rodrigues, Rosalina Aparecida Partezani; Monteiro, Edilene Araújo; Santos, Ana Maria Ribeiro Dos; Pontes, Maria de Lourdes de Farias; Fhon, Jack Roberto Silva; Bolina, Alisson Fernandes; Seredynskyj, Fernanda Laporti; Almeida, Vanessa Costa; Giacomini, Suelen Borelli Lima; Defina, Giovanna Partezani Cardoso; Silva, Luipa Michele

    2017-01-01

    To analyze the police reports filed by older adults who suffered abuse in order to identify the socio-demographic characteristics of victims and aggressors, type of violence, location, as well as to compare rates in three Brazilian cities in the period from 2009 to 2013. Ecological study, in which 2,612 police reports registered in Police Stations were analyzed. An instrument was used to obtain data from the victim, the aggressor and the type of violence. Psychological abuse predominated and most cases occurred in the older adults own home. In the cities of Ribeirão Preto and João Pessoa, the older adults presented similar rates for both gender. Regarding the standardized rates, in João Pessoa, there was a rise of this type of abuse in the two first years, and later there was a certain stability. In the city of Teresina, there was an increase, also observed in the city of Ribeirão Preto in the three first years, followed by a decrease. Older adults abuse is a cultural phenomenon difficult to be reported by them, since it occurs in the family context. Analisar os boletins de ocorrência registrados por idosos que sofreram violência, a fim de identificar características sociodemográficas das vítimas e dos agressores, tipo de violência, local, bem como comparar as taxas em três municípios brasileiros no período de 2009 a 2013. Estudo ecológico, em que foram analisados 2.612 boletins de ocorrência registrados em Delegacias do Idoso. Utilizou-se um instrumento para obter dados da vítima, do agressor e tipo de violência. Predominou a violência psicológica, na maioria dos casos na própria residência do idoso. Em Ribeirão Preto e João Pessoa, os idosos mais jovens apresentaram taxas semelhantes entre ambos os sexos. Na comparação das taxas padronizadas, em João Pessoa, houve ascensão deste tipo de violência nos dois primeiros anos, e, posteriormente, certa estabilidade. Em Teresina, houve ascensão, também observada em Ribeirão Preto nos tr

  11. ERICA: smoking prevalence in Brazilian adolescents

    Directory of Open Access Journals (Sweden)

    Valeska Carvalho Figueiredo

    2016-02-01

    Full Text Available ABSTRACT OBJECTIVE To estimate the prevalences of tobacco use, tobacco experimentation, and frequent smoking among Brazilian adolescents. METHODS We evaluated participants of the cross-sectional, nation-wide, school-based Study of Cardiovascular Risks in Adolescents (ERICA, which included 12- to 17-year-old adolescents from municipalities of over 100 thousand inhabitants. The study sample had a clustered, stratified design and was representative of the whole country, its geographical regions, and all 27 state capitals. The information was obtained with self-administered questionnaires. Tobacco experimentation was defined as having tried cigarettes at least once in life. Adolescents who had smoked on at least one day over the previous 30 days were considered current cigarette smokers. Having smoked cigarettes for at least seven consecutive days was an indicator for regular consumption of tobacco. Considering the complex sampling design, prevalences and 95% confidence intervals were estimated according to sociodemographic and socio-environmental characteristics. RESULTS We evaluated 74,589 adolescents. Among these, 18.5% (95%CI 17.7-19.4 had smoked at least once in life, 5.7% (95%CI 5.3-6.2 smoked at the time of the research, and 2.5% (95%CI 2.2-2.8 smoked often. Adolescents aged 15 to 17 years had higher prevalences for all indicators than those aged 12 to 14 years. The prevalences did not differ significantly between sexes. The highest prevalences were found in the South region and the lowest ones, in the Northeast region. Regardless of sex, the prevalences were found to be higher for adolescents who had had paid jobs, who lived with only one parent, and who reported having been in contact with smokers either inside or outside their homes. Female public school adolescents were found to smoke more than the ones from private schools. CONCLUSIONS Tobacco use among adolescents is still a challenge. Intending to reduce the prevalence of tobacco use

  12. ERICA: smoking prevalence in Brazilian adolescents

    Science.gov (United States)

    Figueiredo, Valeska Carvalho; Szklo, André Salem; Costa, Letícia Casado; Kuschnir, Maria Cristina C; da Silva, Thiago Luiz Nogueira; Bloch, Katia Vergetti; Szklo, Moyses

    2016-01-01

    ABSTRACT OBJECTIVE To estimate the prevalences of tobacco use, tobacco experimentation, and frequent smoking among Brazilian adolescents. METHODS We evaluated participants of the cross-sectional, nation-wide, school-based Study of Cardiovascular Risks in Adolescents (ERICA), which included 12- to 17-year-old adolescents from municipalities of over 100 thousand inhabitants. The study sample had a clustered, stratified design and was representative of the whole country, its geographical regions, and all 27 state capitals. The information was obtained with self-administered questionnaires. Tobacco experimentation was defined as having tried cigarettes at least once in life. Adolescents who had smoked on at least one day over the previous 30 days were considered current cigarette smokers. Having smoked cigarettes for at least seven consecutive days was an indicator for regular consumption of tobacco. Considering the complex sampling design, prevalences and 95% confidence intervals were estimated according to sociodemographic and socio-environmental characteristics. RESULTS We evaluated 74,589 adolescents. Among these, 18.5% (95%CI 17.7-19.4) had smoked at least once in life, 5.7% (95%CI 5.3-6.2) smoked at the time of the research, and 2.5% (95%CI 2.2-2.8) smoked often. Adolescents aged 15 to 17 years had higher prevalences for all indicators than those aged 12 to 14 years. The prevalences did not differ significantly between sexes. The highest prevalences were found in the South region and the lowest ones, in the Northeast region. Regardless of sex, the prevalences were found to be higher for adolescents who had had paid jobs, who lived with only one parent, and who reported having been in contact with smokers either inside or outside their homes. Female public school adolescents were found to smoke more than the ones from private schools. CONCLUSIONS Tobacco use among adolescents is still a challenge. Intending to reduce the prevalence of tobacco use among young

  13. [Consensus on Perioperative Transesophageal Echocardiography of the Brazilian Society of Anesthesiology and the Department of Cardiovascular Image of the Brazilian Society of Cardiology].

    Science.gov (United States)

    Salgado-Filho, Marcello Fonseca; Morhy, Samira Saady; Vasconcelos, Henrique Doria de; Lineburger, Eric Benedet; Papa, Fabio de Vasconcelos; Botelho, Eduardo Souza Leal; Fernandes, Marcelo Ramalho; Daher, Maurício; Bihan, David Le; Gatto, Chiara Scaglioni Tessmer; Fischer, Cláudio Henrique; Silva, Alexander Alves da; Galhardo Júnior, Carlos; Neves, Carolina Baeta; Fernandes, Alexandre; Vieira, Marcelo Luiz Campos

    Through the Life Cycle of Intraoperative Transesophageal Echocardiography (ETTI/SBA) the Brazilian Society of Anesthesiology, together with the Department of Cardiovascular Image of the Brazilian Society of Cardiology (DIC/SBC), createded a task force to standardize the use of intraoperative transesophageal echocardiography by Brazilian anesthesiologists and echocardiographers based on scientific evidence from the Society of Cardiovascular Anesthesiologists/American Society of Echocardiography (SCA/ASE) and the Brazilian Society of Cardiology. Copyright © 2017 Sociedade Brasileira de Anestesiologia. Publicado por Elsevier Editora Ltda. All rights reserved.

  14. Management report 2004 CNEN - Brazilian Nuclear Energy Commission

    International Nuclear Information System (INIS)

    2005-03-01

    This document reports the results of the activity management of the Comissao Nacional de Energia Nuclear - CNEN - Brazil during the year of 2004, involving the Brazilian program of nuclear activities in the areas of nuclear safety, research and development, radiopharmaceutical production, institutional management, teaching, administration in general and miscellaneous

  15. Management report 2006 CNEN - Brazilian Nuclear Energy Commission

    International Nuclear Information System (INIS)

    2007-03-01

    This document reports the results of the activity management of the Comissao Nacional de Energia Nuclear - CNEN - Brazil during the year of 2005, involving the Brazilian program of nuclear activities in the areas of nuclear safety, research and development, radiopharmaceutical production, institutional management, teaching, administration in general and miscellaneous

  16. STANDARDIZED TERMINOLOGY OF ADULT SPINE DEFORMITY FOR BRAZILIAN PORTUGUESE

    Directory of Open Access Journals (Sweden)

    Raphael de Rezende Pratali

    2015-12-01

    Full Text Available Objective : To develop a consensus for translation of the most relevant terms used in the study of Adult Spinal Deformity, from their original languages into Brazilian Portuguese. Methods : A panel of 12 experts in spine surgery from the five Brazilian regions was constituted. To obtain the standardization of terminology, the Delphi method with an electronic questionnaire was administered to participants about their opinion on the translation of 13 relevant terms chosen by literature review. Each term was considered standard when there was consensus, that is, concordance higher than 80% among participants as to the suggestion to be adopted, and then on the acceptance of the term and its abbreviation in Portuguese. Results : Initially there was consensus (over 80% concordance on the translation of seven terms in the electronic questionnaire. The other six terms that have not reached consensus were discussed at a meeting among the participants, relying on the opinion of a specialized professional in simultaneous translation of orthopedic terms in Portuguese and other professional majored in Portuguese language. It was decided how these terms should be translated and there was a consensus among all participants regarding their acceptance. Finally, there was consensus among the participants, who agreed with the translation and abbreviation of the 13 propose terms, defining its standardization for Brazilian Portuguese. Conclusion : We present a standard terminology used in the study of Adult Spinal Deformity through consensus among experts, seeking uniformity in the use of these terms in Brazilian Portuguese.

  17. Lost in Translation : Interpreting the Brazilian Electric Power Privatisation Failure

    NARCIS (Netherlands)

    S. Tankha (Sunil)

    2008-01-01

    textabstractDid Latin American privatisation polices fail because of flawed implementation of fundamentally sound policies or because privatisation policies were themselves seriously flawed? Using the Brazilian electric power reforms as a narrative tool, this paper examines the causal chain assumed

  18. The Musician in Brazilian Society, Past and Present.

    Science.gov (United States)

    Azevedo, Luiz Heitor Correa de

    1982-01-01

    Throughout the history of Brazil, musicians have always been able to win social recognition and status. The development of musicians' professional organizations; the business, cultural, and educational enterprises of Brazilian musicians; and the roles of women, foreign, and amateur musicians are discussed. (AM)

  19. Diversity in School: A Brazilian Educational Policy against Homophobia

    Science.gov (United States)

    Carrara, Sergio; Nascimento, Marcos; Duque, Aline; Tramontano, Lucas

    2016-01-01

    Diversity in School is a Brazilian initiative that seeks to increase understanding, recognition, respect, and value social and cultural differences through offering an e-learning course on gender, sexuality, and ethnic relations for teachers and school administrators in the public school system. The course and its objectives aim to enable staff…

  20. The brazilian nuclear submarine dossier: Navy's priority and its application

    International Nuclear Information System (INIS)

    Rosa, L.P.

    1990-01-01

    This work discusses the feasibility of the brazilian nuclear submarine. It is related to navy's remodeling and is considered as a priority. It would bring Brazil closer to developed countries. It considers the slip, itself, the weapon's system as well as the nuclear propulsion. (author)

  1. Bone mineral density in Brazilian men 50 years and older

    Directory of Open Access Journals (Sweden)

    C.A.F. Zerbini

    2000-12-01

    Full Text Available Bone mineral density (BMD in the lumbar spine (LSBMD, femoral neck (FNBMD and whole body (WBBMD and whole body tissue composition were evaluated in 288 Brazilian men 50 years and older, 80% white and 20% Mulattoes. Age was inversely correlated with WBBMD (r = -0.20 and FNBMD (r = -0.21 but not with LSBMD (r = 0.03. Body mass index and weight showed a strong positive correlation with WBBMD (r = 0.48 and 0.54, LSBMD (r = 0.37 and 0.45 and FNBMD (r = 0.42 and 0.48. Correlation with height was positive but weaker. No significant bone loss at the lumbar spine level was observed as the population aged. FNBMD and WBBMD decreased significantly only in the last decade (age 70-79 studied. BMD was higher for Brazilian men as compared to Brazilian women at all sites. No significant differences were observed between Brazilian and the US/European male population for BMD in the femoral neck. BMD measured by dual-energy X-ray absorptiometry in South American men is reported here for the first time. A decrease in FNBMD was detected only later in life, with a pattern similar to that described for the US/European male population.

  2. Brazilian Portuguese Requests and the Role of Deixis in Politeness.

    Science.gov (United States)

    Koike, Dale April

    In the context of linguistic theories of politeness, it is possible to consider the concept of a continuum of politeness that includes degrees of speaker egocentricity. It is proposed that directives in Brazilian Portuguese follow a hierarchy of politeness forms based on a theory of pragmatic markedness: that the more marked for politeness a…

  3. Education, Employment and Household Dynamics: Brazilian Migrants in Japan

    Science.gov (United States)

    Green, Paul

    2013-01-01

    By treating the household as a primary unit of analysis and social production, this article considers the mutually influential ways in which migrant families shape the educational pathways and experiences of Brazilian children living in Japan. Through an ethnographic exploration of relations between parents, children and their working siblings I…

  4. Analysis of undergraduate cell biology contents in Brazilian public universities.

    Science.gov (United States)

    Mermelstein, Claudia; Costa, Manoel Luis

    2017-04-01

    The enormous amount of information available in cell biology has created a challenge in selecting the core concepts we should be teaching our undergraduates. One way to define a set of essential core ideas in cell biology is to analyze what a specific cell biology community is teaching their students. Our main objective was to analyze the cell biology content currently being taught in Brazilian universities. We collected the syllabi of cell biology courses from public universities in Brazil and analyzed the frequency of cell biology topics in each course. We also compared the Brazilian data with the contents of a major cell biology textbook. Our analysis showed that while some cell biology topics such as plasma membrane and cytoskeleton was present in ∼100% of the Brazilian curricula analyzed others such as cell signaling and cell differentiation were present in only ∼35%. The average cell biology content taught in the Brazilian universities is quite different from what is presented in the textbook. We discuss several possible explanations for these observations. We also suggest a list with essential cell biology topics for any biological or biomedical undergraduate course. The comparative discussion of cell biology topics presented here could be valuable in other educational contexts. © 2017 The Authors. Cell Biology International Published by John Wiley & Sons Ltd on behalf of International Federation of Cell Biology.

  5. Animal experimentation: a legal fight in Brazilian universities

    Directory of Open Access Journals (Sweden)

    Fernanda Luiza Fontoura de Medeiros

    2015-07-01

    Full Text Available Vivisection, or the use of animals in experiments, testing or education is part of a context in which many people still think represent an emergency conflict that requires the choice of human interests rather than the interests of animals. In Brazil, the 1988 Federal Constitution, in Article 225, paragraph 1, item VII, prohibits the practice of cruelty to animals. To regulate the said device, was passed in 2008 the Law 11.794 / 2008, known as Arouca Law, establishing procedures for the scientific use of animals and the Law 9.605 / 2008, which deals with environmental crimes. However, according to Brazilian Constitution, is it possible to sustain the use of animals in teaching and research, especially in universities? The aim of this paper is to analyze the Brazilian legislation regarding the use of animals in testing, teaching and research, and to discuss the observation of this legislation during the lawsuits filled in recent years by animal advocacy organizations against several Brazilian universities. The results point to a disagreement between the practices prevailing in the universities, the legislation and the Brazilian Constitution.

  6. Brazilian validation of the Alberta Infant Motor Scale.

    Science.gov (United States)

    Valentini, Nadia Cristina; Saccani, Raquel

    2012-03-01

    The Alberta Infant Motor Scale (AIMS) is a well-known motor assessment tool used to identify potential delays in infants' motor development. Although Brazilian researchers and practitioners have used the AIMS in laboratories and clinical settings, its translation to Portuguese and validation for the Brazilian population is yet to be investigated. This study aimed to translate and validate all AIMS items with respect to internal consistency and content, criterion, and construct validity. A cross-sectional and longitudinal design was used. A cross-cultural translation was used to generate a Brazilian-Portuguese version of the AIMS. In addition, a validation process was conducted involving 22 professionals and 766 Brazilian infants (aged 0-18 months). The results demonstrated language clarity and internal consistency for the motor criteria (motor development score, α=.90; prone, α=.85; supine, α=.92; sitting, α=.84; and standing, α=.86). The analysis also revealed high discriminative power to identify typical and atypical development (motor development score, P<.001; percentile, P=.04; classification criterion, χ(2)=6.03; P=.05). Temporal stability (P=.07) (rho=.85, P<.001) was observed, and predictive power (P<.001) was limited to the group of infants aged from 3 months to 9 months. Limited predictive validity was observed, which may have been due to the restricted time that the groups were followed longitudinally. In sum, the translated version of AIMS presented adequate validity and reliability.

  7. Violence against Brazilian Women in Public and Mediatic Spheres

    Science.gov (United States)

    Souza-Leal, Bruno; de-Carvalho, Carlos-Alberto; Antunes, Elton

    2018-01-01

    This paper explores the capacity of the media to incorporate controversies in circulation in the public sphere. For that, it is based on the analysis of a set of 607 news stories about violence against women in context of gender relations and proximity, collected in nine Brazilian media during the years of 2013 and 2014. Recognized as one of the…

  8. Brazilian nuclear legislation. Revision n.1/2002

    International Nuclear Information System (INIS)

    Matos, Gilberto Cardoso de

    2002-01-01

    This work intends to facilitate the access to the Brazilian nuclear legislation and other legal instruments, foreseeing the use of nuclear energy and ionizing radiation in health, work and environment areas up to 2002. Legislation on the civil liability of nuclear damage, the law of licensing taxes, controlling and inspection are also included

  9. The Emergence of Quality Assessment in Brazilian Basic Education

    Science.gov (United States)

    Kauko, Jaakko; Centeno, Vera Gorodski; Candido, Helena; Shiroma, Eneida; Klutas, Anni

    2016-01-01

    The focus in this article is on Brazilian education policy, specifically quality assurance and evaluation. The starting point is that quality, measured by means of large-scale assessments, is one of the key discursive justifications for educational change. The article addresses the questions of how quality evaluation became a significant feature…

  10. New prospects for biological control of Brazilian peppertree, Schinus terebinthifolius

    Science.gov (United States)

    Brazilian peppertree, Schinus terebinthifolius Raddi (Anacardiaceae), is an invasive weed from South America that has been spread to many countries. It was introduced into the USA about 100 years ago as an ornamental. Escaping cultivation, it now occurs in three south-eastern states of the USA, Cali...

  11. Trace elements in brazilian soils; Micronutrientes nos solos do Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Geraldo Cesar [Juiz de Fora Univ., MG (Brazil). Dept. de Geociencias

    1995-03-01

    A literature revision on trace elements (Zn, B, Mn, Mo, Cu, Fe, and Cl) in Brazilian soils was prepared, with special attention to the chemical form and range in the soil, extraction methods and correlation of the amount in soils with soil properties. 76 refs.

  12. Modelling sustainable international tourism demand to the Brazilian Amazon

    NARCIS (Netherlands)

    J.A. Divino (Jose Angelo); M.J. McAleer (Michael)

    2008-01-01

    textabstractThe Amazon rainforest is one of the world’s greatest natural wonders and holds great importance and significance for the world’s environmental balance. Around 60% of the Amazon rainforest is located in the Brazilian territory. The two biggest states of the Amazon region are Amazonas (the

  13. Two new Morganella species from the Brazilian Amazon rainforest

    Directory of Open Access Journals (Sweden)

    Alfredo DS

    2012-02-01

    Full Text Available Two new Morganella species, M. albostipitata and M. rimosa were found during studies of gasteroid fungi in the Brazilian Amazon rainforest, Adolpho Ducke Forest Reserve, Amazonas State, Brazil. The new taxa are described, and illustrated with photographs and line drawings, and taxonomical comments are made.

  14. Mineralogical study of Brazilian fly ashes; origin, characteristics and quality

    International Nuclear Information System (INIS)

    Kihara, Y.

    1984-01-01

    Thirty-one fly ash samples from the five main Brazilian coal-powered thermoelectric plants were subjected to gravimetric chemical analysis, complexometry, flame photometry, X-ray diffractometry, thermodifferential and thermogravimetric analysis, transmitted and reflected light microscopy, electron microprobe analysis and transmited and scanning electron microscopy. (Author) [pt

  15. On the system of mood in European and Brazilian Portuguese

    Directory of Open Access Journals (Sweden)

    Rui Marques

    2004-06-01

    Full Text Available This paper is concerned with mood distribution in European and Brazilian Portuguese. Although, in many cases, these two varieties do not differ as regards the selected mood, there are exceptions in some contexts. The variations involve rather different constructions, at first sight suggesting a chaotic picture. However, if one assumes that mood is associated with the expression of an attitude towards a proposition (in other words, that mood is an expression of modality, it becomes clear that European and Brazilian Portuguese are diverging in respect to the relevant factors for mood selection. In particular, while in European Portuguese the selection of mood is sensitive to both veridicality and epistemic modality, Brazilian Portuguese is becoming a language where the truth-value of the proposition is the main factor responsible for mood selection. Hence, a tendency appears to be developing for Brazilian Portuguese to approach the pattern found in languages like Rumanian, (Modern Greek or Hungarian, while European Portuguese follows the pattern found in most other Romance languages.

  16. Citations of Brazilian physical therapy journals in national publications.

    Science.gov (United States)

    Teixeira, Renan K C; Yamaki, Vitor N; Botelho, Nara M; Teixeira, Renato C

    2014-01-01

    Quotations in Brazilian journals are mainly obtained from national articles (articles from Brazilian journals); thus, it is essential to determine how frequently these articles reference Brazilian journals. This study sought to verify how frequently national papers are cited in the references of three Brazilian physical therapy journals. All references for articles published in Fisioterapia em Movimento, Fisioterapia e Pesquisa and Revista Brasileira de Fisioterapia between 2010 and 2012 were evaluated. In particular, the numbers of national articles and international articles (articles from international journals) cited in these references were determined. A total of 13,009 references cited by 456 articles were analyzed, and 2,924 (22.47%) of the cited works were national articles. There were no significant differences among the three examined years. A total of 36 (7.89%) articles did not cite national articles, whereas 65 (13.25%) articles cited more national articles than international articles. On average, 22.47% of the works cited by the evaluated articles were national articles. No significant differences were detected among the three analyzed years.

  17. The nuclear energy in the context of Brazilian law

    International Nuclear Information System (INIS)

    Faria, N.M. de; Goes Fischer, M.D. de

    1981-01-01

    The present work has as its objective the study of nuclear activity within the context of Brazilian Law. It focuses on the organizational structure in which, as part of the Directives of the National Nuclear Energy Policy, this activity is being developed through specific legal norms. (Author) [pt

  18. Scholastic Journalism Unites Brazilian, U.S. Cultures.

    Science.gov (United States)

    Malcolm, Deb Buttleman

    2000-01-01

    Describes, from the viewpoint of a high school teacher and a student, a scholastic journalism exchange program and a three-week visit of 12 Brazilian students to the journalism department at Davenport High School. Intends to establish connections and break down stereotypes of each other. Describes how the program came about and the journalism…

  19. Tense Usage Analysis in Verb Distribution in Brazilian Portuguese.

    Science.gov (United States)

    Hoge, Henry W., Comp.

    This section of a four-part research project investigating the syntax of Brazilian Portuguese presents data concerning tense usage in verb distribution. The data are derived from the analysis of selected literary samples from representative and contemporary writers. The selection of authors and tabulation of data are also described. Materials…

  20. Challenges facing Brazilian economy in the emerging market ...

    African Journals Online (AJOL)

    The literature relates to the discussions on the trade relationship and patterns between Brazil as one of the BRICs countries, and Malaysia as one of the developing countries. This paper also reviews expectations for the Brazilian economy in the next few years and what challenges awaits Brazil ahead. The aim of this paper ...

  1. Stakeholder Theory and Value Creation Models in Brazilian Firms

    Directory of Open Access Journals (Sweden)

    Natalia Giugni Vidal

    2015-09-01

    Full Text Available Objective – The purpose of this study is to understand how top Brazilian firms think about and communicate value creation to their stakeholders. Design/methodology/approach – We use qualitative content analysis methodology to analyze the sustainability or annual integrated reports of the top 25 Brazilian firms by sales revenue. Findings – Based on our analysis, these firms were classified into three main types of stakeholder value creation models: narrow, broad, or transitioning from narrow to broad. We find that many of the firms in our sample are in a transition state between narrow and broad stakeholder value creation models. We also identify seven areas of concentration discussed by firms in creating value for stakeholders: better stakeholder relationships, better work environment, environmental preservation, increased customer base, local development, reputation, and stakeholder dialogue. Practical implications – This study shows a trend towards broader stakeholder value creation models in Brazilian firms. The findings of this study may inform practitioners interested in broadening their value creation models. Originality/value – This study adds to the discussion of stakeholder theory in the Brazilian context by understanding variations in value creation orientation in Brazil.

  2. Brazilian Institute for Ecological Research: Teaching and applying ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-05-10

    May 10, 2011 ... In reflecting on her experience at IEF 2008, Dr Suzana Padua, president of the Brazilian Institute for Ecological Research (IPE) said: “The more you understand the interconnection of everything that is alive in the planet, then it has to touch you somehow.”As an environmental educator, “[health] is not my ...

  3. Metabolic and infectious pathologies in Brazilian medical literature: a review.

    Science.gov (United States)

    Rocha-e-Silva, Mauricio

    2010-06-01

    This review of original reports on metabolic and infectious diseases that were recently published in Brazilian journals is designed to inform the readership of CLINICS about their content. I conducted a search in PubMed for original research articles (clinical or basic research) recently published (2008-2009) by Brazilian medical and biological periodicals. Papers on metabolic pathologies were retrieved by searching for appropriate keywords such as metabolic syndrome and obesity. Papers on infectious disease were obtained by entering 15 different keywords for the most commonly occurring pathologies. Review articles, editorials, letters to the editor, and case reports were manually excluded. Selected titles were then categorized into appropriate sub-categories. This search produced a total of 123 articles, which filtered down to 72 articles after eliminating editorials, review articles, letters to the Editor and case reports. Reviewed periodicals were Arquivos Brasileiros de Cardiologia, Arquivos Brasileiros de Endocrinologia e Metabologia, Brazilian Journal of Biological and Medical Research, Brazilian Journal of Infectious Diseases, Jornal de Pediatria, Jornal de Pneumologia, Revista da Associação Médica Brasileira, Revista da Escola de Enfermagem da Universidade de São Paulo, and São Paulo Medical Journal. The articles were then briefly summarized.

  4. Reconceptualizing Educational Transfer: Brazilian Curriculum Field in the Nineties.

    Science.gov (United States)

    Moreira, Antonio Flavio Barbosa; Macedo, Elizabeth

    A study examined the conception of educational transfer, considering the foreign influence in Brazilian curriculum throughout the 1990s. The study criticizes the literature on educational transfer produced in the 1970s, mainly the works of Martin Carnoy (1974) and Philip Altbach and Gail Kelly (1984), arguing that their two theories understress…

  5. New products made with lignocellulosic nanofibers from Brazilian amazon forest

    International Nuclear Information System (INIS)

    Bufalino, L; Mendes, L M; Tonoli, G H D; Fonseca, A; Rodrigues, A; Cunha, P I; Marconcini, J M

    2014-01-01

    The biodiversity of the Amazon forest is undoubtedly rich; hence there is considerable variety of plant fibers regarding their morphological, chemical and structural properties. The legal exploration of the Brazilian Amazon is based on sustainable management techniques, but the generation of a relevant amount of plant wastes still cant be avoided. The correct destination of such materials is a challenge that Brazilian companies have to face. In this context, the National Council of Science and Technology (CNPq) promoted the creation of investigation nets on sustainability of Brazilian agribusiness. The Brazilian Net on Lignocellulosic Composites and Nanocomposites was then created, with partnership between several national and international research institutions. Until the moment, the results showed that Amazon plant fibers that are discarded as residues have great potential to nanofiber production. Nanopapers with considerable high mechanical and physical strength, proper opacity and great crystalline index were produced by using a clean and simple mechanical method. Those materials are candidates to several uses such as packaging, substrates transparent conductive films, gas barrier films, solar cells and e-papers

  6. Curve number estimation from Brazilian Cerrado rainfall and runoff data

    Science.gov (United States)

    The Curve Number (CN) method has been widely used to estimate runoff from rainfall events in Brazil, however, CN values for use in the Brazilian savanna (Cerrado) are poorly documented. In this study we used experimental plots to measure natural rainfall-driven rates of runoff under undisturbed Cerr...

  7. Children's Perceptions of Brazilian Cerrado Landscapes and Biodiversity

    Science.gov (United States)

    Bizerril, Marcelo X. A.

    2004-01-01

    In this study, the author evaluated Brazilian students' environmental perceptions of Cerrado (savanna-like vegetation). The author administered tests of knowledge and perception of the Cerrado biome's wildlife to students of different social classes. The students (age range: 11-17 years) generally exhibited low identification with the region, and…

  8. Management report 2007 CNEN - Brazilian Nuclear Energy Commission

    International Nuclear Information System (INIS)

    2007-01-01

    This document reports the general activity management of the Comissao Nacional de Energia Nuclear - CNEN - Brazil during the year of 2007, involving the CNEN role in the public policy execution, the Brazilian program of nuclear activities in the areas of nuclear safety, research and development, radiopharmaceutical production, teaching, administration in general and miscellaneous

  9. Metabolic and infectious pathologies in Brazilian medical literature: a review

    Directory of Open Access Journals (Sweden)

    Mauricio Rocha-e-Silva

    2010-06-01

    Full Text Available OBJECTIVE: This review of original reports on metabolic and infectious diseases that were recently published in Brazilian journals is designed to inform the readership of CLINICS about their content. METHODS: I conducted a search in PubMed for original research articles (clinical or basic research recently published (2008-2009 by Brazilian medical and biological periodicals. Papers on metabolic pathologies were retrieved by searching for appropriate keywords such as metabolic syndrome and obesity. Papers on infectious disease were obtained by entering 15 different keywords for the most commonly occurring pathologies. Review articles, editorials, letters to the editor, and case reports were manually excluded. Selected titles were then categorized into appropriate sub-categories. RESULTS: This search produced a total of 123 articles, which filtered down to 72 articles after eliminating editorials, review articles, letters to the Editor and case reports. Reviewed periodicals were Arquivos Brasileiros de Cardiologia, Arquivos Brasileiros de Endocrinologia e Metabologia, Brazilian Journal of Biological and Medical Research, Brazilian Journal of Infectious Diseases, Jornal de Pediatria, Jornal de Pneumologia, Revista da Associação Médica Brasileira, Revista da Escola de Enfermagem da Universidade de São Paulo, and São Paulo Medical Journal. The articles were then briefly summarized.

  10. National Laboratory of Ionizing Radiation Metrology - Brazilian CNEN

    International Nuclear Information System (INIS)

    1992-01-01

    The activities of the Brazilian National Laboratory of Ionizing Radiations Metrology are described. They include research and development of metrological techniques and procedures, the calibration of area radiation monitors, clinical dosemeters and other instruments and the preparation and standardization of reference radioactive sources. 4 figs., 13 tabs

  11. Proceedings of the 6. Brazilian congress on medical physics

    International Nuclear Information System (INIS)

    2001-01-01

    The 6. Brazilian congress on medical physics has presented and discussed recent research results and themes about state-of-the-art of the applications of Physics methods in prevention, diagnosis and pathology treatments. Also has included questions of Safety and Protection in the medical practices and some aspects of Formation/Education emphasizing the situation of medical physics in Brazil - present and future

  12. Patenting bioactive molecules from biodiversity: the Brazilian experience.

    Science.gov (United States)

    Nogueira, Renata Campos; de Cerqueira, Harley Ferreira; Soares, Milena Botelho Pereira

    2010-02-01

    The use of natural compounds from biodiversity, as well as ethnobotanical knowledge, for the development of new drugs is the gate leading to support the conservation of natural resources in developing countries. Recent technological advances and the development of new methods are revolutionizing the screening of natural products and offer a unique opportunity to replace natural products as major source of drug leads. Over the past decades, the Brazilian government established a legislation aiming to grant patent protection in all technological fields. The Convention on Biological Diversity, an international agreement that recognizes the sovereign rights of States over their natural resources, and the Brazilian legislation (Decreto n degree 2186-12/01) set for legislative, administrative or policy measures regarding the share of research and product development benefits could be the key for progress in issues related to rational employment of the Brazilian biodiversity and economy, but are far from being effective. Based on literature review, this article provides a brief description of the Brazilian legislation policy regarding intellectual property and biodiversity access, places natural drug discovery in context, analyzes patent cases and highlights critical key issues responsible for the drawback of the whole process that has a direct impact on industrial and research development, nature protection and benefit share with our society.

  13. Proceedings of the 2. Brazilian Congress of Physicists on Medicine

    International Nuclear Information System (INIS)

    1987-01-01

    The works of the 2. Brazilian Congress of Physicists on Medicine are presented, including course of 'Tomography by Nuclear Magnetic Resonance' and 'New Techniques in the Physics of X Ray Diagnostic' and topics about radiotherapy, radiodiagnostic and dosimetry. (C.G.C.) [pt

  14. Management report 2005 CNEN - Brazilian Nuclear Energy Commission

    International Nuclear Information System (INIS)

    2006-03-01

    This document reports the results of the activity management of the Comissao Nacional de Energia Nuclear - CNEN - Brazil during the year of 2005, involving the Brazilian program of nuclear activities in the areas of nuclear safety, research and development, radiopharmaceutical production, institutional management, teaching, administration in general and miscellaneous

  15. Semiotic Analysis of Brazilian E-Commerce Signs

    Science.gov (United States)

    Guimaraes, Cayley; de Paula, Alice G.; Antunes, Diego R.

    A Semiotic analysis of pictographic signs used in Brazilian e-commerce sites is presented. This study shows a low mapping between the intended function in the system and the desired goal from the user. A better understanding of the Theory of Sign Production and Semiotic Engineering Methods for sign re-design is recommended.

  16. Brazilian Portuguese and German in contact in two virtual communities

    Directory of Open Access Journals (Sweden)

    Layla Cristina Iapechino Souto

    2017-01-01

    Full Text Available This paper presents an analysis of code-switching between Brazilian Portuguese and German language in two virtual communities on Facebook: Brasileiros em Berlim and Brasileiros e Brasileiras em Berlim. We have adopted the concepts of durability, permeability and liminality traced by Zinkhahn-Rhobodes (2015 to observe the permeability of the linguistic border between these two languages. 

  17. Use of statistical procedures in Brazilian and international dental journals.

    Science.gov (United States)

    Ambrosano, Gláucia Maria Bovi; Reis, André Figueiredo; Giannini, Marcelo; Pereira, Antônio Carlos

    2004-01-01

    A descriptive survey was performed in order to assess the statistical content and quality of Brazilian and international dental journals, and compare their evolution throughout the last decades. The authors identified the reporting and accuracy of statistical techniques in 1000 papers published from 1970 to 2000 in seven dental journals: three Brazilian (Brazilian Dental Journal, Revista de Odontologia da Universidade de Sao Paulo and Revista de Odontologia da UNESP) and four international journals (Journal of the American Dental Association, Journal of Dental Research, Caries Research and Journal of Periodontology). Papers were divided into two time periods: from 1970 to 1989, and from 1990 to 2000. A slight increase in the number of articles that presented some form of statistical technique was noticed for Brazilian journals (from 61.0 to 66.7%), whereas for international journals, a significant increase was observed (65.8 to 92.6%). In addition, a decrease in the number of statistical errors was verified. The most commonly used statistical tests as well as the most frequent errors found in dental journals were assessed. Hopefully, this investigation will encourage dental educators to better plan the teaching of biostatistics, and to improve the statistical quality of submitted manuscripts.

  18. Metabolite profiling, antioxidant and antibacterial activities of Brazilian propolis

    NARCIS (Netherlands)

    Bittencourt, M.L.F.; Ribeiro, Paulo R.; Franco, R.L.P.; Hilhorst, H.W.M.; Castro, de R.D.; Fernandez, L.G.

    2015-01-01

    The production of propolis by honeybees results from a selective collection of exudates from various plant species and present many potentialities in the pharmaceutical industry. The objective of this study was to investigate the chemical profile of Brazilian propolis, as well as their in vitro

  19. Occurrence of Metarhizium spp in central Brazilian soils

    Science.gov (United States)

    The biodiversity of entomopathogenic fungi in tropical ecosystems is still little investigated, and the objective of this study was to isolate and identify fungi of the entomopathogenic genus Metarhizium (Hypocreales: Clavicipitaceae) present in undisturbed soils of Central Brazilian Cerrado. A tota...

  20. Deforestation in the Brazilian Amazon: A Classroom Project.

    Science.gov (United States)

    Nijman, Jan; Hill, A. David

    1991-01-01

    Presents a classroom project dealing with tropical deforestation in the Brazilian Amazon. Addresses environmental consequences and economic, social, and political causes. Involves both lectures and individual research and reports by student groups on deforestation causes. Includes a note-playing activity in which students make recommendations for…