WorldWideScience

Sample records for dubnium 269

  1. Chemical isolation of dubnium (element 105) in fluoride media

    Energy Technology Data Exchange (ETDEWEB)

    Trubert, D.; Naour, C. le; Hussonnois, M.; Brillard, L.; Du, J.F. le [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire Radiochimie; Guzman, F.M. [ININ, Carretera Mexico-Toluca, Ocoyoacac, Estado de Mexico (Mexico); Constantinescu, O. [JINR, Dubna (Russian Federation). Flerov Lab. of Nuclear Reactions; Gasparro, J.; Barci, V.; Weiss, B.; Ardisson, G. [Nice Univ. (France). Lab. de Radiochimie

    2002-07-01

    The isotope {sup 262}Db was produced by irradiation of a {sup 248}Cm target with 106-MeV {sup 19}F ions at the 15 MV MP Tandem accelerator of Orsay (France). The reaction products were continuously and rapidly transported with a KCl aerosol helium jet system to the chemistry setup. They were dissolved in HF medium and the solution was passed through three successive ion exchange columns, allowing a continuous high level purification of Db from actinides on a first cation exchange column, the isolation of Db on an anion exchange one, and the retention of the long-lived decay products of {sup 262}Db (3.24 h-{sup 254}Fm) on a second cation exchange column. Just after the end of irradiation, the decay products were desorbed from this column, purified and {alpha}-sources were prepared on carbon foil by electrospray. In 13 effective irradiation hours, 22 events corresponding to the {alpha}-decay of {sup 254}Fm were recorded. Almost 70 atoms of {sup 262}Db, produced in the reaction {sup 248}Cm + {sup 19}F were isolated in dilute HF medium. Like its homologues/analogues Nb, Ta and Pa, dubnium forms, with fluoride ions, negatively charged complexes which are strongly retained on anion exchanger. (orig.)

  2. 21 CFR 26.9 - Equivalence determination.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Equivalence determination. 26.9 Section 26.9 Food... Specific Sector Provisions for Pharmaceutical Good Manufacturing Practices § 26.9 Equivalence determination... document insufficient evidence of equivalence, lack of opportunity to assess equivalence or a determination...

  3. 12 CFR 269.5 - Elections.

    Science.gov (United States)

    2010-01-01

    ... Bank to recognize a labor organization as the exclusive collective bargaining representative without a... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Elections. 269.5 Section 269.5 Banks and... LABOR RELATIONS FOR THE FEDERAL RESERVE BANKS § 269.5 Elections. (a) Once there has been a final...

  4. 7 CFR 1822.269 - Security.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Security. 1822.269 Section 1822.269 Agriculture..., Procedures, and Authorizations § 1822.269 Security. Each loan will be secured by a mortgage on the property purchased or improved with the loan, and a security interest in the funds held by the corporation in...

  5. 12 CFR 269b.731 - Signature.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Signature. 269b.731 Section 269b.731 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM CHARGES OF UNFAIR LABOR PRACTICES General Rules § 269b.731 Signature. The original of each document filed shall...

  6. 12 CFR 269b.310 - Appeal rights.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Appeal rights. 269b.310 Section 269b.310 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM CHARGES OF UNFAIR LABOR PRACTICES Appeal from the Center's Determination § 269b.310 Appeal rights....

  7. 18 CFR 2.69 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false 2.69 Section 2.69 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES GENERAL POLICY AND INTERPRETATIONS Statements of General Policy and Interpretations Under...

  8. Dicty_cDB: SSH269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH269 (Link to dictyBase) - - - Contig-U01518-1 SSH269P (Link to Original site) SSH...269F 381 SSH269Z 406 SSH269P 787 - - Show SSH269 Library SS (Link to library) Clone ID SSH... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-C/SSH269Q.Seq.d/ Representative seq. ID SSH...269P (Link to Original site) Representative DNA sequence >SSH269 (SSH269Q) /CSM/SS/SSH2-C/SSH2...lignments: (bits) Value SSH269 (SSH269Q) /CSM/SS/SSH2-C/SSH269Q.Seq.d/ 1078 0.0 S

  9. Dicty_cDB: VHI269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI269 (Link to dictyBase) - - - Contig-U16260-1 VHI269P (Link to Original site) VHI2...69F 606 VHI269Z 651 VHI269P 1237 - - Show VHI269 Library VH (Link to library) Clone ID VHI2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHI2-C/VHI269Q.Seq.d/ Representative seq. ID VHI2...69P (Link to Original site) Representative DNA sequence >VHI269 (VHI269Q) /CSM/VH/VHI2-C/VHI2...vfk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHI269 (VHI2

  10. 32 CFR 269.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... an administrative proceeding or a civil action in the Federal Courts. (c) Consumer Price Index. The index for all urban consumers published by the Department of Labor. ... CIVIL MONETARY PENALTY INFLATION ADJUSTMENT § 269.2 Definitions. (a) Department. The Department of...

  11. Mars at Ls 269o: Tharsis

    Science.gov (United States)

    2005-01-01

    2 August 2005 This picture is a composite of Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global images acquired at Ls 269o during a previous Mars year. This month, Mars looks similar, as Ls 269o occurs in mid-August 2005. The picture shows the Tharsis face of Mars. Over the course of the month, additional faces of Mars as it appears at this time of year are being posted for MOC Picture of the Day. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Season: last days of Northern Autumn/Southern Spring

  12. 25 CFR 700.269 - Accounting for disclosures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Accounting for disclosures. 700.269 Section 700.269... Privacy Act § 700.269 Accounting for disclosures. (a) Maintenance of an accounting. (1) Where a record is...), an accounting shall be made. (2) The accounting shall record (i) the date, nature, and purpose...

  13. 14 CFR 171.269 - Marker beacon performance requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Marker beacon performance requirements. 171.269 Section 171.269 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Landing System (ISMLS) § 171.269 Marker beacon performance requirements. ISMLS marker beacon equipment...

  14. 14 CFR 21.269 - Export airworthiness approvals.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Export airworthiness approvals. 21.269 Section 21.269 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION....269 Export airworthiness approvals. The manufacturer may issue export airworthiness approvals....

  15. 49 CFR 234.269 - Cut-out circuits.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Cut-out circuits. 234.269 Section 234.269..., Inspection, and Testing Inspections and Tests § 234.269 Cut-out circuits. Each cut-out circuit shall be tested at least once every three months to determine that the circuit functions as intended. For...

  16. 26 CFR 301.269B-1 - Stapled foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Stapled foreign corporations. 301.269B-1....269B-1 Stapled foreign corporations. In accordance with section 269B(a)(1), a stapled foreign corporation is subject to the same taxes that apply to a domestic corporation under Title 26 of the...

  17. Development of an extraction system for the separation of dubnium from rutherfordium using MIBK and HCl/HF solutions

    Energy Technology Data Exchange (ETDEWEB)

    Schumann, Dorothea; Dressler, Rugard [Paul Scherrer Institut (PSI), Villigen (Switzerland)

    2016-04-01

    A chemical separation system was developed to separate group 4 and 5 elements using extraction from HCl/HF solution into methyl-isobutyl-ketone (MIBK). The system is proposed to be applied for a confident assignment of the spontaneous fissioning radionuclide produced as decay product of element 115 either as dubnium (Db, Z = 105) or rutherfordium (Rf, Z = 104). Moreover, extraction systems are proposed allowing the investigation of chemical properties of Db in comparison to the properties of its lighter homologs Nb and Ta.

  18. 12 CFR 269a.2 - Party in interest.

    Science.gov (United States)

    2010-01-01

    ... employees of a bank or that is or was recently a party to a collective bargaining agreement with a bank... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Party in interest. 269a.2 Section 269a.2 Banks... employees, labor organization, or bank that will be or is directly affected by the resolution of any charge...

  19. 12 CFR 269.9 - Mediation of negotiation impasses.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Mediation of negotiation impasses. 269.9... RESERVE SYSTEM POLICY ON LABOR RELATIONS FOR THE FEDERAL RESERVE BANKS § 269.9 Mediation of negotiation impasses. In the event of an impasse in negotiations between the parties for a collective...

  20. Dicty_cDB: VSG269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available S/VSG2-C/VSG269Q.Seq.d/ Representative seq. ID VSG269F (Link to Original site) Representative...as ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/V

  1. 26 CFR 1.269B-1 - Stapled foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Stapled foreign corporations. 1.269B-1 Section 1... (CONTINUED) INCOME TAXES Items Not Deductible § 1.269B-1 Stapled foreign corporations. (a) Treatment as a domestic corporation—(1) General rule. Except as otherwise provided, if a foreign corporation is a...

  2. 7 CFR 205.240-205.269 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling Requirements §§ 205.240-205.269...

  3. Phenotype abnormality: 269 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 269 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u774i ectopic in organ named peduncle... during process named trichome morphogenesis ... peduncle ... mislocalised ... trichome morphogenesis ...

  4. Atomic Mass and Nuclear Binding Energy for Po-269 (Polonium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Po-269 (Polonium, atomic number Z = 84, mass number A = 269).

  5. 40 CFR 761.269 - Sampling liquid PCB remediation waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Sampling liquid PCB remediation waste..., AND USE PROHIBITIONS Cleanup Site Characterization Sampling for PCB Remediation Waste in Accordance with § 761.61(a)(2) § 761.269 Sampling liquid PCB remediation waste. (a) If the liquid is single phase...

  6. Mars at Ls 269o: South Polar Region

    Science.gov (United States)

    2005-01-01

    30 August 2005 This picture is a composite of Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global images acquired at Ls 269o during a previous Mars year. This month, Mars looks similar, as Ls 269o occurred in mid-August 2005. The picture shows the south polar region of Mars. Over the course of the month, additional faces of Mars as it appears at this time of year are being posted for MOC Picture of the Day. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Season: last days of Northern Autumn/Southern Spring

  7. Mars at Ls 269o: Acidalia/Mare Erythraeum

    Science.gov (United States)

    2005-01-01

    9 August 2005 This picture is a composite of Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global images acquired at Ls 269o during a previous Mars year. This month, Mars looks similar, as Ls 269o occurs in mid-August 2005. The picture shows the Acidalia/Mare Erythraeum face of Mars. Over the course of the month, additional faces of Mars as it appears at this time of year are being posted for MOC Picture of the Day. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Season: last days of Northern Autumn/Southern Spring

  8. Mars at Ls 269o: Elysium/Mare Cimmerium

    Science.gov (United States)

    2005-01-01

    23 August 2005 This picture is a composite of Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global images acquired at Ls 269o during a previous Mars year. This month, Mars looks similar, as Ls 269o occurred in mid-August 2005. The picture shows the Elysium/Mare Cimmerium face of Mars. Over the course of the month, additional faces of Mars as it appears at this time of year are being posted for MOC Picture of the Day. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Season: last days of Northern Autumn/Southern Spring

  9. 38 CFR 26.9 - Information on and public participation in VA environmental process.

    Science.gov (United States)

    2010-07-01

    ... participation in VA environmental process. 26.9 Section 26.9 Pensions, Bonuses, and Veterans' Relief DEPARTMENT...) ACTIONS § 26.9 Information on and public participation in VA environmental process. (a) During the..., the Office of Environmental Affairs, or a VA element, information is available by writing to...

  10. 27 CFR 28.269 - Certification by district director of customs.

    Science.gov (United States)

    2010-04-01

    ... director of customs. 28.269 Section 28.269 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Export § 28.269 Certification by district director of customs. (a) Exportation. When the district director of customs is satisfied that merchandise described on the application, notice, or claim, TTB...

  11. 40 CFR 52.269 - Control strategy and regulations: Photochemical oxidants (hydrocarbons) and carbon monoxide.

    Science.gov (United States)

    2010-07-01

    ...: Photochemical oxidants (hydrocarbons) and carbon monoxide. 52.269 Section 52.269 Protection of Environment... PLANS California § 52.269 Control strategy and regulations: Photochemical oxidants (hydrocarbons) and... provide for attainment and maintenance of the national standards for photochemical oxidants...

  12. 26 CFR 1.269-7 - Relationship of section 269 to sections 382 and 383 after the Tax Reform Act of 1986.

    Science.gov (United States)

    2010-04-01

    ... the principal purpose of an acquisition is the evasion or avoidance of Federal income tax. ... 383 after the Tax Reform Act of 1986. 1.269-7 Section 1.269-7 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible...

  13. 26 CFR 1.269-5 - Time of acquisition of control.

    Science.gov (United States)

    2010-04-01

    ...) acquire control of the corporation when they acquire beneficial ownership of the requisite amount of stock... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Time of acquisition of control. 1.269-5 Section... (CONTINUED) INCOME TAXES Items Not Deductible § 1.269-5 Time of acquisition of control. (a) In general. For...

  14. 12 CFR 269b.444 - Objection to conduct of hearing; other motions during hearing.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Objection to conduct of hearing; other motions during hearing. 269b.444 Section 269b.444 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM CHARGES OF UNFAIR LABOR PRACTICES Formal Proceedings §...

  15. New clues to the evolutionary history of the main European paternal lineage M269

    DEFF Research Database (Denmark)

    Valverde, Laura; Illescas, Maria José; Villaescusa, Patricia

    2016-01-01

    The dissection of S116 in more than 1500 individuals from Atlantic Europe and the Iberian Peninsula has provided important clues about the controversial evolutionary history of M269. First, the results do not point to an origin of M269 in the Franco-Cantabrian refuge, owing to the lack of subline...... European peopling, as has been the case for the place of origin of M269.European Journal of Human Genetics advance online publication, 17 June 2015; doi:10.1038/ejhg.2015.114....

  16. Characterization of Group V Dubnium Homologs on DGA Extraction Chromatography Resin from Nitric and Hydrofluoric Acid Matrices

    Energy Technology Data Exchange (ETDEWEB)

    Despotopulos, J D; Sudowe, R

    2012-02-21

    Studies of the chemical properties of superheavy elements (SHE) pose interesting challenges due to their short half-lives and low production rates. Chemical systems must have extremely fast kinetics, fast enough kinetics to be able to examine the chemical properties of interest before the SHE decays to another nuclide. To achieve chemistry on such time scales, the chemical system must also be easily automated. Most importantly however, a chemical system must be developed which provides suitable separation and kinetics before an on-line study of a SHE can be performed. Relativistic effects make studying the chemical properties of SHEs interesting due to the impact these effects could have on the SHEs chemical properties. Relativistic effects arise when the velocity of the s orbital electrons approach the speed of light. As this velocity increases, the Bohr radius of the inner electron orbitals decreases and there is an increase in the particles mass. This contraction results in a destabilization of the energy of the outer d and f electron orbitals (5f and 6d in the case of SHE), which can cause these to expand due to their increased shielding from the nuclear charge. Another relativistic effect is the spin-orbit splitting for p, d, and f orbitals into j = 1 {+-} 1/2 states. This can lead most interestingly to a possible increased stability of element 114, which due to large spin-orbit splitting of the 7p orbital and the relativistically stabilized 7p{sub 1/2} and 7s orbital gives rise to a closed shell ground state of 7s{sup 2}7p{sub 1/2}{sup 2}. The homologs of element 105, dubnium (Db), Ta and Nb and the pseudo-homolog Pa, are well known to hydrolyze and form both neutral and non-neutral monoatomic and polyatomic species that may cause issues with extraction from a given chemical system. Early ion-exchange and solvent-extraction studies show mixed results for the behavior of Db. Some studies show Db behaving most similar to Ta, while others show it behaving

  17. 29 CFR 500.269 - Stay pending decision of the Secretary.

    Science.gov (United States)

    2010-07-01

    ... REGULATIONS MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Administrative Proceedings Modification Or Vacation of Order of Administrative Law Judge § 500.269 Stay pending decision of the Secretary. (a) The... Administrative Law Judge's Decision and Order in a United States District Court and the Secretary issues a...

  18. 12 CFR 269b.720 - Computation of time for filing papers.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Computation of time for filing papers. 269b.720... papers. In computing any period of time prescribed by or allowed by the panel, the day of the act, event... regulations in this subchapter require the filing of any paper, such document must be received by the panel...

  19. 12 CFR 269.10 - Time for internal labor organization business, consultations and negotiations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Time for internal labor organization business... § 269.10 Time for internal labor organization business, consultations and negotiations. Solicitation of... and representatives of a labor organization shall, whenever practicable, be conducted on official time...

  20. 12 CFR 269.3 - Recognition of a labor organization and its relationship to a Federal Reserve Bank.

    Science.gov (United States)

    2010-01-01

    ... conflict with the terms of the collective bargaining agreement. (c) A Bank, through appropriate officials... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Recognition of a labor organization and its relationship to a Federal Reserve Bank. 269.3 Section 269.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED...

  1. Cold Fusion Production and Decay of Neutron-Deficient Isotopes of Dubnium and Development of Extraction Systems for Group V Elements

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M. [Univ. of California, Berkeley, CA (United States)

    2008-07-31

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070$+1100\\atop{-760}$ pb was measured at an excitation energy of 16.0 ± 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660$+450\\atop{-370}$ pb was measured at 22.0 ± 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480$+1730\\atop{-1370}$ pb at an excitation energy of 16.0 ± 1.6 MeV. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier. The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid and mixed hydrochloric acid/lithium chloride media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments was to find a system that demonstrates selectivity among the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z = 105). Experiments with niobium and tantalum were performed with carrier (10-6 M), carrier free (10-10 M) and trace (10-16 M) concentrations of metal using hydrochloric acid solution with concentrations ranging from 1 - 11 M. The extraction of niobium and tantalum from mixed hydrochloric acid/lithium chloride media by HDEHP and BEHP as a function of hydrogen ion (H+) concentration was also investigated. The data obtained are used as the basis to discuss the speciation of niobium and tantalum under the conditions studied and to evaluate possible extraction mechanisms. The 74Se(18O,p3n)88gNb excitation function was measured to determine the best energy for producing the 88Nb used in chemistry experiments. A maximum cross section of 495 +- 5 mb was observed at an 18O energy of 74.0 Me

  2. Distance and proper motion measurement of water masers in Shapless 269 IRS 2w

    CERN Document Server

    Asaki, Yoshiharu; Sobolev, Andrej Mikhailovich; Parfenov, Sergey Yurievich

    2014-01-01

    We present astrometric analysis of archival data of water masers in the star-forming region Sharpless 269 (S269) IRS 2w, observed with the VLBI Exploration of Radio Astrometry. An annual parallax of one of the bright maser features in this region was previously reported to be 0.189+/-0.008 milliarcsecond (mas) using part of the same archival data as we used. However, we found that this maser feature is not the best to represent the annual parallax to S269 IRS 2w because the morphology is remarkably elongated in the east-west direction. For this study we have selected another maser feature showing simpler morphology. This makes the new annual parallax estimate more credible. Our newly obtained annual parallax is 0.247+/-0.034 mas, corresponding to 4.05+0.65-0.49 kpc. This value is well consistent with the 3.7-3.8 kpc obtained using the kinematic distance estimates and photometric distance modulus. We considered two hypotheses for the water maser spatial distribution, a bipolar outflow and an expanding ring, in...

  3. 5 CFR 532.269 - Special wage schedules for Corps of Engineers, U.S. Army navigation lock and dam employees.

    Science.gov (United States)

    2010-01-01

    ... Engineers, U.S. Army navigation lock and dam employees. 532.269 Section 532.269 Administrative Personnel... Determinations § 532.269 Special wage schedules for Corps of Engineers, U.S. Army navigation lock and dam... and dam equipment or who repair and maintain navigation lock and dam operating machinery and...

  4. 76 FR 39254 - Airworthiness Directives; Schweizer Aircraft Corporation (Schweizer) Model 269A, A-1, B, C, C-1...

    Science.gov (United States)

    2011-07-06

    ... Corporation (Schweizer) Model 269A, A-1, B, C, C-1, and TH-55 Series Helicopters AGENCY: Federal Aviation... reviewed Schweizer Service Bulletins No. B-295 for Model 269A, A-1, B, and C helicopters, and No. C1B-032... continues to read as follows: Authority: 49 U.S.C. 106(g), 40113, 44701. Sec. 39.13 0 2. The FAA amends...

  5. Cytogenetics of Premature Ovarian Failure: An Investigation on 269 Affected Women

    Directory of Open Access Journals (Sweden)

    Simona Baronchelli

    2011-01-01

    Full Text Available The importance of X chromosome in the aetiology of premature ovarian failure (POF is well-known but in many cases POF still remains idiopathic. Chromosome aneuploidy increase is a physiological phenomenon related to aging, but the role of low-level sex chromosome mosaicism in ovarian function is still undiscovered. Standard cytogenetic analysis was carried out in a total of 269 patients affected by POF: 27 chromosomal abnormalities were identified, including X chromosome and autosomal structural and numerical abnormalities. In 47 patients with 46,XX karyotype we performed interphase FISH using X alpha-satellite probe in order to identify X chromosome mosaicism rate. Aneuploidy rate in the patient group was significantly higher than the general population group. These findings underline the importance of X chromosome in the aetiology of POF and highlight the potential role of low-level sex chromosome mosaicism in ovarian aging that may lead to a premature onset of menopause.

  6. 26 CFR 1.269-4 - Power of district director to allocate deduction, credit, or allowance in part.

    Science.gov (United States)

    2010-04-01

    ... evasion or avoidance of Federal income tax for which the acquisition was made. The district director is..., DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.269-4...(a), but only to such extent as he determines will not result in the evasion or avoidance of Federal...

  7. Association of the Genetic Polymorphisms RRM1 -756T>C and -269C>A With Cervical Neoplasia.

    Science.gov (United States)

    Chang, Ching-Wen; Yang, Shun-Fa; Wang, Po-Hui; Chang, Hsiu-Ju; Liu, Wen-Chi; Tsai, Hsiu-Ting

    2016-10-01

    Cervical neoplasia is one of the most prevalent malignant neoplasms worldwide. Ribonucleotide reductase 1 (RRM1) is thought to play an essential role in modulating the development and progression of cervical neoplasia. Two novel genetic polymorphisms, RRM1 -756T>C and -269 C>A, are significantly correlated with RRM1 expression. Some epidemiological studies have demonstrated that genetic variants play a crucial role in susceptibility to cervical cancer. The present study aimed to identify the genetic polymorphisms RRM1 -756T>C and -269 C>A in patients with cervical neoplasia and healthy controls. In total, 493 subjects, comprising 324 healthy controls and 169 patients with cervical neoplasia, were enrolled for this study. The allelic discrimination of the RRM1 -756T>C (rs11030918) and -269C>A (rs12806698) polymorphisms was assessed using the ABI StepOne™ real-time polymerase chain reaction system and analyzed using Software Design Specification (SDS), Version 3.0, software with TaqMan assays. The risk of cervical cancer was examined, revealing adjusted odds ratios and 95% confidence intervals of 1.25 [0.51, 3.08] and 1.09 [0.43, 2.78] for individuals with CC alleles of RRM1 -756T>C and for individuals with AA alleles of RRM1 -269C>A genetic polymorphisms, respectively, compared to individuals with wild-type RRM1 genetic polymorphisms. No significant genetic interaction effect was observed in susceptibility to cervical neoplasia, and no association was found between genetic polymorphisms and clinical statuses of invasive cervical cancer. The genetic polymorphisms RRM1 -756T>C and -269C>A may not be a factor for susceptibility to cervical neoplasia.

  8. Nuclei of dwarf spheroidal galaxies KKs 3 and ESO 269-66 and their counterparts in our Galaxy

    Science.gov (United States)

    Sharina, M. E.; Shimansky, V. V.; Kniazev, A. Y.

    2017-10-01

    We present the analysis of medium-resolution spectra obtained at the Southern African Large Telescope for nuclear globular clusters (GCs) in two dwarf spheroidal galaxies (dSphs). The galaxies have similar star formation histories, but they are situated in completely different environments. ESO 269-66 is a close neighbour of the giant S0 NGC 5128. KKs 3 is one of the few truly isolated dSphs within 10 Mpc. We estimate the helium abundance Y = 0.3, age = 12.6 ± 1 Gyr, [Fe/H] = -1.5, -1.55 ± 0.2 dex, and abundances of C, N, Mg, Ca, Ti, and Cr for the nuclei of ESO 269-66 and KKs 3. Our surface photometry results using Hubble Space Telescope images yield the half-light radius of the cluster in KKs 3, rh = 4.8 ± 0.2 pc. We demonstrate the similarities of medium-resolution spectra, ages, chemical compositions, and structure for GCs in ESO 269-66 and KKs 3 and for several massive Galactic GCs with [Fe/H] ∼ -1.6 dex. All Galactic GCs posses Extended Blue Horizontal Branches and multiple stellar populations. Five of the selected Galactic objects are iron-complex GCs. Our results indicate that the sample GCs observed now in different environments had similar conditions of their formation ∼1 Gyr after the Big Bang.

  9. Analysis on endoscopic and biopsy of 269 cases of Barrett's esophagus%Barrett 食管269例的内镜及活检病理分析

    Institute of Scientific and Technical Information of China (English)

    黄达; 梁明佩

    2011-01-01

    目的:探讨Barrett 食管的病理特征及电子胃镜特点.方法:对269 例行电子胃镜检查并经病理检查证实的Barrett患者资料进行回顾性分析、总结.结果:Barrett 患者以40~60 岁居多,占66.2%(178/269),临床症状有不同程度重叠,主要表现为胃食管反流病(GERD)的症状,电子胃镜下表现为岛型176 例,占65.4%;舌型66 例,占24.5%;全周型27 例,占10.4%.病理结果为肠化型上皮116 例,占43.1%;胃底型上皮96 例,占35.7%;贲门型上皮57 例,占21.2%.结论:Barrett 患者多见于中年人,临床上主要表现为GERD 的症状,电子胃镜下以岛型多见,病理类型以肠化生最为常见.%Objective: To explore the pathological and electronic gastroscope property in patients with Barrett's esophagus. Methods: Total of 269 patients with Barrett's esophagus which diagnosed through routine electronic gastroscopy and pathology were enrolled in this retrospective analysis. Results: Majority of patients were between 40-60 years old. There were some degrees of overlap for clinical symptom among these patients which mainly expressed as the symptom of GERD. Under electronic gastroscopy, appearance of Mashima type was investigated in 176 patients (65.4%), tongue type change was found in 66 patients (24.5%), and the remaining were whole-week type change (10.4%). The results of pathological changes showed that the normal squamous epithelium was replaced by intestinal epithelium (43.1%), gastric epithelium (35.7%), and borderline epithelium (21.2%) separately. Conclusion: Barrett's esophagus is mainly seen in middle age population. Majority of symptoms for these patients are expressed as GERD. Mozhima type's appearance is the main finding in gastroscopy and intestinal metaplasia is the main change in pathology.

  10. Analysis of thalassemia gene of 269 couples%某地区269对夫妇珠蛋白生成障碍性贫血基因检测结果

    Institute of Scientific and Technical Information of China (English)

    张艳霞; 韩泽平

    2014-01-01

    Objective The pregnant population in Guangzhou area were detected in mediterranean anemia gene to guide and standardize the premarital examination ,prenatal diagnosis ,genetic counseling ,high-risk prenatal diagno-sis and prevent the birth of children with severe thalassemia .Methods 269 couples during the period from 2013 March to September ,for examination before pregnancy and blood MCV (mean corpuscular volume) and/or hemoglo-bin electrophoresis screening positive(538 cases) were detected in mediterranean anemia gene by agarose gel electro-phoresis and gap-PCR methods .Results 269 couples accepted detection ,detection of alpha thalassemia was 28 .4% , detection of beta thalassemia rate was 19 .5% ,among them ,the couple for alpha thalassemiawith detection rate was 5 .9% ,the same as the betathalassemia detection rate was 2 .2% ,one for the alpha thalassemia ,the other party or party for beta thalassemiaalpha beta composite to poverty ,the other normaldetection rate was 4 .5% .Conclusion Mediterranean anemia examination of reproductive population ,has an important significance to eugenics and reduce the social andeconomic burden of the family .%目的:对广州地区孕前人群进行珠蛋白生成障碍性贫血基因检测,以指导规范的婚前检查、产前检查,预防重症珠蛋白生成障碍性贫血患儿的出生。方法采用琼脂糖凝胶电泳及gap-PCR方法对2013年3~9月来院进行孕前检查并且血常规平均红细胞体积(MCV)和(或)血红蛋白电泳初筛阳性的269对夫妇(共538例)进行珠蛋白生成障碍性贫血基因检测。结果接受检测的269对夫妇中,α-珠蛋白生成障碍性贫血的检出率为28.4%,β-珠蛋白生成障碍性贫血的检出率为19.5%,其中,双方夫妇同为α-珠蛋白生成障碍性贫血的检出率为5.9%,同为β-珠蛋白生成障碍性贫血的检出率为2.2%,一方为α-珠蛋白生成障碍性贫血,另一方为β-珠蛋白

  11. 269例发作性睡病临床特征及中医证候特征研究%Clinical feature and TCM syndrome patterns analysis of 269 cases with narcolepsy

    Institute of Scientific and Technical Information of China (English)

    杨嘉颐; 戴中; 白文; 王春玲; 王今芳; 郭静; 彭朗; 盖聪; 柳洪胜

    2013-01-01

    Objective:To discuss the clinical feature and TCM syndrome patterns of Narcolepsy.Methods:269 cases with narcolepsy from March of 2008 to September of 2010 were analyzed.Clinical conditions,core symptoms and surrounding symptom information were collected.Clinical feature and TCM syndrome patterns in patients of different age were compared and summarized.Results:The main core symptoms included daytime sleepiness,cataplexy,sleep paralysis,hypnogogic hallucination,and disturbed noctumal sleep.The main TCM syndrome patterns were stagnation of liver-qi and spleen asthenic fluid-retention.Conclusion:The clinical feature and TCM syndrome patterns of narcolepsy were analyzed and the study provided evidence for the treatment of Narcolepsy.%目的:探讨发作性睡病的临床特征及中医证候特征.方法:观察269例2008年3月至2010年9月于我院确诊的发作性睡病病例,收集患者一般情况、核心症状及周边症状信息,对比并总结不同发病年龄患者的临床特征及中医证候特征.结果:发作性睡病以白天嗜睡、发作性猝倒、睡瘫、入睡幻觉及夜间睡眠紊乱为主要核心症状;肝郁、脾虚湿困是发作性睡病的主要中医证候.结论:发作性睡病的临床特征及中医证候特征具有一定规律,为中医辨治发作性睡病提供依据.

  12. Impact of gamma rays exposure and growth regulators on Oryza sativa L. c.v MR269 callus induction

    Science.gov (United States)

    Kadhimi, Ahsan A.; Zain, Che Radziah Che Mohd; Alhasnawi, Arshad Naji; Isahak, Anizan; Ashraf, Mehdi Farshad; Mohamad, Azhar; Doni, Febri; Yusoff, Wan Mohtar Wan

    2016-11-01

    The study is aimed to evaluate in vitro somatic embryogenesis to gamma ray exposure and the use of growth regulators to mature embryos explants for rice callus induction. Seeds of local rice genotype (MR269) were exposed to gamma rays at 350 Gy (Source: Caesium-137). Matured embryos were cultured to induce callus on Murashige and Skoog (MS) supplemented at different concentrations of 1.0, 2.0, 3.0 mg/L 2.4-D and 0.1 and 0.2 mg/L Kinetin for 4 weeks. Callus induction and callus fresh weight were decreased after exposure to gamma ray. The most efficient response to callus induction and callus fresh weight was found at 3 mg/L 2,4-D and 0.1 mg/L kinetin.

  13. Elastic scattering and breakup of 11Be on deuterons at 26.9 A MeV

    Science.gov (United States)

    Chen, J.; Lou, J. L.; Ye, Y. L.; Rangel, J.; Moro, A. M.; Pang, D. Y.; Li, Z. H.; Ge, Y. C.; Li, Q. T.; Li, J.; Jiang, W.; Sun, Y. L.; Zang, H. L.; Zhang, Y.; Aoi, N.; Ideguchi, E.; Ong, H. J.; Lee, J.; Wu, J.; Liu, H. N.; Wen, C.; Ayyad, Y.; Hatanaka, K.; Tran, T. D.; Yamamoto, T.; Tanaka, M.; Suzuki, T.; Nguyen, T. T.

    2016-12-01

    The elastic scattering and breakup reactions of the halo nucleus 11Be on deuterons at an incident energy of 26.9 A MeV are reported for the first time. Special attention has been paid to the determination and subtraction of the proton contaminations in the deuterated polyethylene (CD2)n target (where D2 denotes H22 ). The cross sections for elastic scattering are analyzed with the systematic optical potentials of Daehnick et al. and DA1p, as well as with single-folding potentials, derived from the Jeukenne-Lejeune-Mahaux effective nucleon-nucleon interaction. An extended version of the continuum-discretized coupled-channels (XCDCC) formalism, including dynamic core excitation (DCX) effects, is applied to analyze the elastic scattering and breakup data. Comparisons of the full XCDCC calculation with that omitting DCX effects indicate that the core excitation plays a remarkable role in reproducing breakup reactions of 11Be+d .

  14. Cavity residue leucine 95 and channel residues glutamine 204, aspartic acid 211, and phenylalanine 269 of toluene o-xylene monooxygenase influence catalysis.

    Science.gov (United States)

    Kurt, Cansu; Sönmez, Burcu; Vardar, Nurcan; Yanık-Yıldırım, K Cansu; Vardar-Schara, Gönül

    2016-09-01

    Structural analysis of toluene-o-xylene monooxygenase (ToMO) hydroxylase revealed the presence of three hydrophobic cavities, a channel, and a pore leading from the protein surface to the active site. Here, saturation mutagenesis was used to investigate the catalytic roles of alpha-subunit (TouA) second cavity residue L95 and TouA channel residues Q204, D211, and F269. By testing the substrates toluene, phenol, nitrobenzene, and/or naphthalene, these positions were found to influence the catalytic activity of ToMO. Several regiospecific variants were identified from TouA positions Q204, F269, and L95. For example, TouA variant Q204H had the regiospecificity of nitrobenzene changed significantly from 30 to 61 % p-nitrophenol. Interestingly, a combination of mutations at Q204H and A106V altered the regiospecificity of nitrobenzene back to 27 % p-nitrophenol. TouA variants F269Y, F269P, Q204E, and L95D improved the meta-hydroxylating capability of nitrobenzene by producing 87, 85, 82, and 77 % m-nitrophenol, respectively. For naphthalene oxidation, TouA variants F269V, Q204A, Q204S/S222N, and F269T had the regiospecificity changed from 16 to 9, 10, 23, and 25 % 2-naphthol, respectively. Here, two additional TouA residues, S222 and A106, were also identified that may have important roles in catalysis. Most of the isolated variants from D211 remained active, whereas having a hydrophobic residue at this position appeared to diminish the catalytic activity toward naphthalene. The mutational effects on the ToMO regiospecificity described here suggest that it is possible to further fine tune and engineer the reactivity of multicomponent diiron monooxygenases toward different substrates at positions that are relatively distant from the active site.

  15. Differential actions of the prostacyclin analogues treprostinil and iloprost and the selexipag metabolite, MRE-269 (ACT-333679) in rat small pulmonary arteries and veins.

    Science.gov (United States)

    Orie, N N; Ledwozyw, A; Williams, D J; Whittle, B J; Clapp, L H

    2013-10-01

    The prostacyclin (IP) receptor agonists, treprostinil, iloprost and the selexipag metabolite, MRE-269 (ACT-333679) were evaluated in rat distal pulmonary blood vessels. Small pulmonary arteries and veins were pre-contracted with the thromboxane mimetic, U46619 (25 and 100nM, respectively), and relaxation determined with and without IP receptor antagonists, RO1138452 and RO3244794. In arteries, treprostinil was a more potent vasorelaxant than iloprost, while the efficacy of iloprost was greater. In pulmonary arteries, treprostinil-induced relaxation was essentially abolished by both IP antagonists (1μM), while responses to iloprost were partially inhibited. Both treprostinil and iloprost were equipotent, prominently relaxing pulmonary veins with responses being similarly and partially sensitive to IP antagonists. In contrast, RO1138452 failed to inhibit relaxations to MRE-269 in either pulmonary arteries or veins, suggesting no involvement of typical IP receptors. Thus, rat pulmonary tissues cannot be considered appropriate to assess classical IP receptors using the proposed highly selective non-prostanoid agonist MRE-269, contrasting with the IP receptor agonism profile of prostacyclin analogues, iloprost and treprostinil. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Characterization of fHbp, nhba (gna2132), nadA, porA, sequence type (ST), and genomic presence of IS1301 in group B meningococcal ST269 clonal complex isolates from England and Wales.

    Science.gov (United States)

    Lucidarme, Jay; Comanducci, Maurizio; Findlow, Jamie; Gray, Stephen J; Kaczmarski, Edward B; Guiver, Malcolm; Kugelberg, Elisabeth; Vallely, Pamela J; Oster, Philipp; Pizza, Mariagrazia; Bambini, Stefania; Muzzi, Alessandro; Tang, Christoph M; Borrow, Ray

    2009-11-01

    Highly effective glycoconjugate vaccines exist against four of the five major pathogenic groups of meningococci: A, C, W-135, and Y. An equivalent vaccine against group B meningococci (menB) has remained elusive due to the poorly immunogenic capsular polysaccharide. A promising alternative, the investigational recombinant menB (rMenB)- outer membrane vesicle (OMV) vaccine, contains fHBP, NHBA (previously GNA2132), NadA, and outer membrane vesicles (OMVs) from the New Zealand MeNZB vaccine. MenB currently accounts for 90% of meningococcal disease in England and Wales, where the multilocus sequence type (ST) 269 (ST269) clonal complex (cc269) has recently expanded to account for a third of menB cases. To assess the potential cc269 coverage of the rMenB-OMV vaccine, English and Welsh cc269 isolates from the past decade were genetically characterized with respect to fHBP, NHBA, and NadA. All of the isolates harbored fHbp and nhba alleles, while 98% of the cc269 isolates were devoid of nadA. Subvariant profiling of fHbp, nhba, and porA against STs revealed the presence of two broadly distinct and well-defined clusters of isolates, centered around ST269 and ST275, respectively. An additional molecular marker, insertion sequence IS1301, was found to be present in 100% and <2% of isolates of the respective clusters. On the basis of the genetic data, the potential rMenB-OMV coverage of cc269 in England and Wales is high (up to 100%) within both clusters. Expression studies and serum bactericidal antibody assays will serve to enhance predictions of coverage and will augment ongoing studies regarding the significance of IS1301 within the ST269 cluster.

  17. Chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN269 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2011-09-01 to 2011-10-08 (NODC Accession 0104368)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104368 includes chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN269 in the Coastal Waters of SE Alaska and...

  18. A comparison of the therapeutic and reactivating efficacy of newly developed bispyridinium compounds (K206, K269) with currently available oximes against tabun in rats and mice.

    Science.gov (United States)

    Kassa, Jiri; Karasova, Jana; Bajgar, Jiri; Kuca, Kamil; Musilek, Kamil

    2008-12-01

    The potency of newly developed bispyridinium compounds (K206, K269) in reactivating tabun-inhibited acetylcholinesterase and eliminating tabun-induced lethal toxic effects was compared with commonly used oximes (obidoxime, trimedoxime, the oxime HI-6) using in vivo methods. Studies which determined percentage of reactivation of tabun-inhibited blood and tissue AChE in poisoned rats showed that the reactivating efficacy of both newly developed oximes is comparable with obidoxime and trimedoxime in blood but lower than the reactivating potency of trimedoxime and obidoxime in the diaphragm and brain. Nevertheless, the differences in reactivating efficacy of obidoxime, trimedoxime and K206 was not significant while the potency of K269 to reactivate tabun-inhibited acetylcholinesterase was significantly lower. Both newly developed oximes were also found to be relatively efficacious in elimination of the lethal toxic effects in tabun-poisoned mice. Their therapeutic efficacy corresponds to the therapeutic potency of obidoxime. The oxime HI-6, relatively efficacious against soman, did not seem to be an adequately effective oxime in reactivation of tabun-inhibited AChE and to counteract lethal effects of tabun. Both newly developed oximes (K206, K269) are significantly more efficacious in reactivating tabun-inhibited AChE in rats and to eliminate lethal toxic effects of tabun in mice than the oxime HI-6 but their reactivating and therapeutic potency does not prevail over the effectiveness of currently available obidoxime and trimedoxime and, therefore, they are not suitable for their replacement of commonly used oximes for the treatment of acute tabun poisoning.

  19. [The influence of immunization of rats with BSA-conjugated peptide 269-280 of type 3 melanocortin receptor on the metabolic parameters and thyroid functions].

    Science.gov (United States)

    Derkach, K V; Shpakova, E A; Zharova, O A; Bondareva, V M; Shpakov, A O

    2014-01-01

    One of the approaches to study the role of the brain hormonal signaling systems in the regulation of biochemical and physiological processes is their shutdown using the antibodies generated to peptides corresponding to extracellular regions of receptors. The brain type 3 melanocortin receptors (M3R) play an important role in the central regulation of the metabolism and the endocrine system. However, the influence of prolonged inhibition of M3R on energy metabolism, insulin resistance, and thyroid gland (TG) function is practically not studied. The aim of the study was to investigate the influence of prolonged repeated immunization of male rats with the BSA-conjugated peptide Ala-[Pro-Thr-Asn-Pro-Tyr-Cys-Ile-Cys-Thr-Thr-Ala-His269-280]-Ala (A[269- 280]A) corresponding to the third extracellular loop of M3R on their metabolic parameters and functional activity of TG. 9 months after the first immunization, the weight of rats was reduced and after 12-13 months was significantly lower than in controls. The weight of abdominal and brown adipose tissues, on the contrary, increased. At the same timeline there was an increase in the fasting glucose and insulin levels, and increase of the HOMA-IR index (by 75%) indicating that immunized animals develop insulin resistance. The rats have increased glucose utilization due to an increase of insulin production by pancreatic β-cells. 12 months after the first immunization, the increase of the triglycerides level (by 74%) and the ratio of LDL- and HDL-cholesterol (by 36%) were revealed. 13 months after the start of immunization, the levels of free and total thyroxine and total triiodothyronine significantly decreased. In the TG plasma membranes of immunized rats the weakening adenylyl cyclase stimulating effect of thyroid-stimulating hormone was detected. Thus, long-term decrease in the bra- in M3R activity due to repeated immunization of rats with BSA-conjugated peptide A[269-280]A induces the disturbances of the peripheral

  20. Synthesis and Pharmacophore Modelling of 2,6,9-Trisubstituted Purine Derivatives and Their Potential Role as Apoptosis-Inducing Agents in Cancer Cell Lines

    Directory of Open Access Journals (Sweden)

    Jeannette Calderón-Arancibia

    2015-04-01

    Full Text Available A series of 2,6,9-trisubstituted purine derivatives have been synthesized and investigated for their potential role as antitumor agents. Twelve compounds were obtained by a three step synthetic procedure using microwave irradiation in a pivotal step. All compounds were evaluated in vitro to determine their potential effect on cell toxicity by the MTT method and flow cytometry analysis on four cancer cells lines and Vero cells. Three out of twelve compounds were found to be promising agents compared to a known and effective anticancer drug, etoposide, in three out of four cancer cell lines assayed with considerable selectivity. Preliminary flow cytometry data suggests that compounds mentioned above induce apoptosis on these cells. The main structural requirements for their activity for each cancer cell line were characterized with a preliminary pharmacophore model, which identified aromatic centers, hydrogen acceptor/donor center and a hydrophobic area. These features were consistent with the cytotoxic activity of the assayed compounds.

  1. Remaining Sites Verification Package for the 100-F-26:9, 1607-F2 Sanitary Sewer Pipelines, Waste Site Reclassification Form 2008-029

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2008-10-29

    The 100-F-26:9 underground pipeline subsite consists of the sanitary sewers servicing the 105-F, 108-F, 184-F, 185-F, and 190-F buildings, and the 1700-F administration and service buildings (1704-F, 1707-F, 1707-FA, 1713-F, 1717-F, 1719-F, and 1722-F). In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  2. Oligocene-Miocene paleoceanographic changes offshore the Wilkes Land Margin, Antarctica: dinoflagellate cyst and TEX86 analyses of DSDP Site 269

    Science.gov (United States)

    Bijl, Peter; Boterblom, Wilrieke H.; Sangiorgi, Francesca; Hartman, Julian D.; Peterse, Francien

    2017-04-01

    Although a lot of research has been conducted to characterize the onset of Antarctic glaciation at the Eocene-Oligocene transition, little is known about the subsequent evolution and fluctuations of the size of the Antarctic Ice Sheet (AIS). The discrepancy between the conclusions of Foster and Rohling (2013) (insensitive global cryosphere between 400-650 ppmv CO2) and variations in benthic foraminiferal δ18O records (0.5-1 ‰) illustrate the uncertainty in particularly the East AIS variability during the Oligocene and Miocene. Increasing awareness of the importance of oceanographic conditions on ice sheet melt emphasize the need to directly infer ice sheet volume fluctuations from sedimentary archives close to the Antarctic margin. In this study, dinoflagellate cyst (dinocyst) assemblages, dinocyst-based biostratigraphy and TEX86 from Deep Sea Drilling Project Site 269, offshore the Wilkes Land Margin (WLM), were used to reconstruct the paleoenvironment and paleoceanographic setting during the Oligocene and Miocene. Preliminary results are indicative of open ocean conditions, Southern Ocean fronts and high productivity waters. Furthermore, biomarker species were found, which are useful for stratigraphic dating. Research conducted at the continental rise of the WLM (Site U1356), by Bijl et al. (in prep.), has allowed for the calibration of dinocysts events of the Oligocene-Miocene Southern Ocean to the international time scale. Comparing the results of Site 269 to Site U1356 can thus provide an age constraint for this record. Correlating paleoceanographic changes between sites can provide insights into the variability of the EAIS during the Oligocene and Miocene, and will contribute to improving predictions of future changes in the Antarctic ice sheet.

  3. Tolerance of the widespread cyanobacterium Nostoc commune to extreme temperature variations (-269 to 105°C), pH and salt stress.

    Science.gov (United States)

    Sand-Jensen, Kaj; Jespersen, Thomas Sand

    2012-06-01

    Nostoc commune is a widespread colonial cyanobacterium living on bare soils that alternate between frost and thaw, drought and inundation and very low and high temperatures. We collected N. commune from alternating wet and dry limestone pavements in Sweden and tested its photosynthesis and respiration at 20°C after exposure to variations in temperature (-269 to 105°C), pH (2-10) and NaCl (0.02-50 g NaCl kg(-1)). We found that dry field samples and rewetted specimens tolerated exposure beyond that experienced in natural environmental conditions: -269 to 70°C, pH 3-10 and 0-20 g NaCl kg(-1), with only a modest reduction of respiration, photosynthesis and active carbon uptake at 20°C. (14)CO(2) uptake from air declined markedly below zero and above 55°C, but remained positive. Specimens maintained a high metabolism with daily exposure to 6 h of rehydration and 18 h of desiccation at -18 and 20°C, but died at 40°C. The field temperature never exceeded the critical 40°C threshold during the wet periods, but it frequently exceeded this temperature during dry periods when N. commune is already dry and unaffected. We conclude that N. commune has an excellent tolerance to low temperatures, long-term desiccation and recurring cycles of desiccation and rewetting. These traits explain why it is the pioneer species in extremely harsh, nutrient-poor and alternating wet and dry environments.

  4. Alteraciones de la mucosa bucal causadas por la asociación entre el tabaco y los colutorios bucales con una concentración de alcohol del 26,9 % Alterations of the oral mucous membrane caused by the association between tobacco and the mouthwashes with an alcohol concentration of 26.9 %

    Directory of Open Access Journals (Sweden)

    Anna Christina Medeiros Fossati

    2006-09-01

    Full Text Available Se analizaron el epitelio y la capa de queratina de la mucosa oral de 15 ratas que durante 45 días fueron sometidas a una aplicación tópica de picadura de tabaco y de colutorio bucal con una concentración de alcohol del 26,9 %. Tras ese período, se extrajeron las mucosas y se les realizó un análisis histológico. Se observó una significativa disminución del espesor del epitelio y de la capa de queratina, lo que indica que la picadura asociada con colutorios bucales con alta concentración de alcohol, provoca la reducción del espesor de la capa de queratina y del epitelio de la boca.The epithelium and the keratin layer of the oral mucous membrane of 15 rats that were subjected to a topical application of cut tobacco and mouthwashes with an alcohol concentration of 26.9 % during 45 days were analyzed. After that period, the oral mucous membranes were removed and a histological analysis was made. It was observed a significant decrease of the thickness of the epithelium and of the keratin layer, which shows that cut tobbaco associated with collutories with a high concentration of alcohol causes the reduction of the thickness of the keratin layer and of the mouth epithelium.

  5. The detection of infectious bronchitis viral antigen by means of immunohistochemical technique in broiler chicken infected with I-269 IB isolate or injected with H-120 live vaccine

    Directory of Open Access Journals (Sweden)

    Rini Damayanti

    2001-12-01

    Full Text Available A study was carried out to detect the antigen of infectious bronchitis vius (IBV in broiler chicken by means of immunohistochemical technique. A total of 150 - fourteen days old broiler chicken were divided into three groups i.e. 50 chicken were infected with an IB isolate of I-269, 50 chicken were injected with H-120 life vaccine, and 50 chicken served as un-treated control. Clinical signs and gross pathological changes were observed. Each of five chicken of each group were necropsied at 1, 2, 3, 4, 7, 10, 14, 21, 28, and 35 day(s post infection/vaccination. The antigen could be detected at one day through 35 days post vaccination/infection. In the vaccinated group, histopathological lesions and the detected antigen were minimal. In contrast, the infected chicken showed varied histolopathological lesion in accordance with the numerous antigens. The antigen were observed in the lymphocytes/macrophages in the trachea, lungs and kidney, and in the epithelium of trachea, alveoli, broncheolus and tubular sitoplasm of the kidney of both vaccinated and infected groups. In the infected group, antigen was also detected in the lymphocytes and macrophages of the affected organs.

  6. A comparison of the CATHIA-T sampler, the GK2.69 cyclone and the standard cowled sampler for thoracic fiber concentrations at a Taconite (iron ore)-processing mill.

    Science.gov (United States)

    Lee, Eun Gyung; Harper, Martin; Nelson, John; Hintz, Patrick J; Andrew, Michael E

    2008-01-01

    Several recommendations have been made to the effect that the most appropriate health-based size-selective criterion for fibers is the thoracic convention of the International Organization for Standardization (ISO). The performance of two thoracic samplers, the CATHIA-T (37-mm filter) and the GK2.69 cyclone (37-mm filter), was investigated against the standard 25-mm cowled sampler (current NIOSH 7400 standard method) to determine the effect of thoracic sampling on field results. A total of 270 samples: 80 field and 10 field blank samples for each sampler type, were taken from seven stations in the processing mill of an iron ore mine whose ore contains amphibole minerals. Slides were prepared using the dimethyl formamide/Euparal technique and relocatable cover slips. Two counters examined the slides according to NIOSH 7400 counting A rules with phase contrast microscopes. Prior to counting the sample slides, four reference slides were randomly selected and counted three times on different days to compare the coefficient of variation (CV) between and within counters. Also, seven reference slides were chosen to explore variability between the two microscopes. The average CV between counters (0.148) showed slightly higher than the average CVs within counters (0.072 for Counter 1 and 0.119 for Counter 2). The average CV between the two microscopes was 0.147. Compared to the standard cowled sampler, the overall fiber concentration was lower for the CATHIA-T sampler (CATHIA-T/Cowled = 0.63) and higher for the GK2.69 cyclone (GK2.69/Cowled = 1.66). The result for the CATHIA-T sampler is as expected from laboratory trials, but the result for the GK2.69 cyclone is not as expected. In conclusion, the CATHIA-T sampler has a potential advantage as a high-flow static sampler for screening coarse particles. However, these findings resulted from one field sampling site that contains amphibole minerals, not all of which are asbestiform. Thus, additional field samples from other

  7. Decreased affinity of recombinant human tumor necrosis factor-related apoptosis-inducing ligand (rhTRAIL) D269H/E195R to osteoprotegerin (OPG) overcomes TRAIL resistance mediated by the bone microenvironment.

    Science.gov (United States)

    Bosman, Matthieu C J; Reis, Carlos R; Schuringa, Jan J; Vellenga, Edo; Quax, Wim J

    2014-01-10

    The bone marrow microenvironment provides important signals for the survival and proliferation of hematopoietic and malignant cells. In multiple myeloma, plasma cells are surrounded by stromal cells including osteoblasts. These stromal cells protect multiple myeloma cells from apoptosis induced by chemotherapeutic agents. Osteoprotegerin (OPG), a soluble receptor of the cytokine TNF-related apoptosis-inducing ligand (TRAIL), is secreted by osteoblasts and has been implicated in the prevention of cell death induced by TRAIL in malignant cells. Previously, we have designed death receptor-specific TRAIL variants that induce apoptosis exclusively via one of its death receptors. Here, we have studied in detail the interaction between recombinant human (rhTRAIL) variants and OPG. We show that a DR5-specific variant (rhTRAIL D269H/E195R) displays a significantly decreased affinity to OPG. Furthermore, this rhTRAIL variant shows a much higher activity when compared with rhTRAIL WT and retains its effectiveness in inducing cell death in multiple myeloma cell lines, in the presence of OPG secreted by stromal cells. We also demonstrate that stromal cells are largely insensitive to high concentrations of this rhTRAIL variant. In conclusion, rhTRAIL D269H/E195R is a potential therapy for multiple myeloma due to its high effectiveness and diminished binding to OPG.

  8. Complications of Elbow Arthroscopy in 46 Cases:A 10-Year Medical Record Review of 269 Cases%46例肘关节镜手术并发症的分析——10年269例肘关节镜手术回顾

    Institute of Scientific and Technical Information of China (English)

    徐雁; 王健全; 崔国庆; 印钰

    2011-01-01

    目的 探讨肘关节镜手术并发症发生情况及其原因.方法 回顾研究1998年6月~2008年11月269例肘关节镜中46例(17.1%)并发症的发生、处理及预后.男32例,女14例,年龄(32.9±15.1)岁(13~61岁).其中骨关节炎20例,关节粘连8例,肱骨外上髁炎4例,类风湿关节炎4例,急性创伤5例,肱骨内上髁炎1例,剥脱性骨软骨炎2例,色素绒毛结节性滑膜炎1例,肘关节不稳1例.最多见为一过性神经损伤36例,其中累及桡神经7例,尺神经7例,腋神经1例,肢体远端末梢神经感觉障碍21例;迟发性尺神经炎5例;伤口术后渗液1例,皮下血肿1例;残留游离体5例.2例肘关节发生了2种并发症.结果 36例一过性神经损伤患者中的32例在术后1~7天内缓解,最迟1例桡神经深支损伤术后8个月好转.3例迟发性尺神经炎行尺神经前移术,1例伤口血肿行血肿清除术,2例游离体残留行游离体二次取出术,余保守治疗,均治愈.结论肘关节镜的并发症以一过性神经损伤最多见,还有迟发性尺神经炎、伤口并发症、游离体残留.这些并发症绝大多数都是轻微可逆的,故肘关节镜是一种安全有效的技术.%Objective To investigate the major complications after elbow arthroscopy and their causes. Methods Though June 1998 to November 2008, we performed elbow arthroscopy on 269 patients, of whom, complications occurred in 46 cases [ 17. 1% , 32 male and 14 female, aged 32.9 ± 15. 1 in average (13 to 61 years)]. We reviewed the occurrence, treatment, and prognosis of the complications. Among the 46 cases, osteoarthritis was found in 20 patients, flexion contracture in 8, rheumatoid synovitis in 4, tennis elbow in 4, acute trauma in 5, osteoarthritis dissecans in 2, humeral medial epicondylitis in 1, villonodular synovitis in 1, and elbow instability in 1. We noticed that the most common complication was transient neural injury (36 cases), including injury to the musculospiral nerve (7

  9. Alteraciones de la mucosa bucal causadas por la asociación entre el tabaco y los colutorios bucales con una concentración de acohol del 26,9%

    OpenAIRE

    Fossati, Anna Christina Medeiros; Kappel, Eduardo P.; Dobrinsky, Lourenço; Amenábar,José Miguel; Lamers, Marcelo Lazzaron; Silveira, Heloísa Emília Dias da

    2006-01-01

    Se analizaron el epitelio y la capa de queratina de la mucosa oral de 15 ratas que durante 45 días fueron sometidas a una aplicación tópica de picadura de tabaco y de colutorio bucal con una concentración de alcohol del 26,9 %. Tras ese período, se extrajeron las mucosas y se les realizó un análisis histológico. Se observó una significativa disminución del espesor del epitelio y de la capa de queratina, lo que indica que la picadura asociada con colutorios bucales con alta concentración de al...

  10. Alteraciones de la mucosa bucal causadas por la asociación entre el tabaco y los colutorios bucales con una concentración de alcohol del 26,9 %

    Directory of Open Access Journals (Sweden)

    Anna Christina Medeiros Fossati

    Full Text Available Se analizaron el epitelio y la capa de queratina de la mucosa oral de 15 ratas que durante 45 días fueron sometidas a una aplicación tópica de picadura de tabaco y de colutorio bucal con una concentración de alcohol del 26,9 %. Tras ese período, se extrajeron las mucosas y se les realizó un análisis histológico. Se observó una significativa disminución del espesor del epitelio y de la capa de queratina, lo que indica que la picadura asociada con colutorios bucales con alta concentración de alcohol, provoca la reducción del espesor de la capa de queratina y del epitelio de la boca.

  11. A comparison of vasodilation mode among selexipag (NS-304; [2-{4-[(5,6-diphenylpyrazin-2-yl)(isopropyl)amino]butoxy}-N-(methylsulfonyl)acetamide]), its active metabolite MRE-269 and various prostacyclin receptor agonists in rat, porcine and human pulmonary arteries.

    Science.gov (United States)

    Fuchikami, Chiaki; Murakami, Kohji; Tajima, Koyuki; Homan, Junko; Kosugi, Keiji; Kuramoto, Kazuya; Oka, Michiko; Kuwano, Keiichi

    2017-01-15

    Selexipag (NS-304; [2-{4-[(5,6-diphenylpyrazin-2-yl)(isopropyl)amino]butoxy}-N- (methylsulfonyl)acetamide]) is a novel, orally available non-prostanoid prostacyclin receptor (IP receptor) agonist that has recently been approved for the treatment of pulmonary arterial hypertension (PAH). We examined the effect of the active metabolite of selexipag, MRE-269, and IP receptor agonists that are currently available as PAH therapeutic drugs on the relaxation of rat, porcine and human pulmonary artery. cAMP formation in human pulmonary artery smooth muscle cells was induced by all test compounds (MRE-269, epoprostenol, iloprost, treprostinil and beraprost sodium) and suppressed by IP receptor antagonists (CAY10441 and 2-[4-(1H-indol-4-yloxymethyl)-benzyloxycarbonylamino]-3-phenyl-propionic acid). MRE-269 induced endothelium-independent vasodilation of rat extralobar pulmonary artery (EPA). In contrast, endothelial denudation or the addition of a nitric oxide synthase inhibitor markedly attenuated the vasodilation of EPA induced by epoprostenol, treprostinil and beraprost sodium but not iloprost. The vasorelaxant effects of MRE-269 on rat small intralobar pulmonary artery (SIPA) and EPA were the same, while the other IP receptor agonists induced less vasodilation in SIPA than in EPA. Furthermore, a prostaglandin E receptor 3 antagonist enhanced the vasodilation induced by all IP receptor agonists tested except MRE-269. We also investigated the relaxation induced by IP receptor agonists in pulmonary arteries from non-rodent species and found similar vasodilation modes in porcine and human as in rat preparations. These results suggest that MRE-269, in contrast to other IP receptor agonists, works as a selective IP receptor agonist, thus leading to pronounced vasorelaxation of rat, porcine and human pulmonary artery.

  12. Reference: 269 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available trick Teresa B|Forster Gabriela|Raschle Thomas|Tambasco-Studart Marina|Titiz Olca ... Sep Proceedings of the National Academy of Sciences of the United States of America Amrhein Nikolaus|Fitzpa

  13. Galileo's Medicean Moons (IAU S269)

    Science.gov (United States)

    Barbieri, Cesare; Chakrabarti, Supriya; Coradini, Marcello; Lazzarin, Monica

    2010-11-01

    Preface; 1. Galileo's telescopic observations: the marvel and meaning of discovery George V. Coyne, S. J.; 2. Popular perceptions of Galileo Dava Sobel; 3. The slow growth of humility Tobias Owen and Scott Bolton; 4. A new physics to support the Copernican system. Gleanings from Galileo's works Giulio Peruzzi; 5. The telescope in the making, the Galileo first telescopic observations Alberto Righini; 6. The appearance of the Medicean Moons in 17th century charts and books. How long did it take? Michael Mendillo; 7. Navigation, world mapping and astrometry with Galileo's moons Kaare Aksnes; 8. Modern exploration of Galileo's new worlds Torrence V. Johnson; 9. Medicean Moons sailing through plasma seas: challenges in establishing magnetic properties Margaret G. Kivelson, Xianzhe Jia and Krishan K. Khurana; 10. Aurora on Jupiter: a magnetic connection with the Sun and the Medicean Moons Supriya Chakrabarti and Marina Galand; 11. Io's escaping atmosphere: continuing the legacy of surprise Nicholas M. Schneider; 12. The Jovian Rings Wing-Huen Ip; 13. The Juno mission Scott J. Bolton and the Juno Science Team; 14. Seeking Europa's ocean Robert T. Pappalardo; 15. Europa lander mission: a challenge to find traces of alien life Lev Zelenyi, Oleg Korablev, Elena Vorobyova, Maxim Martynov, Efraim L. Akim and Alexander Zakahrov; 16. Atmospheric moons Galileo would have loved Sushil K. Atreya; 17. The study of Mercury Louise M. Prockter and Peter D. Bedini; 18. Jupiter and the other giants: a comparative study Thérèse Encrenaz; 19. Spectroscopic and spectrometric differentiation between abiotic and biogenic material on icy worlds Kevin P. Hand, Chris McKay and Carl Pilcher; 20. Other worlds, other civilizations? Guy Consolmagno, S. J.; 21. Concluding remarks Roger M. Bonnet; Posters; Author index; Object index.

  14. Dicty_cDB: SHB269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 389Q.Seq.d/ 464 e-130 SHA292 (SHA292Q) /CSM/SH/SHA2-D/SHA292Q.Seq.d/ 464 e-130 CHL168 (CHL168Q) /CSM/CH/CHL1...eq.d/ 464 e-130 VHG683 (VHG683Q) /CSM/VH/VHG6-D/VHG683Q.Seq.d/ 464 e-130 SHG389 (SHG389Q) /CSM/SH/SHG3-D/SHG

  15. 40 CFR 180.269 - Aldicarb; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... commodities: Commodity Parts per million Bean, dry, seed 0.1 Beet, sugar, roots 0.05 Beet, sugar, tops 1 Citrus, dried pulp 0.6 Coffee, bean, green 0.1 Cotton, undelinted seed 0.1 Cotton, hulls 0.3 Grapefruit...

  16. Dicty_cDB: SSK269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e N BI272254 |BI272254.1 NF016A03FL1F1020 Developing flower Medicago truncatula c...DNA clone pDSLC-37D4, mRNA sequence. 78 2e-12 3 BG452146 |BG452146.1 NF077A07LF1F1053 Developing leaf Medica...44L17 5' end, mRNA sequence. 44 4e-11 3 BE319984 |BE319984.2 NF024A12RT1F1085 Developing root Medicago trunc

  17. Dicty_cDB: VSD269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KVCTGLVVRQRKHWKRKDGVYIYFEDNAGVMCNPKGE VKGNILGPVAKECSDLGQRLPPMPVP Frame C: lrkkvct...glvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpvakecsdlwpkv atnagtiv*inthkvkti*kk--- ---qvlviwswlpskrvnqn*erkfalv*...*lsdkentgrermvftsiskitlvlcviqkvkskvtfsdqsprnapiygqr lppmpvplfk*IHIKLKQYKKK--- ---AGVGDMVMATVKKGKPELRKKVCTGLV...VRQRKHWKRKDGVYIYFEDNAGVMCNPKGE VKGNILGPVAKECSDLGQRLPPMPVP Translated Amino Acid sequence (All Frames) Frame

  18. Dicty_cDB: VFF269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyuns...aturated fatty acids. 1304 0.0 2 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain p...04.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and composit...ions for synthesis of long chain polyunsaturated fatty acids in plants. 1304 0.0 2

  19. 12 CFR 269b.520 - Exceptions to hearing officer's report.

    Science.gov (United States)

    2010-01-01

    ... FEDERAL RESERVE SYSTEM CHARGES OF UNFAIR LABOR PRACTICES Panel Review of Hearing Officer's Report and... statement of the case containing all that is material to the consideration of the questions presented; (2)...

  20. 77 FR 269 - Matters Related to Patent Appeals

    Science.gov (United States)

    2012-01-04

    ... United States Patent and Trademark Office Matters Related to Patent Appeals ACTION: Proposed collection; comment request. SUMMARY: The United States Patent and Trademark Office (USPTO), as part of its continuing...: Email: InformationCollection@uspto.gov . Include ``0651- 00xx Matters Related to Patent Appeals...

  1. Dicty_cDB: VSK269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6_1( EU494076 |pid:none) Scaptodrosophila lebanonensis vouc... 34 7.8 EU494077_1(... EU494077 |pid:none) Scaptodrosophila pattersoni vouche... 34 7.8 protein update 2009. 3.26 PSORT psg: 0.70

  2. Dicty_cDB: VHC269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 normal cattle brain Bos taurus cDNA clone RZPDp1056L2142Q 5', mRNA sequence. 48 0.30 1 BF440292 |BF440292.1 BS29000192603 Lewin Cat...tle Spleen Bos taurus cDNA clone BS29000192603 3', mRNA

  3. Dicty_cDB: SHE269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .f OR_ABa Oryza ridleyi genomic clone OR_ABa0074P22 5', genomic survey sequence. 42 2.9 1 CZ796627 |CZ796627....1 OC__Ba0165O17.f OC__Ba Oryza coarctata genomic clone OC__Ba0165O17 5', genomic survey sequence. 42 2.9 1 ...CZ764028 |CZ764028.1 OC__Ba0118L24.f OC__Ba Oryza coarctata genomic clone OC__Ba0118L24 5', genomic survey

  4. Dicty_cDB: AHA269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 X15386 |X15386.1 Dictyostelium discoideum H6 gene mRNA. 242 2e-64 2 BI863585 |BI863585.1 kx46a06.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to SW:EF2...loides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA ...5' similar to SW:EF2_CHICK Q90705 ELONGATION FACTOR 2 ;, mRNA sequence. 66 2e-18 3 BI451383 |BI451383.1 kx23e09.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides

  5. Dicty_cDB: SHD269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9278.rev ANNN Pimephales promelas Whole (L) Pimephales promelas cDNA clone ANNN92...78 3', mRNA sequence. 48 0.26 1 DT309974 |DT309974.1 JGI_CAAX1517.rev CAAX Pimephales promelas testis 7-8 mo...nth adults, males and females pooled (L) Pimephales promelas cDNA clone CAAX1517 3', mRNA sequence. 48 0.26 ...1 DT309975 |DT309975.1 JGI_CAAX1517.fwd CAAX Pimephales promelas testis 7-8 month adults, males and females ...T347978 |DT347978.1 JGI_CAAX10802.fwd CAAX Pimephales promelas testis 7-8 month adults, males and females pooled (L) Pimephales prome

  6. Dicty_cDB: CHM269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hlhllqalphlhlhhqalphlhlhhqalphlhlhhqallhlh lhhlhlhhlhlhhlqqlqlqlqlqlqlqlqlqlqpq F...rame B: ---lclcrsk*csclfaktyhyhr*hi*lvcpwfnl*klclwflccfklclwffccfift iiiccklfsificcklfsificcklfpificiiklfpif

  7. 12 CFR 269.6 - Unfair labor practices.

    Science.gov (United States)

    2010-01-01

    ... employees. (c) Notwithstanding anything previously stated in this section, the expression of any view, argument or opinion, or the dissemination thereof, whether in oral, written, printed, graphic or visual form, shall not constitute or be evidence of an unfair labor practice, if such expression contains no...

  8. Dicty_cDB: SFJ269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PXTMIINGEADVLRDEGENFXRLLRKANVPVTHLRIQ AMVHDFVALXCLDQSRSM*scxgxln*flk*is*skcn*tkmxqiitsixqsixqsinyk ixhx Tran...KWFWDAYTN SPKDTNEIYCSPSKCKESDVMGFPXTMIINGEADVLRDEGENFXRLLRKANVPVTHLRIQ AMVHDFVALXCLDQSRSM*scx

  9. Dicty_cDB: SSG269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e 2 map 4657875-4914984 strain AX4, complete sequence. 38 0.025 9 CA984857 |CA984857.1 AGENCOURT_11280334 Well... 0.027 1 BG730427 |BG730427.1 df44c04.y1 Wellcome CRC pRN3 head Xenopus laevis cDNA clone IMAGE:3581190 5' s

  10. 12 CFR 269.2 - Membership in a labor organization.

    Science.gov (United States)

    2010-01-01

    ... organization. (a) Any employee of a Federal Reserve Bank (hereinafter referred to as “Bank”) is free to join... employees eligible to vote specifically elect to be represented by such labor organization. However,...

  11. Vouchers and Educational Freedom: A Debate. Policy Analysis No. 269.

    Science.gov (United States)

    Bast, Joseph L.; And Others

    Advocates of educational freedom disagree about whether school vouchers would liberate schools and families and lead to greater freedom of choice or trap private schools in a web of subsidy and regulation that would destroy their independence and quality. In this exchange of opinions, Joseph L. Bast and David Harmer argue that voucher plans would…

  12. Dicty_cDB: CFH269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA clone VVB158G03 5, mRNA sequence. 64 6e-07 2 CA813481 |CA813481.1 CA48LN10IF-E8 Caberne...B341828 |CB341828.2 CA32EN0002_IIIbF_E01 Cabernet Sauvignon Leaf - CA32EN Vitis vinifera cDNA clone CA32EN00

  13. 12 CFR 269.1 - Definition of a labor organization.

    Science.gov (United States)

    2010-01-01

    ...) Which asserts the right to strike against the government of the United States, the Board of Governors of... the constitutional form of the government of the United States; or (d) Which discriminates with...

  14. 26 CFR 1.269-3 - Instances in which section 269(a) disallows a deduction, credit, or other allowance.

    Science.gov (United States)

    2010-04-01

    ... net operating loss carryovers. The transfer of the profitable business, which has the effect of using... which is materially greater than its aggregate fair market value at the time of such acquisition and...

  15. 26 CFR 1.269-6 - Relationship of section 269 to section 382 before the Tax Reform Act of 1986.

    Science.gov (United States)

    2010-04-01

    ... utilizing its net operating loss carryovers by changing its business to a profitable new business. Assume... and that during January 1957 the business is changed to an entirely new and profitable business. The... after the merger, 12 percent of the fair market value of the outstanding stock of P Corporation. If the...

  16. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  17. 12 CFR 269b.442 - Duties and powers of the hearing officer.

    Science.gov (United States)

    2010-01-01

    ... evidence; (e) Take or cause depositions to be taken whenever the ends of justice would be served thereby... respective positions concerning any issue in the case or theory in support thereof; (k) Require the...

  18. 32 CFR 269.4 - Cost of living adjustments of civil monetary penalties.

    Science.gov (United States)

    2010-07-01

    ... adjustment” means the percentage (if any) for each civil monetary penalty by which the Consumer Price Index for the month of June of the calendar year preceding the adjustment, exceeds the Consumer Price Index... Subsequent Offense 20,000 22,000 31 U.S.C. 1352 Use of Appropriated Funds to Influence Contract: Minimum...

  19. 29 CFR 1910.269 - Electric power generation, transmission, and distribution.

    Science.gov (United States)

    2010-07-01

    ... distribution installations, including related equipment for the purpose of communication or metering, which are... used to supply a workplace for emergency, standby, or similar purposes only is covered under subpart S... safety, and the locations of circuits and equipment, including power and communication lines and...

  20. Draft Genome Sequence of Fonsecaea nubica Strain CBS 269.64, Causative Agent of Human Chromoblastomycosis.

    Science.gov (United States)

    Costa, Flávia F; de Hoog, Sybren; Raittz, Roberto T; Weiss, Vinicius A; Leão, Aniele C R; Bombassaro, Amanda; Sun, Jiufeng; Moreno, Leandro F; Souza, Emanuel M; Pedrosa, Fabio O; Steffens, Maria Berenice R; Baura, Valter; Tadra-Sfeir, Michele Z; Balsanelli, Eduardo; Najafzadeh, M Javad; Gomes, Renata R; Felipe, Maria S; Teixeira, Marcus; Santos, Germana D; Xi, Liyan; Alves de Castro, Mauro Antônio; Vicente, Vânia A

    2016-08-04

    On the basis of multilocus phylogenetic data, Fonsecaea nubica was described in 2010 as a molecular sibling of F. monophora, an established agent of the human skin disease chomoblastomycosis in tropical zones. Genome analysis of these pathogens is mandatory to identify genes involved in the interaction with host and virulence. Copyright © 2016 Costa et al.

  1. Calibration of ground-based Lidar instrument WLS7-269

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Wagner, Rozenn

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement uncertain......This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...

  2. 49 CFR 40.269 - What problems cause an alcohol test to be cancelled unless they are corrected?

    Science.gov (United States)

    2010-10-01

    ... or STT, or employer, you must cancel an alcohol test if any of the following problems occur, unless they are corrected. These are “correctable flaws.” These problems are: (a) The BAT or STT does not sign the ATF (see §§ 40.247(a)(1) and 40.255(a)(1)). (b) The BAT or STT fails to note on the “Remarks” line...

  3. Neoarchean paleoweathering of tonalite and metabasalt: Implications for reconstructions of 2.69Ga early terrestrial ecosystems and paleoatmospheric chemistry

    Science.gov (United States)

    Driese, S.G.; Jirsa, M.A.; Ren, M.; Brantley, S.L.; Sheldon, N.D.; Parker, Dana C.; Schmitz, M.

    2011-01-01

    Field and laboratory investigations of a 2690.83Ma (207Pb/206Pb age of Saganaga Tonalite) unconformity exposed in outcrop in northeastern Minnesota, USA, reveal evidence for development of a deep paleoweathering profile with geochemical biosignatures consistent with the presence of microbial communities and weakly oxygenated conditions. Weathering profiles are characterized by a 5-50m thick regolith that consists of saprolitized Saganaga Tonalite and Paulson Lake succession basaltic metavolcanic rocks retaining rock structure, which is cross-cut by a major unconformity surface marking development of a successor basin infilled with alluvial deposits. The regolith and unconformity are overlain by thick conglomerate deposits that contain both intrabasinal (saprock) as well as extrabasinal detritus. Thin-section microscopy and electron microprobe analyses reveal extensive hydrolysis and sericitization of feldspars, exfoliation and chloritization of biotite, and weathering of Fe-Mg silicates and Cu-Fe sulfides; weathering of Fe-Ti oxides was relatively less intense than for other minerals and evidence was found for precipitation of Fe oxides. Geochemical analyses of the tonalite, assuming immobile TiO2 during weathering (??Ti,j), show depletion of SiO2, Al2O3, Na2O, CaO, MgO, and MnO, and to a lesser degree of K2O, relative to least-weathered parent materials. Significant Fe was lost from the tonalite. A paleoatmospheric pCO2 of 10-50 times PAL is estimated based on geochemical mass-balance of the tonalite profile and assuming a formation time of 50-500Kyr. Interpretations of metabasalt paleoweathering are complicated by additions of sediment to the profile and extensive diagenetic carbonate (dolomite) overprinting. Patterns of release of P and Fe and retention of Y and Cu in tonalite are consistent with recent laboratory experiments of granite weathering, and with the presence of acidic conditions in the presence of organic ligands (produced, for example, by a primitive microbial community) during weathering. Cu metal in the profile may document lower pO2 than present day at the surface. Comparison with previous studies of weathered tonalite and basalt (Denison, 2.45-2.22Ga) in Ontario, Canada, reveal general similarities in paleoweathering with our study, as well as important differences related to lower paleoatmospheric pO2 and terrestrial biosignature for the older Minnesota profile. A falling water table in the Alpine Lake locality is presumed to have promoted formation of this gossan-like deep-weathering system that extends to 50-m depth. ?? 2011 Elsevier B.V.

  4. 269. Veinte años de experiencia con homoinjertos vasculares criopreservados en la infección vascular

    Directory of Open Access Journals (Sweden)

    E. Quintana

    2012-04-01

    Conclusiones: Este estudio a largo plazo contribuye a mantener la indicación para el implante de homoinjertos vasculares criopreservados en las infecciones vasculares. Los resultados demuestran un comportamiento satisfactorio en esta población multimórbida.

  5. Aubertin Catherine, Pinton Florence, Boisvert Valérie, Les marchés de la biodiversité, IRD Editions, Paris, 2007, 269 p.

    Directory of Open Access Journals (Sweden)

    Elodie Brahic

    2012-05-01

    Full Text Available L’article 2 de la Convention sur la Diversité Biologique (CDB définit la biodiversité comme étant « la variabilité des organismes vivants de toute origine y compris, entre autres, les écosystèmes terrestres, marins et autres écosystèmes aquatiques et les complexes écologiques dont ils font partie ; cela comprend la diversité au sein des espèces et entre espèces ainsi que celles des écosystèmes ». Or, dans l’ouvrage « Les marchés de la biodiversité », les auteurs centrent leur recherche sur l...

  6. Persistence of Fall 1988 Math 310, Math 12 & Math 13 Students through Transfer Level Math over Four Academic Years (Fall 1988-Spring 1992). Research Report #269.

    Science.gov (United States)

    Kangas, Jon; Ma, Tony

    A study was conducted at Evergreen Valley College (EVC) and San Jose City College (SJCC) to determine persistence rates over 4 academic years for students with no previous college experience who entered arithmetic (Math 310), beginning algebra (Math 12), and intermediate algebra (Math 13) courses in fall 1988. The study sought to determine…

  7. Pregnancy planning among women at postpartum period in a public and a private hospital - doi:10.5020/18061230.2008.p269

    Directory of Open Access Journals (Sweden)

    Lucila Coca Leventhal

    2012-01-01

    Full Text Available Purpose: To compare the attitudes of women at postpartum period, from a public (PuH and a private hospital (PrH, regarding their pregnancy planning and to identify contraceptive methods that failed on use, in order to better direct the assistance at contraception. Methods: It was a descriptive study, held on two hospitals from the city of São Paulo. The data collection occurred in August, 2004, by means of a questionnaire applied to all women at postpartum period of each hospital (83 from PuH and 88 from PrU, comprising 171 interviewed. Statistical analysis was done by absolute frequencies and percentages. Results: Most of the interviewed women from PuH (69.9%; n=58 did not plan their pregnancy, while 83.0% (n=73 of those from PrH did so. The contraceptive methods that mostly caused failure were the pill (27.6%; n=16 and the condom (12.1%; n=7 at PuH; and the Ogino- Knaus method [rhythm method of contraception] (26.6%; n=4 and the pill (13.3%; n=2 at PrH. Conclusions: Pregnancy planning was done by most of the women from PrH; the same not occurring for women from PuH. The contraceptive pill and the condom, at PuH, and the rhythm method and the pill, at PrH, were the contraceptive methods that mostly failed. The accomplishment and disclosure of family planning programs for more deprived people is needed, as well as to favor them easy access to contraceptive methods.

  8. 20 CFR 416.269 - What is done to determine whether your earnings are too low to provide comparable benefits and...

    Science.gov (United States)

    2010-04-01

    ... INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility Special Provisions for People Who Work Despite A... (see § 416.1112(c)(6)), work expenses of the blind (see § 416.1112(c)(8)), and income used or set aside... Medicaid benefits for disabled and blind SSI cash recipients, including recipients of...

  9. Comparing Enrollment, Characteristics, and Academic Outcomes of Students in Developmental Courses and Those in Credit-Bearing Courses at Northern Marianas College. REL 2017-269

    Science.gov (United States)

    Herman, Phillip; Scanlan, Spencer; Carreon, Daisy

    2017-01-01

    Many students graduate from high school academically unprepared for college. When such students enroll in college as first-time freshmen, they are commonly placed in non-credit-bearing developmental English and math courses to develop the skills necessary to complete freshman-level credit-bearing courses. Understanding students' college readiness…

  10. A descriptive study of psoriasis characteristics, severity and impact among 3,269 patients: Results of a Belgian cross sectional study (BELPSO)

    NARCIS (Netherlands)

    J. Lambert (Julien); E.A. Dowlatshahi (Emmilia); M. de la Brassinne (Michel); T.E.C. Nijsten (Tamar)

    2012-01-01

    textabstractBackground: Although several large observational studies have reported on psoriasis characteristics, very few have included severity assessments by dermatologists and validated health related quality of life measures. Objective: To describe psoriasis characteristics, clinical severity

  11. Teaching Russian for special purposes in Italy. Some reflections about the book E. Cadorin, I. Kukushkina, Il russo tecnico-scientifico (Hoepli, Milano 2011, pp. 269 Riflessioni sull’insegnamento delle microlingue del russo. A proposito del volume di E. Cadorin, I. Kukushkina, Il russo tecnico-scientifico (Hoepli, Milano 2011, pp. 269

    Directory of Open Access Journals (Sweden)

    Maria Chiara Ferro

    2012-01-01

    Full Text Available The essay deals with the problems involved in teaching Russian as a foreign language in Italian Universities, in order to bring university courses into line with market demands in a globalized world.Over the last twenty years educated youngsters looking for jobs in commerce, law or tourism, have been required to have a series of skills, both in the linguistic and technical fields, that they can rarely achieve during academic lessons.The book by E. Cadorin and I. Kukushkina offers a great deal of original material intended for specialised advanced Russian language courses in the fields of natural sciences, technology, commerce, and so on. Appreciation of the book has stimulated reflections on wider questions related to “when, how and where?” Russian for special purposes should be taught in our universities.The essay deals with the problems involved in teaching Russian as a foreign language in Italian Universities, in order to bring university courses into line with market demands in a globalized world. Over the last twenty years educated youngsters looking for jobs in commerce, law or tourism, have been required to have a series of skills, both in the linguistic and technical fields, that they can rarely achieve during academic lessons. The book by E. Cadorin and I. Kukushkina offers a great deal of original material intended for specialised advanced Russian language courses in the fields of natural sciences, technology, commerce, and so on. Appreciation of the book has stimulated reflections on wider questions related to “when, how and where?” Russian for special purposes should be taught in our universities.

  12. Multibeam collection for TN269: Multibeam data collected aboard Thomas G. Thompson from 2011-09-09 to 2011-10-04, departing from Seattle, WA and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  13. Corrigendum to “Nuclear microprobe investigation of the penetration of ultrafine zinc oxide into human skin affected by atopic dermatitis” [Nucl. Instr. Meth. B 269 (2011) 2278-2280

    Science.gov (United States)

    Szikszai, Z.; Kertesz, Zs.; Bodnar, E.; Borbiro, I.; Kiss, B.; Angyal, A.; Csedreki, L.; Furu, E.; Szoboszlai, Z.; Kiss, A. Z.; Hunyadi, J.

    2014-11-01

    The author line in the originally published version of the article is incorrect and the correct author line is as follows: Z. Szikszaia,∗, Zs. Kertesza, E. Bodnarb, I. Borbiroc, B. Kissb, A. Angyala, L. Csedrekia, E. Furua, Z. Szoboszlaia, A.Z. Kissa, J. Hunyadib

  14. Additional insights. Commentary on “the musical stroop effect: opening a new avenue to research on automatisms” by l. Grégoire, P. Perruchet, and B. Poulin-Charronnat (Experimental Psychology, 2013, vol. 60, pp. 269–278).

    Science.gov (United States)

    Akiva-Kabiri, Lilach; Henik, Avishai

    2014-01-01

    In their paper "The Musical Stroop Effect: Opening a New Avenue to Research on Automatisms," Grégoire, Perruchet, and Poulin-Charronnat (2013) use a musical Stroop-like task to demonstrate the automaticity of musical note naming in musicians. In addition, the authors suggest that music training can serve as a tool in order to study the acquisition of automaticity. In the following commentary, we aim to address three main issues concerning the paper by Grégoire et al. (2013). First, we will suggest some additional interpretations of the results; specifically, we will relate to the association between music and space. Second, we will discuss a methodological issue dealing with interference, facilitation, and the role of the neutral condition. We suggest that the study by Grégoire et al. (2013) lacks a proper neutral condition and thus it is impossible to assert that the congruency effect is interference based. Third, we will discuss the authors' suggestion of using the musical Stroop effect as a tool for studying automatism. We consider the practical relevance of music training as a tool for studying the acquisition of automaticity by pointing out that music training is highly heterogeneous.

  15. Reference Services in Australian Academic Libraries are Becoming More Multifaceted, A Review of: Burke, L. “Models of Reference Services in Australian Academic Libraries.” Journal of Librarianship and Information Science 40.4 (2008: 269‐86.

    Directory of Open Access Journals (Sweden)

    David Herron

    2009-09-01

    Full Text Available Objective – To investigate the current organizational models for reference work in Australian academic libraries, and how these reference services are staffed.Design – Mixed methods.Setting – Academic universities in Australia.Subjects – Forty Council of Australian University Librarians (CAUL member libraries.Methods – A literature study was undertaken to (1 find a definition of reference services and (2 explore the development of reference service models over time. Statistics from the CAUL member libraries were studied for trends in student population and number of academic and library staff. A web‐based survey, with questions based on the findings in the literature study, was then distributed to the 40 Australian university libraries in 2006. Respondents were asked when the library commenced different reference services in five areas: formats in which the library received and responded to reference queries, information literacy, subject specialization, liaison activities, and collection development. Respondents also answered questions about the organization of the reference department, including: whether they had a separate or integrated model; the size of the reference collections; if they had a librarian dedicated to supporting students studying in remote or distant mode; if the interlibrary loans department was part of the suite of reference services; and if they had a mission or statement of purpose for their reference services department.Main Results – Based on the literature study, the working definition of reference services (1 for the project was “all activities which assist in providing relevant and appropriate information services to patrons” (270, including:•All interactions with patrons to assist them in their searches for information in all media types.•All training by librarians of patrons to be able to access information for themselves.•Activities to help the library stay informed of relevant developments, such as establishing and maintaining relationships with patrons. The literature study also revealed (2 a shift from the traditional reference service model, focused on the reference desk and the services delivered from that location, to new models involving “consolidation of reference service points, establishment of tiered reference, reference by appointment, reorganization of reference departments, and limiting services to primary users” (271.The core aspects of reference services have changed little over time, including face‐to‐face reference work, print collection development, bibliographic instruction, and attending meetings. In some aspects, however, there has been a shift in emphasis, e.g., in bibliographic instruction from the teaching of tools to the teaching of information literacy. In addition, reference work has come to include “going out to users,” or academic liaison work, as well as research consultation as a general way to assist undergraduate student in getting started on assignments and projects.The Web‐based survey (n=40, response rate 87.5% showed that 32.4% of libraries have an integrated inquiry point which incorporates information queries and other queries that are not necessarily related to traditional library reference services (272, Table 1. This survey result supports the findings of the literature study in showing a trend of library services moving away from the traditional reference desk. A majority of the responding libraries still retained a separate reference department, but a significant number of libraries have developed departments incorporating reference services with other library services. Those that retained the separate department varied in how they described services to patrons, the most common name being Information Services, a more user‐friendly and descriptive name. In staffing the reference service, the respondents were asked to indicate the classification level of their staff using the Higher Education Worker (HEW scale (an Australian salary scale, based on competencies, minimum 1 / maximum 10. Staff spans a variety of levels (4‐10, the most common level being HEW6, a level where all libraries had staff. This indicates that a large part of reference staff in Australian academic libraries are highly qualified. The shift in higher education, resulting in greater numbers of students and fewer staff (including librarians, has in many libraries resulted in a more flexible organization of reference services, and the utilization of staff from other sections of the library for manning the reference service point. There is also evidence of how the changing student population leads to changing demands for library facilities and services, e.g. a decrease in the traditional complex reference questions, as well as in over the counter loan transactions, and an increase in more general queries.Conclusion – Reference services in Australian academic libraries are becoming more flexible and integrated (although the definition for integrated is still unclear, in part as the result of client demand, and in part due to decreased funding. The author sees an emerging role for reference librarians in helping patrons to navigate the increasingly complex information environment, and to assist in developing the skills to critically evaluate the information they access for authoritativeness and appropriateness.

  16. Can the "musical stroop" task replace the classical stroop task? Commentary on “The musical Stroop effect: Opening a new avenue to research on automatisms” by l. Grégoire, P. Perruchet, and B. Poulin-Charronnat (Experimental Psychology, 2013, vol. 60, pp. 269–278).

    Science.gov (United States)

    Zakay, Dan

    2014-01-01

    The musical Stroop task is analyzed and compared to the classical Stroop task. The analysis indicates that the two tasks differ in the following significant characteristics: ecological validity, the interrelations between the two perceptual dimensions involved, the nature of the automatic process and the existence of a potential Garner interference. It is concluded that the musical task has no advantage over the classical task.

  17. What is learned, and when? Commentary on “the musical stroop effect: opening a new avenue to research on automatisms” by l. Grégoire, P. Perruchet, and B. Poulin-Charronnat (Experimental Psychology, 2013, vol. 60, pp. 269–278).

    Science.gov (United States)

    Gast, Anne

    2014-01-01

    In the musical Stroop task, which has recently been introduced by Grégoire, Perruchet, and Poulin-Charronat (2013), participants respond to note names that are placed inside musical notes. Musicians respond more slowly to note names that are incongruent with the note than to note names that are congruent with the note. Grégoire et al. propose to use this task to study the acquisition of automaticity by relating musical Stroop effects to the amount of musical experience. I discuss some caveats that have to be considered for these types of analyses. Specifically, I focus on how different contingencies in the learning situation relate to the Stroop effect and on the question whether a long-term perspective is suitable for studying the acquisition of automaticity.

  18. Chemical studies of elements with Z ≥ 104 in liquid phase

    Energy Technology Data Exchange (ETDEWEB)

    Nagame, Yuichiro, E-mail: nagame.yuichiro@jaea.go.jp [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan); Kratz, Jens Volker [Institut für Kernchemie, Johannes Gutenberg-Universität Mainz, Fritz-Straßmann-Weg 2, 55128 Mainz (Germany); Schädel, Matthias [Advanced Science Research Center, Japan Atomic Energy Agency (JAEA), Tokai, Ibaraki 319-1195 (Japan)

    2015-12-15

    Recent studies of the chemical separation and characterization experiments of the first three transactinide elements, rutherfordium (Rf), dubnium (Db), and seaborgium (Sg), conducted atom-at-a-time in liquid phases, are reviewed. A short description on experimental techniques based on partition methods, specifically automated rapid chemical separation systems, is also given. A newly developed experimental approach to investigate single atoms of the heaviest elements with an electrochemical method is introduced. Perspectives for liquid-phase chemistry experiments on heavier elements are briefly discussed.

  19. Opõtõ analititsheskogo tshtenija : "Russkije nots'i" V. Odojevskogo, "Ussomnivs'iisja Makar" A. Platonova / Jelena Grigorjeva

    Index Scriptorium Estoniae

    Grigorjeva, Jelena, 1959-

    1999-01-01

    Bibl. lk. 268-269. Kokkuvõte inglise k. " Analytical reading: "Russkie nochi" by V. Odoyevsky. "Usomnivschijsja Makar" by A. Platonov, lk. 269. Kokkuvõte eesti k. "Analüütilise lugemise kogemus: V. Odojevski "Vene ööd". A. Platonovi "Kahtleja Makar", lk. 269-270

  20. Opõtõ analititsheskogo tshtenija : "Russkije nots'i" V. Odojevskogo, "Ussomnivs'iisja Makar" A. Platonova / Jelena Grigorjeva

    Index Scriptorium Estoniae

    Grigorjeva, Jelena, 1959-

    1999-01-01

    Bibl. lk. 268-269. Kokkuvõte inglise k. " Analytical reading: "Russkie nochi" by V. Odoyevsky. "Usomnivschijsja Makar" by A. Platonov, lk. 269. Kokkuvõte eesti k. "Analüütilise lugemise kogemus: V. Odojevski "Vene ööd". A. Platonovi "Kahtleja Makar", lk. 269-270

  1. A Female Urinary Diversion Device for Military Women in the Deployed Environment

    Science.gov (United States)

    2016-10-27

    COVERED (From - To) 1 July 2012 -31 May 2016 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER N/A A Female Urinary Diversion Device... Freedom (OEF) were recruited from an SRC. They were randomly assigned to the IG (n = 61) or CG (n = 33). Of the 61 military women randomized to... Contract : 10245 - A Female Urinary Diversion Device for Militar Award Amount: 188,269.00 Total Estimated: 188,269.00 Total Funded: 188,269.00 Category

  2. The multitudinous creativity of the contemporary capitalisms

    Directory of Open Access Journals (Sweden)

    Ionuț Bârliba

    2015-12-01

    Full Text Available Creative Capitalism, Multitudinous Creativity, Radicalities and Alterities, Edited by Giuseppe Cocco and Barbara Szaniecki, Lexington Books, Lanham. Boulder. New York. London, 2015, 269p.

  3. Drug: D03362 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03362 Drug Trafermin (genetical recombination) (JAN); Trafermin (USAN/INN); Fiblas...rmides 269 Miscellaneous 2699 Others D03362 Trafermin (genetical recombination) (JAN); Trafermi

  4. 32 CFR 32.52 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... obtaining financial information from recipients: (1) SF-269 9 or SF-269A, 10 Financial Status Report. (i) Do... standards in § 32.21, additional pertinent information to further monitor awards may be obtained upon... 32 National Defense 1 2010-07-01 2010-07-01 false Financial reporting. 32.52 Section 32.52...

  5. Gclust Server: 110850 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 110850 DME_CG7178_24642963 Cluster Sequences - 269 wupA: wings up A CG7178-PG, isof... to cluster sequences Cluster Sequences Link to related sequences - Sequence length 269 Representative annotation wupA: wings

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-0691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0691 ref|YP_001398481.1| L-fucose permease [Campylobacter jejuni subsp.... doylei 269.97] gb|ABS44031.1| L-fucose permease [Campylobacter jejuni subsp. doylei 269.97] YP_001398481.1 1e-82 48% ...

  7. Cholinesterase Structure: Identification of Residues and Domains Affecting Organophosphate Inhibition and Catalysis

    Science.gov (United States)

    1998-04-01

    269-274, 1997. ISSN 0006-2952/97/$17.00 + 0.00 "© 1997 Elsevier Science Inc . All rights reserved. PII S0006-2952(97)00180-9 ELSEVIER Mutant...potential candidates for pre- or post-exposure treatment for OP toxicity. BIOCHEM PHARMACOL 54;2:269-274, 1997. © 1997 Elsevier Science Inc . KEY WORDS

  8. EST Table: FS935695 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS935695 E_FL_fwgP_43M16_F_0 10/09/28 37 %/269 aa ref|XP_970577.1| PREDICTED: similar to ganglios...006132 10/09/10 n.h 10/09/10 37 %/269 aa gi|91078536|ref|XP_970577.1| PREDICTED: similar to ganglioside-indu

  9. Hydrographic characteristics and circulation in the Caribbean Sea during April and May 1990

    Digital Repository Service at National Institute of Oceanography (India)

    PrasannaKumar, S.; Murty, V.S.N; Khan, A.A; Jones, M.A; Wagh, A; Desai, B.N

    stream_size 12 stream_content_type text/plain stream_name Caribb_Mar_Stud_2_69.pdf.txt stream_source_info Caribb_Mar_Stud_2_69.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  10. 20 CFR 435.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Financial reporting. 435.52 Section 435.52... ORGANIZATIONS Post-Award Requirements Reports and Records § 435.52 Financial reporting. (a) Authorized forms... financial information from recipients: (1) SF-269 or SF-269A, Financial Status Report. (i) SSA...

  11. 22 CFR 145.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial reporting. 145.52 Section 145.52....52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial...

  12. 41 CFR 105-72.602 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Financial reporting. 105... § 105-72.602 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A,...

  13. Drug: D08405 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available SYSTEM N06 PSYCHOANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD AND NOOTROPICS N06BX Other psychostimu...D08405 Drug Pramiracetam (INN) C14H27N3O2 269.2103 269.3831 D08405.gif Nootropic; Psychostimu

  14. Bioecology of subtidal region

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A

    stream_size 2 stream_content_type text/plain stream_name Mar_Archaeol_2_69.pdf.txt stream_source_info Mar_Archaeol_2_69.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  15. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models.

  16. 75 FR 64165 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-10-19

    ... Approximately 265 feet +269 City of Kenedy. downstream of South 2nd Street. Ojo de Agua Creek Approximately 1... 860 feet +287 upstream of the confluence with Tributary 9 to Ojo de Agua Watershed. San Antonio...

  17. Moral pluralism on the trolley tracks: Different normative principles are used for different reasons in justifying moral judgments

    National Research Council Canada - National Science Library

    Büsra Aktas; Onurcan Yilmaz; Hasan G Bahçekapili

    2017-01-01

    ...), psychopathy and real-world utilitarianism in three Turkish samples. In Study 1 (n = 269), we used four ethical dilemmas and asked participants to select one normative principle as the grounds for their judgment in the dilemma...

  18. EST Table: FY019993 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 4 44 %/306 aa gnl|Amel|GB14482-PA 11/11/04 52 %/269 aa gi|91094825|ref|XP_971125.1| PREDICTED: similar to werner helicase interacting protein [Tribolium castaneum] BY928125 bmov ...

  19. Novel therapies for coeliac disease

    National Research Council Canada - National Science Library

    Sollid, L. M; Khosla, C

    2011-01-01

    ...) Novel therapies for coeliac disease (Symposium). J Intern Med 2011; 269 : 604–613. Coeliac disease is a widespread, lifelong disorder for which dietary control represents the only accepted form of therapy...

  20. Aldolase blood test

    Science.gov (United States)

    ... pancreatic, or prostate cancer Muscle disease such as dermatomyositis , muscular dystrophy , polymyositis Swelling and inflammation of the ... Saunders; 2016:chap 269. Vleugels RA, Callen JP. Dermatomyositis. In: Lebwohl MG, Heymann WR, Berth-Jones J, ...

  1. Lurking: a challenge or a fruitful strategy? A comparison between lurkers and active participants in an online corporate community of practice

    NARCIS (Netherlands)

    Mirjam, Neelen; Sibren, Fetter

    2011-01-01

    Neelen, M., & Fetter, S. (2010). Lurking: a challenge or a fruitful strategy? A comparison between lurkers and active participants in an online corporate community of practice. International Journal of Knowledge and Learning, 6(4), 269-284.

  2. Significance of uniaxial and hydrostatic pressure studies on ancient oceanic rocks in tectonics

    Digital Repository Service at National Institute of Oceanography (India)

    Sarma, K.V.L.N.S.; Ramana, Y.V.

    showed the lowest value of compressive strength (45 MPa) and pyroxenite gave the highest value (269 MPa), while meta volcanics exhibited narrow limits of 58 to 245 MPa. Standard correlations were obtained for compressive strength to G/P ratio...

  3. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Guam.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 22-26 September 2003 (JD 265-269) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Guam Island in...

  4. Investigación internacional en marketing turístico: análisis de contenido sobre temas y metodologías

    National Research Council Canada - National Science Library

    Bigné Alcañiz, J. Enrique; Andreu Simó, Luisa; Sánchez García, Isabel; Alvarado Herrera, Alejandro

    2008-01-01

    ...) to analyse the methodological approach employed in the papers, content analysis has been conducted focused on 269 marketing oriented papers published in the main international tourist journals in the period 2004-2006...

  5. Influence of plasma density and plasma sheath dynamics on the ion implantation by plasma immersion technique

    OpenAIRE

    Ensinger, Wolfgang

    1996-01-01

    Influence of plasma density and plasma sheath dynamics on the ion implantation by plasma immersion technique / B. Rauschenbach ... - In: Nuclear instruments and methods in physics research. B. 113. 1996. S. 266-269

  6. Flood-frequency characteristics of Wisconsin streams

    Science.gov (United States)

    Krug, W.R.; Conger, D.H.; Gebert, W.A.

    1993-01-01

    Flood-frequency characteristics for 269 gaged sites on Wisconsin streams are presented for recurrence intervals of 2 to 100 years. Annual flood peaks for the period of record for each gaged site are included.

  7. A new record of the freshwater jellyfish Craspedacusta sowerbii Lankester, 1880 (Hydrozoa) in Southeastern Anatolia (Turkey)

    Science.gov (United States)

    Bekleyen, Aysel; Varol, Memet; Gokot, Bulent

    2011-03-01

    We report the first record of the invasive freshwater jellyfish Craspedacusta sowerbii Lankester in Kralkizi Dam Lake, Southeastern Anatolia, Turkey. The medusa was found only in August, 2008 when average surface water temperatures were 26.9°C.

  8. NIHSeniorHealth

    Medline Plus

    Full Text Available ... next Play now What Are Advance Directives? - Duration: 2 minutes, 55 seconds. 15,269 views 2 years ... now Preparing for the End of Life - Duration: 2 minutes, 33 seconds. 5,069 views 3 years ...

  9. Download - Metabolonote | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available download 4 Analytical Method (M) metabolonote_analytical_method.zip (269 KB) Simple search and download 5 D...ad 6 Analytical Method Details (MS) metabolonote_analytical_method_details.zip (73 KB) Simple search and dow

  10. 2285-IJBCS-Article-Paroiso Moussiliou Noèl

    African Journals Online (AJOL)

    hp

    Education for Health in Developing Countries. (DCs) allowed to list ... knowledge, attitudes, beliefs, values, self- efficacy ... latrines, drinking water availability, proximity ... the effectiveness of hygiene measures, peers .... Secondary school. 26,9.

  11. Sinus Headaches

    Science.gov (United States)

    ... Evaluation and management of "sinus headache" in the otolaryngology practice. Otolaryngology Clinics of North America. 2014;47:269. Sinusitis. ... et al. Why the confusion about sinus headache? Otolaryngology Clinics of North America. 2014;47:169. Sinus ...

  12. A new record of the freshwater jellyfish Craspedacusta sowerbii Lankester, 1880 (Hydrozoa) in Southeastern Anatolia (Turkey)

    Institute of Scientific and Technical Information of China (English)

    Aysel BEKLEYEN; Memet VAROL; Bulent GOKOT

    2011-01-01

    We report the first record of the invasive freshwater jellyfish Craspedacusta sowerbii Lankester in Kralkizi Dam Lake, Southeastern Anatolia, Turkey. The medusa was found only in August, 2008 when average surface water temperatures were 26.9℃.

  13. Kodanik / Luciano Canfora ; tõlk. Kattri Türk

    Index Scriptorium Estoniae

    Canfora, Luciano

    2001-01-01

    Linnriikide poliitilised süsteemid ja sotsiaal-majanduslikud raamid. Lisad: Herodotos. Ajalugu, III, 80-82 ; Ateena kodakondsuse andmine samostlastele ; Plutarchos Periklesest ; Pseudo-Xenophon. Ateena riigikord, II ; Aristoteles. Poliitika, 126-269 ; Thukidides II, IV

  14. Kodanik / Luciano Canfora ; tõlk. Kattri Türk

    Index Scriptorium Estoniae

    Canfora, Luciano

    2001-01-01

    Linnriikide poliitilised süsteemid ja sotsiaal-majanduslikud raamid. Lisad: Herodotos. Ajalugu, III, 80-82 ; Ateena kodakondsuse andmine samostlastele ; Plutarchos Periklesest ; Pseudo-Xenophon. Ateena riigikord, II ; Aristoteles. Poliitika, 126-269 ; Thukidides II, IV

  15. 3Tesla MRI surface coil: Is it sensitive for prostatic imaging??

    African Journals Online (AJOL)

    Mahmoud Agha

    2014-01-30

    Jan 30, 2014 ... anemia, bone aches, with or without pathologic fracture, and neurologic deficits from spinal ..... mic prostate cancer on DWI.18. Application of .... 269:1 159–166. 8. Johannes G, Korporaal, Cornelis AT, van den Berg, Jeukens.

  16. Environmentally Friendly Cleaners for Removing Tar from Metal Surfaces

    Science.gov (United States)

    2009-04-01

    800.544.0133 Phone: 269.382.0133 Fax: 269.382.0214 email: sales@beaverresearch.com 57A Degreaser Diethanolamine, Aliphatic (D-60) Solvent Naphtha , Medium...Fax: (718) 748-3425 General Information Email: info@kleenallplus.com #408 Tar & Asphalt Remover #141 Vehicle wash Petroleum naphtha , Ethylene...Xylene-ortho Solvent, Light aromatic, Naphtha (petroleum) Removes tar from metal surfaces. 19 Sentinel Products, Inc. 51 NE 77th Ave Minneapolis

  17. Etiology of sexually transmitted infections among street-based female sex workers in Dhaka, Bangladesh.

    Science.gov (United States)

    Rahman, M; Alam, A; Nessa, K; Hossain, A; Nahar, S; Datta, D; Alam Khan, S; Amin Mian, R; Albert, M J

    2000-03-01

    An etiological study of sexually transmitted infections (STIs) was conducted among female sex workers (FSWs) in Dhaka, Bangladesh. Endocervical swab and blood samples from 269 street-based FSWs were examined for Neisseria gonorrhoeae, Chlamydia trachomatis, and Trichomonas vaginalis as well as for antibodies to Treponema pallidum and herpes simplex virus 2 (HSV-2). Sociodemographic data and data regarding behavior were also collected. A total of 226 of the 269 FSWs (84%) were positive for the STI pathogens studied. Among the 269 FSWs, 35.5% were positive for N. gonorrhoeae, 25% were positive for C. trachomatis, 45.5% were positive for T. vaginalis, 32.6% were seropositive for T. pallidum, 62.5% were seropositive for HSV-2, and 51% had infections with two or more pathogens.

  18. Changes in oxidation indices and minor components of low free fatty acid and freshly extracted crude palm oils under two different storage conditions.

    Science.gov (United States)

    Tan, Choon-Hui; Ariffin, Abdul A; Ghazali, Hasanah M; Tan, Chin-Ping; Kuntom, Ainie; Choo, Adrian Cheng-Yong

    2017-06-01

    This article reports on the changes of oxidation indices and minor components of low free fatty acid (FFA) and freshly extracted crude palm oils after storage at ambient (28 ± 1 C) and 60 C for 77 days. The changes in peroxide value (PV), FFA, extinction coefficient at 233 and 269 nm (K233 and K269), bleachability index (DOBI), carotene and vitamin E contents were monitored. PV, FFA, K233 and K269 of both oil samples increased as storage progressed while the values of carotene and vitamin E contents decreased. At the end of storage period at 60 °C, the carotene content of low FFA crude palm oil was 4.24 ppm. The storage conditions used led to the loss of entire vitamin E fractions of both oil samples as well as a reduction in DOBI values except for freshly extracted crude palm oil stored at ambient temperature.

  19. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 5, (Ashton, Rhode Island-Sinclair, Wyoming).

    Science.gov (United States)

    1984-01-01

    RAYTHEON COMPANY 31 31 RGN CONSTRUCTION CO INC 1,368 1,368 SILVERTON CONSTRUCTION CO INC 74 74 SOUTHWESTERN BELL TELE CO 900 900 SILVAN SERVICE SORP 285 265...SANDERS ASSOCIATES INC 269 269 SANDERS MC CALL 66 66 SANTA FE ENGINEERS INC 164 164 SERAPHIN TEST MEASURE CO 35 35 SILVERTON CONSTRUCTION CO INC 7,976...GRAND PRAIRIE 󈧐,774 9,470 424 12,386 828 9,664 GRANGER SILVERTON CONSTRUCTION CO INC 25 25 GRAPEVINE BOYD W R INC 353 353 0 & R CONSTRUCTION 71 71

  20. Drug: D08305 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08305 Drug Orphenadrine (INN); Mialgin (TN) C18H23NO 269.178 269.3813 D08305.gif A... Gastric acid secretion map07220 Cholinergic and anticholinergic drugs USP drug classification [BR:br08302] ...Skeletal Muscle Relaxants Orphenadrine D08305 Orphenadrine (INN) Target-based cla...scarinic cholinergic receptor [HSA:1128 1129 1131 1132 1133] [KO:K04129 K04130 K04131 K04132 K04133] Orphenadrine D0830...5 Orphenadrine (INN) CAS: 83-98-7 PubChem: 96024992 DrugBank: DB01173 LigandBox: D0830

  1. Arginine of retinoic acid receptor beta which coordinates with the carboxyl group of retinoic acid functions independent of the amino acid residues responsible for retinoic acid receptor subtype ligand specificity.

    Science.gov (United States)

    Zhang, Zeng Ping; Hutcheson, Juliet M; Poynton, Helen C; Gabriel, Jerome L; Soprano, Kenneth J; Soprano, Dianne Robert

    2003-01-15

    The biological actions of retinoic acid (RA) are mediated by retinoic acid receptors (RARalpha, RARbeta, and RARgamma) and retinoid X receptors (RXRalpha, RXRbeta, and RXRgamma). Consistent with the X-ray crystal structures of RARalpha and RARgamma, site-directed mutagenesis studies have demonstrated the importance of a conserved Arg residue (alphaArg(276), betaArg(269), and gammaArg(278)) for coordination with the carboxyl group of RA. However, mutation of Arg(269) to Ala in RARbeta causes only a 3- to 6-fold increase in the K(d) for RA and EC(50) in RA-dependent transcriptional transactivation assays while the homologous mutation in either RARalpha or RARgamma causes a 110-fold and a 45-fold increase in EC(50) value, respectively. To further investigate the nature of this difference, we prepared mutant RARs to determine the effect of conversion of betaR269A to a mutant which mimics either RARalpha ligand selectivity (betaA225S/R269A) or RARgamma ligand selectivity (betaI263M/R269A/V338A). Our results demonstrate that in RARbeta mutants that acquire either RARalpha or RARgamma ligand specificity the Arg(269) position responsible for coordination with the carboxyl group of retinoids continued to function like that of RARbeta. Furthermore, three mutant receptors (betaA225S/R269A, betaA225S/F279, and alphaF286A) were found to have a greater than wild-type affinity for the RARalpha-selective ligand Am580. Finally, a homology-based computer model of the ligand binding domain (LBD) of RARbeta and the X-ray crystal structures of the LBD of both RARalpha and RARgamma are used to describe potential mechanisms responsible for the increased affinity of some mutants for Am580 and for the difference in the effect of mutation of Arg(269) in RARbeta compared to its homologous Arg in RARalpha and RARgamma.

  2. NCBI nr-aa BLAST: CBRC-TTRU-01-1012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1012 ref|ZP_04645702.1| putative teichoic acid/polysaccharide export protein [Lactobacillus... jensenii 269-3] ref|ZP_04676439.1| predicted protein [Lactobacillus jensenii 1153] ref...|ZP_05866216.1| predicted protein [Lactobacillus jensenii SJ-7A-US] gb|EEQ24315.1| putative teichoic acid/po...lysaccharide export protein [Lactobacillus jensenii 269-3] gb|EEQ67708.1| predicted protein [Lactobacillus... jensenii 1153] gb|EEX26848.1| predicted protein [Lactobacillus jensenii SJ-7A-US] ZP_04645702.1 0.034 23% ...

  3. Drug: D08485 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08485 Drug Rizatriptan (INN); Maxalt (TN) C15H19N5 269.164 269.3449 D08485.gif Ant...OUS SYSTEM N02 ANALGESICS N02C ANTIMIGRAINE PREPARATIONS N02CC Selective serotonin (5HT1) agonists N02CC04 Rizatriptan D08485 Rizatri...) 1b/1d Receptor Agonists Rizatriptan D08485 Rizatriptan (INN) Target-based class...ptan [ATC:N02CC04] D08485 Rizatriptan (INN) 5-HT1D-receptor [HSA:3352] [KO:K04153] Rizatriptan... [ATC:N02CC04] D08485 Rizatriptan (INN) CAS: 144034-80-0 PubChem: 9602

  4. Peptide sequences of glycoprotein G-2 discriminate between herpes simplex virus type 2 (HSV-2) and HSV-1 antibodies.

    OpenAIRE

    Levi, M.; Rudén, U; Wahren, B.

    1996-01-01

    The complete herpes simplex virus type 2 envelope glycoprotein G was represented by overlapping synthetic peptides. Herpes simplex virus type 2-specific human seroreactivities were mainly seen against three peptides, peptides G2-64, G2-69, and G2-70, located in the C-terminal part of glycoprotein G. This is, interestingly, a region which has strong homology between herpes simplex virus types 1 and 2. G2-69 was the most herpes simplex virus type 2-specific peptide, reacting with 93% (13 of 14)...

  5. 导航有专攻——宇达电通Mio DiqiWalker PND

    Institute of Scientific and Technical Information of China (English)

    王炳晨

    2006-01-01

    GPS导航应用是近几年来国内消费市场成长最快的几大热点之一.随之而来的一个全新的概念——PNO(Portable Navlgation Devices,便携导航设备)也逐渐被我们所熟识。而所谓业有专攻.Mio DigiWalker PND(型号为269.以下简称Mio269)就是一台经过优化后的专用PND。

  6. Personality and Gender Differences in Friendship Needs and Experiences in Preadolescence and Young Adulthood

    Science.gov (United States)

    Zarbatany, Lynne; Conley, Ryanne; Pepper, Susan

    2004-01-01

    Personality and gender differences in close same-sex friendship needs and experiences were investigated in two samples. Participants were 312 university students (217 women, M age = 19.5) and 491 preadolescents (269 girls, M age = 11.87). Participants completed several questionnaires yielding scores for communion and agency (personality), communal…

  7. A Study of Promotion and Attrition of Mid-Grade Officers in the U.S. Marine Corps: Are Assignments a Key Factor?

    Science.gov (United States)

    2005-03-01

    Vincent Van Gogh This is not the end. It is not even the beginning of the end. But...usc_sup_01_10.html] accessed January 2005. Van Gogh , Vincent , Letter 237, The Hague, 22 October 1882 [http://www.vangoghgallery.com/letters/269_V

  8. Does visual impairment lead to additional disability in adults with intellectual disabilities?

    NARCIS (Netherlands)

    Sjoukes, L.; Koot, H. M.; Kooijman, A. C.; Evenhuis, H.

    2009-01-01

    This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with observant-based questi

  9. Observing purchase-related parent-child communication in retail environments: A developmental and socialization perspective

    NARCIS (Netherlands)

    Buijzen, M.A.; Valkenburg, P.M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N= 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent–child comm

  10. Observing purchase-related parent-child communication in retail environments: a developmental and socialization perspective

    NARCIS (Netherlands)

    Buijzen, M.; Valkenburg, P.M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N= 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent-child comm

  11. New Soliton-like Solutions and Multi-soliton Structures for Broer-Kaup System with Variable Coefficients

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    By using the further extended tanh method [Phys. Lett. A 307 (2003) 269; Chaos, Solitons & Fractals 17(2003) 669] to the Broer-Kaup system with variable coefficients, abundant new soliton-like solutions and multi-soliton-like solutions are derived. Based on the derived multi-soliton-like solutions which contain arbitrary functions, some interesting multi-soliton structures are revealed.

  12. Comparison of the PSC-17 and Alternative Mental Health Screens in an At-Risk Primary Care Sample

    Science.gov (United States)

    Gardner, William; Lucas, Amanda; Kolko, David J.; Campo, John V.

    2007-01-01

    Objective: To validate the 17-item version of the Pediatric Symptom Checklist (PSC-17) as a screen for common pediatric mental disorders in primary care. Method: Patients were 269 children and adolescents (8-15 years old) whose parents completed the PSC-17 in primary care waiting rooms. Children were later assessed using the Schedule for Affective…

  13. Knowledge and use of emergency contraception by medical doctors ...

    African Journals Online (AJOL)

    Knowledge and use of emergency contraception by medical doctors on internship in ... while about a quarter (26.9%) routinely counsel women about ECP use. ... We recommend that in.service training should focus more on EC to improve the ...

  14. Rotation of the solenoid magnet of the CMS experiment before the insertion into its cryostat

    CERN Multimedia

    Patrice Loiez

    2005-01-01

    At one side of the 27 km ring of the future Large Hadron Collider (LHC), the 230 tonne solenoid magnet for the CMS experiment has been rotated through 90° prior to insertion into its cryostat - the jacket that will cool the magnet to 4.2 K (-269° C).

  15. Recovery rates, serotypes, and antimicrobial susceptibility patterns of Salmonellae isolated from cloacal swabs of wild Nile crocodiles (Crocodylus niloticus) in Zimbabwe

    DEFF Research Database (Denmark)

    Madsen, Mogens; Hangartner, P.; West, K.

    1998-01-01

    Samples from the cloaca and the ventral skin surface of 67 Nile crocodiles (Crocodylus niloticus) captured in four uninhabited areas at Lake Kariba, Zimbabwe, were cultured for Salmonella. All the skin samples tested negative for Salmonella, whereas 18 of 67 (26.9%) cloacal samples grew Salmonell...

  16. Isolation and expression of the Pneumocystis carinii thymidylate synthase gene

    DEFF Research Database (Denmark)

    Edman, U; Edman, J C; Lundgren, B;

    1989-01-01

    The thymidylate synthase (TS) gene from Pneumocystis carinii has been isolated from complementary and genomic DNA libraries and expressed in Escherichia coli. The coding sequence of TS is 891 nucleotides, encoding a 297-amino acid protein of Mr 34,269. The deduced amino acid sequence is similar...

  17. Maternal Emotional Distress, Abuse Risk, and Children's Symptoms: Child Gender as a Moderator of Parent Sensitivity as a Mediator

    Science.gov (United States)

    Zimmer-Gembeck, Melanie J.; Thomas, Rae; Hendrickson, Kym; Avdagic, Elbina; Webb, Haley; McGregor, Leanne

    2013-01-01

    Mothers' distress is a correlate of their children's elevated behaviour problems and symptoms. Parenting practices have been shown to mediate these associations, but few studies have observed parenting or focused on parents at risk of child abuse. In this study of 269 high-risk mothers and their young children (M?=?4.2?years), structural…

  18. Anti-platelet aggregation of mixtures of betulinic oleanolic and ...

    African Journals Online (AJOL)

    exhibited low cytotoxic effect on both HEK293 cells (IC50: 724.43, 269.08 and 407.89 mg/mL respectively) and .... suspended in a small volume of suspending buffer (0.4 mM ..... reported to selectively inhibit myeloid leukemia. (HL-60) cell line ...

  19. AFRREV IJAH, Vol.3 (1) January, 2014

    African Journals Online (AJOL)

    Toshiba

    2014-01-09

    Jan 9, 2014 ... his highly scholarly book, Democracy and Prebendal Politics in ... 1942:269 cited in Joseph, 1991:19) or cancelling an election result and ... But, first, let us quickly go to the basic issue ... some degree of freedom of communication and ... making of Rousseau's social contract also means that the government.

  20. Dicty_cDB: VFJ482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pid:none) Asterionella glacialis MAT mRNA fo... 266 4e-72 ( P50304 ) RecName: Ful...... 269 1e-72 (Q9FPL6) RecName: Full=S-adenosylmethionine synthetase 2; ... 266 2e-72 AB461922_1( AB461922 |

  1. Patients' Assessment of Pharmacists' Medication Counseling in a ...

    African Journals Online (AJOL)

    Erah

    Managing therapy, 1.87 ± 0.89 and 2.46 ± 0.78, and Communication, 2.23 ± 0.77 and 2.69 ± 0.62, respectively. ... behaviour, and evaluate the reliability of an instrument to ..... out if you understand the advice he .... World Health Organization.

  2. Methodology For The System Integration Of Adaptive Resilience In Armor

    Science.gov (United States)

    2016-09-01

    achieved in an externally reconfigurable fashion; however, this would not make sense because this would create a vulnerability in the armor protection that...complex operating environment, systems engineering, system integration, engineering resilience, resilience theory 15. NUMBER OF PAGES 269 16...each step of the methodology. This methodology makes possible many new applications for integrating adaptive resilience technological systems. These

  3. OUGENE

    DEFF Research Database (Denmark)

    Pan, Xiaoyong; Shen, Hong-Bin

    2016-01-01

    -expression and various diseases. In this study, we presented a comprehensive disease-associated over- and under-expressed gene database (OUGene) based on our proposed text mining pipeline and several open curated databases. It contains total 41,269 unique associations between 7,238 over- or under-expressed genes and 1...

  4. The Event-Related Brain Potential as an Index of Information Processing and Cognitive Activity: A Program of Basic Research.

    Science.gov (United States)

    1986-02-20

    element deflection of the stick to the right produced a clock- proportional to the movement of the control stick. wise rotation of the cursor at an angular ...tasks in patients with alexia without agraphia. In D. Lehmann & E. Callaway (Eds.), Human Evoked Potentials, Plenum, New York, pp. 269-283. Pfefferbaum

  5. 77 FR 10962 - Flazasulfuron; Pesticide Tolerances

    Science.gov (United States)

    2012-02-24

    ... or on fruit, citrus, group 10 at 0.01 parts per million (ppm); grapes at 0.01 ppm; and sugarcane at 0... 26.9 parts per billion (ppb) for surface water and 102 ppb for ground water. EDWCs of flazasulfuron and its degradates for chronic exposures for non-cancer assessments are estimated to be 4.67 ppb for...

  6. Approaching Resistance to Targeted Inhibition of PI3K in Breast Cancer

    Science.gov (United States)

    2011-10-01

    2002; Arteaga 2006; Tornillo and Terracciano 2006). Notably, the most frequently deregulated component of the pathway downstream of PI3K is the...protein kinase which phosphorylates and activates protein kinase Balpha. Curr Biol 7:261–269 Arteaga CL (2006) EGF receptor mutations in lung cancer: from

  7. Does Anger Regulation Mediate the Discrimination-Mental Health Link among Mexican-Origin Adolescents? A Longitudinal Mediation Analysis Using Multilevel Modeling

    Science.gov (United States)

    Park, Irene J. K.; Wang, Lijuan; Williams, David R.; Alegría, Margarita

    2017-01-01

    Although prior research has consistently documented the association between racial/ethnic discrimination and poor mental health outcomes, the mechanisms that underlie this link are still unclear. The present 3-wave longitudinal study tested the mediating role of anger regulation in the discrimination-mental health link among 269 Mexican-origin…

  8. Taking a Reading/Writing Intervention for Secondary English Language Learners on the Road: Lessons Learned from the Pathway Project

    Science.gov (United States)

    Olson, Carol Booth; Land, Robert

    2008-01-01

    These two recipients of this year's Alan C. Purves Award reflect on their work (reported in "RTE" Vol. 41, No. 3, pp. 269-303) on "A Cognitive Strategies Approach to Reading and Writing Instruction for English Language Learners in Secondary School" and the lessons they learned from their original research study as they tried to replicate the…

  9. A Professional Learning Program Designed to Increase K-12 Teachers' Instructional Technology Use

    Science.gov (United States)

    Spencer, Lisa A.

    2014-01-01

    Despite the ready availability of many instructional-technology resources, many teachers in the researched Maryland school district are uncomfortable using technology to deliver content. This concurrent mixed methods case study examined the impact of Sharing Technology with Educators Program (STEP) on 269 K-12 teachers' technology use. The study…

  10. Drug: D08987 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8987.gif Treatment of ulcerative colitis [nicotinic receptor agonist] nicotinic cholinergic receptor alpha4b...D08987 Drug Rivanicline galactarate (USAN) (C10H14N2)2. C6H10O8 534.269 534.6019 D0

  11. InterPro search result: AK072398 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072398 J023078O17 IPR011014 Mechanosensitive channel MscS, transmembrane superfam...ily SSF82861 Mechanosensitive channel protein MscS (YggB), transmembrane region T269-353 1.8e-11 ...

  12. Exchange of regions of the carboxypeptidase Y propeptide. Sequence specificity and function in folding in vivo

    DEFF Research Database (Denmark)

    Ramos, C; Winther, Jakob R.

    1996-01-01

    The propeptide of carboxypeptidase Y from Saccharomyces cerevisiae is important for folding of the enzyme. Previous work [Ramos, C., Winther, J.R. & Kielland-Brandt, M. C. (1994) J. Biol. Chem. 269, 7006-7012] suggested that the sequences essential for in vivo folding were situated in the COOH...

  13. The Influence of Social Capital on Individual Health : Is it the Neighbourhood or the Network?

    NARCIS (Netherlands)

    Mohnen, Sigrid M.; Volker, Beate; Flap, Henk; Subramanian, S. V.; Groenewegen, Peter P.

    2015-01-01

    We examined the influence of both individual and neighbourhood social capital on individual health and analysed whether effects of one type of social capital are contingent upon the other. The Dutch 'Housing and Living Survey' (WoON 2006, n = 53,269) was used and combined with information on neighbo

  14. Drug: D04810 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04810 Drug Potash soap (JP16); Potash soap (TN) Therapeutic category: 2359 2662 26...an agents 235 Purgatives, clysters 2359 Others D04810 Potash soap (JP16) 26 Epidermides 266 Emollients 2662 ...Alkaline agents D04810 Potash soap (JP16) 269 Miscellaneous 2699 Others D04810 Potash soap (JP16) PubChem: 17398179 ...

  15. AcEST: DK960111 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ct: 6 KDITMKNDE-SQEEEIP-----------DQFLCCVCLELLYKPIVLSCGHLSCFWCVHKS 53 Query: 189 MNAFTASSCPLCRRPFIYFPRVCKLLH...= 41/82 (50%), Gaps = 3/82 (3%) Frame = +3 Query: 93 ESLTCSICLELLYKPVVTACGHMFCFWC---GHQGMNAFTASSCPLCRRPFIYFP... = +3 Query: 42 RDESLPVSSVGLCKEAMESLTCSICLELLYKPVVTACGHMFCFWCGHQGMNAFTASSCPL 221 ... = 35/62 (56%) Frame = +3 Query: 42 RDESLPVSSVGLCKEAMESLTCSICLELLYKPVVTACGHMFCFWCGHQGMNAFTA...ps = 5/74 (6%) Frame = +3 Query: 105 CSICLELLYKPVVTACGHMFCFWCGHQGMNAFTASSCPLCR---RPFIYFPRVC--KLLH 269 CS+C+

  16. Bullying Victims: The Effects Last into College

    Science.gov (United States)

    Adams, Frank D.; Lawrence, Gloria J.

    2011-01-01

    This study examined whether those bullied in schools continued to show the effects of being bullied after they enrolled in an institution of higher education. There were 269 undergraduate students participating in the study. Previous studies (2006; 2008) conducted by the authors suggested the effects of bullying upon both the victim and bully are…

  17. Lateral Reaction Jet Flow Interaction Effects on a Generic Fin-Stabilized Munition in Supersonic Crossflows

    Science.gov (United States)

    2013-11-01

    269–275. 9. Stahl, B.; Edmunds , H.; Gulhan, A. Experimental Investigation of Hot and Cold Side Jet Interaction With a Supersonic Cross Flow...LICHTENBERG-SCANLAN G MALEJKO T RECCHIA C STOUT W TOLEDO J TRAVAILLE E VAZQUEZ C WILSON 4 PM CAS (PDF) M BURKE R KIEBLER

  18. Ignition, Combustion and Tuning of Nanocomposite Thermites

    Science.gov (United States)

    2010-01-01

    oxygen and nitrogen, the thermal conductivity as a function of temperature is given in Incropera and DeWitt144 up to 3000 K, and we extrapolate it...Meeting, 1998; 1998. 143. M. L. Hobbs; M. R. Baer; B. C. McGee, Propellants, Explosives, Pyrotechnics 1999, 24, (5), 269-279. 144. F. P. Incropera ; D

  19. Gclust Server: 81915 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 81915 DME_CG31496_24644809 Cluster Sequences Related Sequences(255) 269 CG31496: CG...31496-PA 1 1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 81915 Cluster ID 81915 Sequence ID DME_CG31496_24644809 Li

  20. radiation-related eye diseases among welders of suame

    African Journals Online (AJOL)

    User

    “Magazine” in the Kumasi metropolis were enrolled for the study. Methods employed in the ex- ... Repeated exposure of the eyes to UV radiation. (UVR) causes both short-term eye ... men and 121 (26.9%) women constituted the control group.

  1. Dicty_cDB: VSI526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of HSP's gapped (non-prelim): 0 length of query: 43 length of database: 80,480,566 effective HSP length: 16 effective length of query... Number of successful extensions: 1489304 Number of sequences better than 10.0: 0 Length of query: 43 Length... of database: 104,622,809,269 Length adjustment: 21 Effective length of query: 22

  2. 76 FR 4348 - Labor-Management Cooperation Grant Program Information Collection Request

    Science.gov (United States)

    2011-01-25

    ...), Accounting System and Financial Capability Questionnaire (LM-3), Request for Advance or Reimbursement SF-270 (LM- 6), Financial Status Report SF-269a (LM-7), Project Performance (LM-8), and Grants Program... estimated time per response is 60 minutes. The Accounting System and Financial Capability Questionnaire (LM...

  3. Steady-State Kinetics of Br(2P 1/2) yields CO2(101) Electronic-to-Vibrational Energy Transfer Laser System.

    Science.gov (United States)

    2011-07-21

    Bomem Michelson Interferometer Fourier Spectrometer, and are depicted in Figures 3-2 and 3-3. Transmittance [%] 100 2.69 50 0- 2.0 3.0 4.0 5.0...calibration. Ar+ pump laser power is tracked by two Hamamatsu model S228 1 silicon photodiodes attached to Oriel fiber optic cables. In each case, signal is

  4. Exploiting Chemical Libraries, Structure, and Genomics in the Search for Kinase Inhibitors

    NARCIS (Netherlands)

    Gray, Nathanael S.; Wodicka, Lisa; Thunnissen, Andy-Mark W.H.; Norman, Thea C.; Kwon, Soojin; Espinoza, F. Hernan; Morgan, David O.; Barnes, Georjana; LeClerc, Sophie; Meijer, Laurent; Kim, Sung-Hou; Lockhart, David J.; Schultz, Peter G.

    1998-01-01

    Selective protein kinase inhibitors were developed on the basis of the unexpected binding mode of 2,6,9-trisubstituted purines to the adenosine triphosphate-binding site of the human cyclin-dependent kinase 2 (CDK2). By iterating chemical library synthesis and biological screening, potent inhibitors

  5. Individual Differences in Trajectories of Emotion Regulation Processes: The Effects of Maternal Depressive Symptomatology and Children's Physiological Regulation

    Science.gov (United States)

    Blandon, Alysia Y.; Calkins, Susan D.; Keane, Susan P.; O'Brien, Marion

    2008-01-01

    Trajectories of emotion regulation processes were examined in a community sample of 269 children across the ages of 4 to 7 using hierarchical linear modeling. Maternal depressive symptomatology (Symptom Checklist-90) and children's physiological reactivity (respiratory sinus arrhythmia [RSA]) and vagal regulation ([delta]RSA) were explored as…

  6. Phonological Awareness Development as a Discrete Process: Evidence for an Integrative Model

    Science.gov (United States)

    Cassady, Jerrell C.; Smith, Lawrence L.; Putman, S. Michael

    2008-01-01

    The theoretical and practical implications of examining young children's acquisitions of phonological awareness skills with specific and differentiated processing tasks are explored in this study. The study presents data from 269 kindergarten children completing a phonological awareness protocol that provided information on 14 discrete…

  7. The Antiaircraft Journal. Volume 92, Number 5, September-October 1949

    Science.gov (United States)

    1949-10-01

    Strategic PIns. Gp., Rm. 2E269, Pentagon. Wash. 25, D. C. French. A. J., Tunnel Rd., Santa Barbara , Calif. French. Paul H .. KG Bureau, The Pentagon, Wash...Peterson, Capers L., 119 1fontague Ave., Greenwood, S. C. Peterson, 1. A, 4817 Keswick Rd .. Baltimore 10. 1fd. Phillips. A. J,’ Jr., 3401 Centenary

  8. Disease: H00950 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available of five patients from three Italian families. Eur J Pediatr 154:835-9 (1995) PMID:20190753 (description, gen...ents with ARC syndrome. J Pediatr Gastroenterol Nutr 48:348-54 (2009) PMID:16492441 (description) Bull LN, M...stasis, and renal dysfunction but without arthrogryposis: incomplete ARC syndrome phenotype. J Pediatr 148:269-71 (2006) ...

  9. Gclust Server: 86666 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 86666 Ccr_CC_0530 Cluster Sequences Related Sequences(269) 501 sensor histidine kin...ase 1 9.98e-01 0.0 0.0 0.0 0.0 3.23 0.0 Show 86666 Cluster ID 86666 Sequence ID Ccr_CC_0530 Link to cluster

  10. Age estimation of brown shrimp

    NARCIS (Netherlands)

    Campos, J.; Bio, A.; Freitas, V.; Moreiro, C.; van der Veer, H.W.

    2013-01-01

    In this study, 2 methods for age estimation of Crangon crangon were compared: one based on total length, the other based on the number of segments in the antennules, as suggested by Tiews’ findings (1954: Ber Deut Wiss Kommiss 13:235-269). Shrimps from populations near the species’ geographic edges,

  11. Recovery rates, serotypes, and antimicrobial susceptibility patterns of Salmonellae isolated from cloacal swabs of wild Nile crocodiles (Crocodylus niloticus) in Zimbabwe

    DEFF Research Database (Denmark)

    Madsen, Mogens; Hangartner, P.; West, K.

    1998-01-01

    Samples from the cloaca and the ventral skin surface of 67 Nile crocodiles (Crocodylus niloticus) captured in four uninhabited areas at Lake Kariba, Zimbabwe, were cultured for Salmonella. All the skin samples tested negative for Salmonella, whereas 18 of 67 (26.9%) cloacal samples grew Salmonell...

  12. Regionalism and Secession

    Science.gov (United States)

    2015-03-01

    Sobre Cataluña (Madrid: Los Libros de la Catarata, 2014), 112. 269 Ibid. 60 autonomy and not independence.270 Catalan nationalists, aided by the media...de Escritos Sobre Cataluña. Madrid: Los Libros de la Catarata, 2014. Domorenok, Ekaterina,. “The Committee of the Regions: In Search of Identity

  13. Public perception of the Antarctic Wilderness: Surveys from an educated, environmentally knowledgeable European community

    Science.gov (United States)

    Tina Tin; Kees Bastmeijer; Jessica O' Reilly; Patrick Maher

    2011-01-01

    In 2007 and 2008, students from Tilburg University (the Netherlands) collected 269 responses on a questionnaire about Antarctica and its management. Respondents in the Netherlands clearly supported protecting Antarctica as a wilderness, and acknowledged Antarctica's importance as part of the global climate system and as a science laboratory for the benefit of...

  14. Sexually dimorphic secretion of cortisol but not catecholamines in response to an endotoxin challenge in beef cattle

    Science.gov (United States)

    This study was designed to determine the effect of endotoxin (lipopolysaccharide; LPS) challenge on secretion of the adrenal stress-related hormones cortisol, epinephrine, and norepinephrine in bull and heifer calves. Brahman calves (n = 12; 269 ± 11.7 kg) were randomly selected from the fall 2007 c...

  15. Integrating Professional Development across the Curriculum: An Effectiveness Study

    Science.gov (United States)

    Ciarocco, Natalie J.; Dinella, Lisa M.; Hatchard, Christine J.; Valosin, Jayde

    2016-01-01

    The current study empirically tested the effectiveness of a modular approach to integrating professional development across an undergraduate psychology curriculum. Researchers conducted a two-group, between-subjects experiment on 269 undergraduate psychology students assessing perceptions of professional preparedness and learning. Analysis…

  16. Observing purchase-related parent-child communication in retail environments: A developmental and socialization perspective

    NARCIS (Netherlands)

    Buijzen, M.A.; Valkenburg, P.M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N= 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent–child

  17. Observing purchase-related parent-child communication in retail environments: a developmental and socialization perspective

    NARCIS (Netherlands)

    Buijzen, M.; Valkenburg, P.M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N= 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent-child

  18. Dicty_cDB: VSD761 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of extensions: 0 Number of successful extensions: 0 Number of sequences better than 10.0: 0 Number of HSP's better... 357 Number of sequences better than 10.0: 0 Length of query: 146 Length of database: 104,622,809,269 Length

  19. X-ray crystal structure of divalent metal-activated ß-xyloisdase, RS223BX

    Science.gov (United States)

    We report the first X-ray structure of a glycoside hydrolase family 43 ß-xylosidase, RS223BX, which is strongly activated by the addition of divalent metal cations. The 2.69 Å structure reveals that the Ca2+ cation is located at the back of the active site pocket. The Ca2+ coordinates to H274 to sta...

  20. Oktoober oli kasumiteenimise kuu / Fredy-Edwin Esse ; kommenteerinud Kristjan Hänni

    Index Scriptorium Estoniae

    Esse, Fredy-Edwin

    2010-01-01

    Nii Tallinna kui ka Vilniuse börs kuulusid oktoobris maailma kümne enim tõusnud aktsiaturu hulka, Tallinna börs on viimase nelja kuu jooksul kasvanud 26,9%. Kõige rohkem tõusis oktoobris Shanghai börs. Kallinemisest toorainete turul

  1. Data of evolutionary structure change: 1AIGN-1AIJS [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIG n>N 1AI...RO CA 208 LEU CA 267 ALA CA 286 LYS CA 269 ...n> 1AIJ n>S 1AIJS...1AIGN-1AIJS 1AIG 1AIJ N S ------------ALLSFERKYRVPGGTL-------VGGN...LFDFWVGPFYVGFFGVATFFFAALGIILIAWSAVLQGTWNPQ-------LISVYPPALEYGLGG-APLAKGGLWQIITICATGAFVSWALREVEICRKLGIGYHIPFAFAFAI

  2. Dicty_cDB: Contig-U06978-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6.B7_E10 GQ036 - Shoot tip - Active growth ... 54 9e-07 3 ( DV985998 ) GQ0206.B3_K24 GQ020: Clean ROOTS systems -Diurnal...987310 ) GQ0206.TB_K24 GQ020: Clean ROOTS systems -Diurnal... 54 1e-06 3 >( AU269

  3. 76 FR 77716 - Alternate Passenger Rail Service Pilot Program

    Science.gov (United States)

    2011-12-14

    ... Federal Railroad Administration 49 CFR Part 269 RIN 2130-AC19 Alternate Passenger Rail Service Pilot... proceeding to develop a pilot program that permits a rail carrier or rail carriers that own infrastructure... develops this pilot program in conformance with the statutory directive. DATES: This final rule is...

  4. Dicty_cDB: Contig-U11764-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6e-77 EF689770_1( EF689770 |pid:none) Placocarpus schaereri isolate AFTO... 291 6e-77 DQ973049_1( DQ973049 ... RecName: Full=DNA-directed RNA polymerase II subunit RP... 269 3e-70 DQ883743_1( DQ883743 |pid:none) Coccoca

  5. Gender Ratio in Dyslexia.

    Science.gov (United States)

    Miles, T. R.; Haslum, M. N.; Wheeler, T. J.

    1998-01-01

    A study involving 11,804 British children (age 10) found that when specified criteria for dyslexia were used, 269 children qualified as dyslexic. These included 223 boys and 46 girls, for a ratio of 4.51 to 1. Difficulties in interpreting these data are discussed and a defense of the criteria is provided. (Author/CR)

  6. Social Support and Well-Being at Mid-Life among Mothers of Adolescents and Adults with Autism Spectrum Disorders

    Science.gov (United States)

    Smith, Leann E.; Greenberg, Jan S.; Seltzer, Marsha Mailick

    2012-01-01

    The present study investigated the impact of social support on the psychological well-being of mothers of adolescents and adults with ASD (n = 269). Quantity of support (number of social network members) as well as valence of support (positive support and negative support) were assessed using a modified version of the "convoy model" developed by…

  7. Dicty_cDB: Contig-U04831-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 ( AU072048 ) Dictyostelium discoideum slug cDNA, clone SSD269. 418 e-118 2 ( AC156755 ) Carollia perspicil...lata clone 417E12, WORKING DRAF... 52 0.040 1 ( AC154931 ) Carollia perspicillata clone 577H2, WORKING DRAFT

  8. Detection of Breast Microcalcifications Under Ultrasound Using Power Doppler and Acoustic Resonance Imaging

    Science.gov (United States)

    2003-07-01

    2241 010511 imaging, including magnetic resonance Radiology 2002; 224:265-269 Calcium carbonate particles embed- imaging, scintigraphy , and...characterize calcifications. digitized M-mode images: gestational dif- ways feasible because calcifications can- ferences of fetal lung . Ultrasound Med Biol

  9. Decreased Wound Neutrophils and Indiscrete Margination in the Pathogenesis of Wound Infection

    Science.gov (United States)

    1985-08-01

    response of neutrophils to infusion of saline the first 3 hours after injury. By 4 hours, infiltration of solution, N- formyl -L-methionyl-leucyl-L-phenylala...PA: Oxygen radical dependent lung damage following thermal injury of rat skin, J Trauma between the neutrophil and endothelium? 23:269-77, 1983 Dr

  10. Domain Modeling: NP_008881.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_008881.2 chrX Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP (...Form 1) c1px2b_ chrX/NP_008881.2/NP_008881.2_holo_113-417.pdb blast 188H,225K,267V,269K,273A,274H,275S,276G,

  11. Drug: D03283 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03283 Mixture, Drug Cadexomer iodine (USAN); Iodine - cadexomer mixt; Iodosorb (TN... Epidermides 269 Miscellaneous 2699 Others D03283 Cadexomer iodine (USAN) Anatomi...OF WOUNDS AND ULCERS D03A CICATRIZANTS D03AX Other cicatrizants D03AX01 Cadexomer iodine D03283 Cadexomer iodine (USAN) CAS: 94820-09-4 PubChem: 17397435 ...

  12. Drug: D04812 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04812 Mixture, Drug Sucrose - povidone iodine mixt; Sorenurse (TN) Sucrose [DR:D00...8301] 2 Agents affecting individual organs 26 Epidermides 269 Miscellaneous 2699 Others D04812 Sucrose - povidone iodine mixt PubChem: 17398181 ...

  13. Effect of Herbal Immunodulator on Body weight gain in immunosuppressed broiler birds

    Directory of Open Access Journals (Sweden)

    S.G. Mode

    Full Text Available The herbal immunomodulator was evaluated in immunosupressed broiler birds in terms of body weight gain. The treatment with Ocimum sanctum and Emblica officinalis @ 3 gm /kg feed for 2 weeks were found to be effective immunomodulator in increasing body weight gain in broiler birds. [Vet World 2009; 2(7.000: 269-270

  14. Coagulopathy and Shock on Admission is Associated with Mortality for Children with Traumatic Injuries at Combat Support Hospitals

    Science.gov (United States)

    2012-01-01

    trauma in an austere combat envi- ronment. Crit Care Med 2008; 36:S293–S296 6. Creamer KM, Edwards MJ, Shields CH, et al: Pediatric wartime admissions...Effect of stored-blood transfusion on oxygen delivery in patients with sepsis. JAMA 1993; 269:3024–3029 32. Fitzgerald RD, Martin CM, Dietz GE, et

  15. Armed Services Vocational Aptitude Battery (ASVAB): The Equity of ASVAB Form 14 in the Prediction of High School Course Grades

    Science.gov (United States)

    1990-08-01

    1Q84 1985 Snrr-re (Fthnirity not tpqted) Slope Differences for Sex 7 8 .1715 .1571 .01436 1 155 2.69 Intercept riffcrcnce, for Sex 2 9 .1571 .1194...Sex 8 9 .2986 .1890 .10962 1 196 30.63 * Biology I - II 1Q84 - 1985 Senior (Ethnicity z White & Black) (Sex not tested) Slope Differences for Ethnicity

  16. Social Intelligence and Communication Competence: Predictors of Students' Intercultural Sensitivity

    Science.gov (United States)

    Bosuwon, Takwa

    2017-01-01

    This study investigated the level of intercultural sensitivity of foreign international undergraduates and its possible predictors. Sample participants included 269 foreign international undergraduates of both government and private universities in Thailand. The research instrument was the three-page survey constructed questionnaire based on the…

  17. 'FIFA 11 for Health' for Europe. 1

    DEFF Research Database (Denmark)

    Fuller, Colin W; Ørntoft, Christina Øyangen; Larsen, Malte Nejst;

    2016-01-01

    AIM: To modify the 'FIFA 11 for Health' programme to the European situation, and to assess its effects on health knowledge and well-being in Danish school children. METHOD: A two-cohort study with seven intervention and two control schools. Of the 546 Danish children (boys 269; girls 277) of mean...

  18. Distribution of the mRNA for protein phosphatase T in rat brain

    NARCIS (Netherlands)

    Becker, W; Buttini, M; Limonta, S; Boddeke, H; Joost, HG

    1996-01-01

    We have recently cloned a novel protein serine/threonine phosphatase (PPT) from rat mRNA which is predominantly expressed in the brain (Becker et al., J. Biol. Chem., 269 (1994) 22586-22592). In the present study, the regional distribution of PPT mRNA in the brain of adult rats was characterized by

  19. Climate Change and Maize Production: Empirical Evidence from ...

    African Journals Online (AJOL)

    Michael Madukwe

    Adaptation Strategies to Climate Change by Food Crop Farmers in Oke-Ogun Area of South ..... Labour availability is being reduced due to climate change. 26.9 35.6 ... forced to permanently change the type of crops being grown, as time goes ...

  20. 75 FR 62425 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-10-08

    ... identified by name by the International Trade Commission as a member of a domestic industry in an... section 222 has not been met. TA-W No. Subject firm Location Impact date 73,983 Apria Healthcare, Redmond... City, NC Industries, Inc. 73,269 Grand Manor Furniture, Lenoir, NC Leased Workers Accuforce...

  1. Racial Differences in the Determinants of Living Arrangements of Widowed and Divorced Elderly Women.

    Science.gov (United States)

    Choi, Namkee G.

    1991-01-01

    Analyzed within-racial group differences in the determinants of living arrangements of widowed white (n=1,807), widowed nonwhite (n=269), divorced white (n=684), and divorced nonwhite (n=126) elderly women. Results indicated race was not just one explanatory variable but was the second most and the most crucial explanatory variable for widows and…

  2. Why and how people engage in social comparison while learning social skills in groups.

    NARCIS (Netherlands)

    Buunk, Abraham (Bram); Cohen-Schotanus, J; Nek, R.H.

    This study was conducted among 269 medical students who participated in educational training groups. Self-evaluation was the most important motive to engage in social comparison with other group members, followed by, respectively, self-enhancement and self-improvement. Upward comparisons (i.e., with

  3. Regulation of MDM2 Activity by Nucleolin

    Science.gov (United States)

    2007-06-01

    assistance with FACS analysis, Eric Rubin (UMDNJ) for providing the GST-nucleolin expression vectors, Cris- tina Cardoso for the pENeGFP RPA34 plasmid, and...formation, and functional char- acterization. J. Biol. Chem. 269:11121–11132. 25. Huang, W., and R. L. Erikson . 1994. Constitutive activation of Mek1

  4. 77 FR 14832 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-03-13

    ... Corporation, Ball Packaging Corporation, leased workers from Kelly Services. 81,269 Cummins Filtration, A... Corporation, Water Suffolk, VA......... January 30, 2011. Solutions, Nextsource, Inc.. 81,286 CHF Industries............ February 1, 2011. Texas Division, Adecco and Its Quest. 81,301 Massachusetts Mutual Life Springfield, MA...

  5. 77 FR 12885 - Millstone Power Station, Units 1, 2 and 3, Dominion Nuclear Connecticut, Inc.; Exemption

    Science.gov (United States)

    2012-03-02

    ... Background Dominion Nuclear Connecticut, Inc. (DNC or the licensee) is the holder of Facility Operating... pursuant to 10 CFR 26.9, DNC, doing business as Dominion, requested an exemption from the requirements of... otherwise in the public interest. Therefore, the Commission hereby grants DNC an exemption from...

  6. A Hollow Army in the 21st Century: Will History Repeat Itself?

    Science.gov (United States)

    2012-03-22

    America’s First Battles 1776-1965, 269. 15 Douglas McGregor . Don’t Waste a Drawdown Online. Armed Forces Journal (February 2012): http...General Douglas MacArthur summarized the personnel shortages dramatically, declaring: “In many cases there is but one officer on duty with an entire

  7. Dicty_cDB: Contig-U05111-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e from clone CH211-269M1 in ... 34 0.004 7 ( AC226639 ) Lama pacos clone CH246-29... DNA sequence from clone DKEY-145J6 in l... 38 0.083 4 ( AC232666 ) Lama pacos clone CH246-243P10, WORKING D

  8. Taking a Reading/Writing Intervention for Secondary English Language Learners on the Road: Lessons Learned from the Pathway Project

    Science.gov (United States)

    Olson, Carol Booth; Land, Robert

    2008-01-01

    These two recipients of this year's Alan C. Purves Award reflect on their work (reported in "RTE" Vol. 41, No. 3, pp. 269-303) on "A Cognitive Strategies Approach to Reading and Writing Instruction for English Language Learners in Secondary School" and the lessons they learned from their original research study as they tried to replicate the…

  9. ETHIOPIA

    African Journals Online (AJOL)

    Organic matter contents of the Awassa contaminated surface soils ranges from medium (2.69%) to ... Akaki, chromium and nickel contents of the contaminated soils have reached the “toxic levels” .... or through biodegradation. All the above are ...

  10. The Short Form Luria-Nebraska Neuropsychological Battery in Assessment of Dementia.

    Science.gov (United States)

    McCue, Michael; And Others

    This study sought to determine whether a short form of the Luria-Nebraska Neuropsychological Battery could discriminate between senile dementia of the Alzheimer's type and depression in a sample of elderly neuropsychiatric patients. The short form Luria-Nebraska includes 141 of the 269 items contained in the original version, with the Rhythm scale…

  11. EST Table: NM_001173331 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available on) 10/09/29 76 %/269 aa ref|NP_001139700.1| abdominal B isoform RBL [Bombyx mori] dbj|BAH30152.1| Abdomin...al-B [Bombyx mori] 10/09/13 41 %/237 aa FBpp0281793|DpseGA11117-PA 10/08/29 low hom

  12. Molecular analysis of myophosphorylase deficiency in Dutch patients with McArdle's disease.

    NARCIS (Netherlands)

    Martin, M.A.; Rubio, J.C.; Wevers, R.A.; Engelen, B.G.M. van; Steenbergen-Spanjers, G.C.H.; Diggelen, O.P. van; Visser, M. de; Die-Smulders, C.E.M. de; Blazquez, A.; Andreu, A.L.; Arenas, J.

    2004-01-01

    We report on 8 Dutch patients with McArdle's disease from 6 unrelated families. Molecular analysis revealed the presence of four previously described mutations: the common R49X mutation, the IVS14+1G>A mutation and the recently reported R269X and Y84X nonsense mutations; and two new molecular def

  13. Domain Modeling: NP_065137.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_065137.1 chr11 NMR Study of the Fibrillin-1 cbEGF12-13 Pair of Ca2+ Binding Epid...ermal Growth Factor-like Domains c1lmja_ chr11/NP_065137.1/NP_065137.1_holo_269-351.pdb psi-blast 540G,541T,

  14. AcEST: DK950361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available I Leucine-rich repeat protein OS=x Citrofortunella mitis Align length 65 Score (b...INSENSITIVE 1-associated ... 93 8e-18 >tr|Q84N26|Q84N26_9ROSI Leucine-rich repeat protein OS=x Citrofortunel

  15. Observing Purchase-Related Parent-Child Communication in Retail Environments: A Developmental and Socialization Perspective

    Science.gov (United States)

    Buijzen, Moniek; Valkenburg, Patti M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N = 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent-child communication (i.e., children's purchase influence…

  16. Analytical Method (M) - Metabolonote | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available le File name: metabolonote_analytical_method.zip File URL: ftp://ftp.biosciencedbc.jp/archive/metabolonote/LATEST/metabolonote_analyt...://togodb.biosciencedbc.jp/togodb/view/metabolonote_analytical_method#en Data acquisition method - Data anal...ical_method.zip File size: 269 KB Simple search URL http

  17. Does Visual Impairment Lead to Additional Disability in Adults with Intellectual Disabilities?

    Science.gov (United States)

    Evenhuis, Heleen M.; Sjoukes, L.; Koot, H. M.; Kooijman, A. C.

    2009-01-01

    Background: This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). Method: In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with observant-based questionnaires, prior to expert…

  18. Does visual impairment lead to additional disability in adults with intellectual disabilities?

    NARCIS (Netherlands)

    Sjoukes, L.; Koot, H. M.; Kooijman, A. C.; Evenhuis, H.

    This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with observant-based

  19. Oktoober oli kasumiteenimise kuu / Fredy-Edwin Esse ; kommenteerinud Kristjan Hänni

    Index Scriptorium Estoniae

    Esse, Fredy-Edwin

    2010-01-01

    Nii Tallinna kui ka Vilniuse börs kuulusid oktoobris maailma kümne enim tõusnud aktsiaturu hulka, Tallinna börs on viimase nelja kuu jooksul kasvanud 26,9%. Kõige rohkem tõusis oktoobris Shanghai börs. Kallinemisest toorainete turul

  20. Does Built Environment Matter to Early Adolescents' Physical Activity?

    Science.gov (United States)

    Lin, Jen-Jia; Ting, Tzu-Cheng

    2014-01-01

    This study examined the relationship of built environments to physical activity among adolescents aged 12 to 14 years old. The study sample included 269 junior high school students studying in Nangang District, Taipei, Taiwan. Sample physical activity data were obtained by surveying adolescents using a self-administered short version of the…

  1. 43 CFR 12.952 - Financial reporting.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Financial reporting. 12.952 Section 12.952... Requirements § 12.952 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or...

  2. 7 CFR 3430.56 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial reporting. 3430.56 Section 3430.56... reporting. (a) SF-269, Financial Status Report. Unless stated differently in the award terms and conditions... requirement. (f) Additional reporting requirements. CSREES may require additional financial...

  3. Role of Zinc in the Pathogenesis of Prostate Cancer

    Science.gov (United States)

    2005-09-01

    the regulation of prostate by its similarity to zinc transporters recently character- cell growth. ized in fungi and plants. hZIP2 is a member of the...reveals altered metabolite content in gression of prostate malignancy. Oncology 59: 269-282. malignant prostate tissue. Anticancer Res 17: 1455-1460. 914

  4. Test-Retest Stability and Concurrent Validity of Two Reading Tests with a Drug-Abusing Population.

    Science.gov (United States)

    Johnson, Mark E.; Fisher, Dennis G.; Rhodes, Fen; Booth, Robert

    1996-01-01

    The Wide Range Achievement Test-Revised and the Woodcock Reading Mastery Tests-Revised were administered twice to 269 current drug abusers over an average time interval of 204.2 days. Overall, the study demonstrates that the two instruments have strong psychometric properties and that results from current drug abusers are reliable. (SLD)

  5. 75 FR 41517 - Notice of Availability of the Draft Environmental Impact Statement for the Proposed Over The RiverTM

    Science.gov (United States)

    2010-07-16

    ....blm.gov/co/st/en/fo/rgfo/planning/otr.html . E-mail: co_otr_comments@blm.gov . Fax: (719) 269-8599... approximately 56 acres (acreage includes visitor facilities) and a 4,000-square-foot warehouse/office building. Upon project completion, the warehouse would be donated to a public agency or deconstructed and...

  6. 38 CFR 43.23 - Period of availability of funds.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Period of availability of funds. 43.23 Section 43.23 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS... with the submission of the annual Financial Status Report (SF-269). The Federal agency may extend...

  7. 78 FR 4766 - Adoption of Updated EDGAR Filer Manual

    Science.gov (United States)

    2013-01-23

    ... COMMISSION 17 CFR Parts 232, 239, 249, 269, 274 Adoption of Updated EDGAR Filer Manual AGENCY: Securities and...) Filer Manual and related rules to reflect updates to the EDGAR system. The revisions are being made...: Effective Date: January 23, 2013. The incorporation by reference of the EDGAR Filer Manual is approved...

  8. Cellular Therapy to Obtain Rapid Endochondral Bone Formation

    Science.gov (United States)

    2009-02-01

    NUMBER 6. AUTHOR(S) Elizabeth A. Olmsted-Davis, Ph.D., Alan R. Davis, Ph.D., Michael Heggeness M.D., 5d. PROJECT NUMBER Jennifer West, Ph.D., Francis...and vascular endothelium to skeletal development. Dev Biol 269(1):55-69. 2. Maes C, Stockmans I, Moermans K, Van Looveren R, Smets N, Carmeliet P

  9. Drug: D04372 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 99 4199 an extract from hemolysed blood of young cattle Therapeutic category of drugs in Japan [BR:br08301] 2 Agent...29 Others D04372 Deproteinized serum 26 Epidermides 269 Miscellaneous 2699 Others D04372 Deproteinized serum 4 Agent

  10. Research

    African Journals Online (AJOL)

    abp

    age ≥37 weeks and birth weight ≥2500g recruited in an inner-city maternity hospital in Lagos, Nigeria. Primary .... prolonged/obstructed labor had 2.69-fold increased risk of SCBU ... The findings on early-onset sepsis, hyperbilirubinemia and low five- ... driven by economic reasons to continue with their business.

  11. Data of evolutionary structure change: 1AFCF-1Z4SB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /entryIDChain> LYCSN-GHFLR >EEE - EEE> F 1AFCF LYCSNGGYFLR ...>EEE EEEE> ATOM 4951 CA LEU F 14 61.269 21.921 ...ID> B 1Z4SB YIKST-TGQYL ...>EEE - EE> ATOM 1583 CA TYR B 55 50.017 14.254 20.934 1.

  12. Experiment list: SRX367451 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available e Diagnosis=Glioma 24276847,81.9,0.6,269 GSM1250287: LN229-SOX4; Homo sapiens; ChIP-Seq source_name=LN229 human glioblastoma... cell line with SOX4 overexpression || cell line=LN229 glioblastoma cell line || genotype/va

  13. What Motivates Municipal Employees: A Comparison Study of Supervisory vs. Non-Supervisory Personnel.

    Science.gov (United States)

    Jurkiewicz, Carole L.; Massey, Tom K., Jr.

    1997-01-01

    Municipal employees (n=269) ranked 15 motivational factors. Supervisors were significantly dissatisfied with about half; nonsupervisory workers were satisfied with only one. The latter expressed less interest in learning new things, benefitting society, and having autonomy and more interest in advancement, security, exercising leadership, and…

  14. Women, Rape, and War: ’Gaining Redress within A Human Rights Framework’

    Science.gov (United States)

    1993-12-01

    state with them." " 3Slavenka, Drakulic , "Women Behind a Wall of Silence," Nation, 1 Mar 93, p. 269. 18 "We feel that we have lost everything...34 Journal of Social Issues, Vol. 48, No.1, 1992. Drakulic , Slavenka, "Women Behind a Wall of Silence," The Nation, 1 March 1993. Drozdiak, William, "Serbs

  15. Bayesian and Non-Bayesian Evidential Updating

    Science.gov (United States)

    1985-01-01

    American Mathematical Society 46, 763-774. Koopman, Bernard 0., (1940), The Axioms and Algebra of Intuitive Probability," Annals of Mathematics 41, 269-292...Koopman, Bernard 0., (1941), "Intuitive Probabilities and Sequences," Annals of Mathematics 42, 169-187. 41 Kyburg, Henry E., Jr., (1961

  16. Fundamentals and Bioengineering of Enzymatic Fuel Cells. Part 1. Bioengineering of Enzymes as Electrocatalysts

    Science.gov (United States)

    2012-01-31

    Knowles, P. F.; Mcpherson, M. J. Journal of Biological Chemistry 1994.269,25095-25105. (36) Betancor, L.; Fuentes , M.; Dellamora- Ortiz, G.; Lopez...the energy computation. A total of 48,150 rotamers were finally obtained. Combinatorial Optimization of Protein Sequence A standard Monte Carlo

  17. Sequential Testing of Hypotheses Concerning the Reliability of a System Modeled by a Two-Parameter Weibull Distribution.

    Science.gov (United States)

    1981-12-01

    the variance of point estimators are given by Mendenhall and Scheaffer (Ref 17:269), for both biased and unbiased estimations. In addition to this...Weibull Distribution. Thesis, Wright-Patterson AFB, Ohio: Air Force Institute of Technology, December 1980. 17. Mendenhall, W. and R. L. Scheaffer

  18. Validation of models in an imaging infrared simulation

    CSIR Research Space (South Africa)

    Willers, C

    2007-10-01

    Full Text Available 5147,?4February1994,pp.641-646.Elsevier. [6]D.E. Thompson,Verification,Validation,andSolution?Quality inComputationalPhysics:CFDMethodsappliedtoIceSheet Physics,NASAAmesResearchCenter,MailStop269-1, MoffettField,CA 94035-1000. [7]I...

  19. Does visual impairment lead to additional disability in adults with intellectual disabilities?

    NARCIS (Netherlands)

    Sjoukes, L.; Koot, H. M.; Kooijman, A. C.; Evenhuis, H.

    2009-01-01

    This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with observant-based questi

  20. Distribution of the mRNA for protein phosphatase T in rat brain

    NARCIS (Netherlands)

    Becker, W; Buttini, M; Limonta, S; Boddeke, H; Joost, HG

    1996-01-01

    We have recently cloned a novel protein serine/threonine phosphatase (PPT) from rat mRNA which is predominantly expressed in the brain (Becker et al., J. Biol. Chem., 269 (1994) 22586-22592). In the present study, the regional distribution of PPT mRNA in the brain of adult rats was characterized by

  1. Domain Modeling: NP_006452.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_006452.3 chr17 TROPOMYOSIN CRYSTAL STRUCTURE AND MUSCLE REGULATION. APPENDIX. CO...NSTRUCTION OF AN ATOMIC MODEL FOR TROPOMYOSIN AND IMPLICATIONS FOR INTERACTIONS WITH ACTIN c2tmab_ chr17/NP_006452.3/NP_006452.3_apo_6-269.pdb psi-blast 0 ...

  2. New conjugated molecular scaffolds based on [2,2]paracyclophane as electron acceptors for organic photovoltaic cells.

    Science.gov (United States)

    Yang, Yang; Zhang, Guanxin; Yu, Chenmin; He, Chang; Wang, Jianguo; Chen, Xin; Yao, Jingjing; Liu, Zitong; Zhang, Deqing

    2014-09-07

    Two conjugated molecules with a [2,2]paracyclophane core were designed as non-fullerene electron acceptors for photovoltaic cells. Using as the donor, a high power conversion efficiency (2.69%) is achieved for the blending thin film of with , which is relatively high for solution-processed OPVs based on small molecular non-fullerene acceptors and as the electron donor.

  3. Steps/day ability to predict anthropometric changes is not affected by its plausibility

    Science.gov (United States)

    We evaluated whether treating steps/day data for implausible values (30,000) affected the ability of these data to predict intervention-induced anthropometric (waist circumference, body mass index, percent body fat, and fat mass) changes. Data were from 269 African American participants wh...

  4. Participant adherence indicatiors predict changes in blood pressure, anthropometric measures, and self-reported physical activity in a lifestyle intervention: HUB City Steps

    Science.gov (United States)

    Purpose. To evaluate several adherence indicators, created using 2 measures, separately and in combination, for predicting health outcome changes. Design. Non-experimental with pre-post measures. Setting. Mid-sized city in southern region of United States. Subjects. 269 primarily African-America...

  5. TMFunction data: 723 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available entration ... QACC_STAAU (P14319) Helix ... smr protein; transmembrane domain; specificity; drug resistance ...aphylococcus aureus ... Grinius LL, Goldberg EB. J Biol Chem. 1994 Nov 25;269(47):29998-30004. mutagenesis 0.3mM minimal inhibitory conc

  6. TMFunction data: 724 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available ylococcus aureus ... Grinius LL, Goldberg EB. J Biol Chem. 1994 Nov 25;269(47):29998-30004. mutagenesis 3.0mM minimal inhibitory concent...ration ... QACC_STAAU (P14319) Helix ... smr protein; transmembrane domain; specificity; drug resistance

  7. TMFunction data: 725 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available lococcus aureus ... Grinius LL, Goldberg EB. J Biol Chem. 1994 Nov 25;269(47):29998-30004. mutagenesis 2.35mM minimal inhibitory concent...ration ... QACC_STAAU (P14319) Helix ... smr protein; transmembrane domain; specificity; drug resistance

  8. The influence of IS1301 in the capsule biosynthesis locus on meningococcal carriage and disease.

    Directory of Open Access Journals (Sweden)

    Elisabeth Kugelberg

    Full Text Available Previously we have shown that insertion of IS1301 in the sia/ctr intergenic region (IGR of serogroup C Neisseria meningitidis (MenC isolates from Spain confers increased resistance against complement-mediated killing. Here we investigate the significance of IS1301 in the same location in N. meningitidis isolates from the UK. PCR and sequencing was used to screen a collection of more than 1500 meningococcal carriage and disease isolates from the UK for the presence of IS1301 in the IGR. IS1301 was not identified in the IGR among vaccine failure strains but was frequently found in serogroup B isolates (MenB from clonal complex 269 (cc269. Almost all IS1301 insertions in cc269 were associated with novel polymorphisms, and did not change capsule expression or resistance to human complement. After excluding sequence types (STs distant from the central genotype within cc269, there was no significant difference for the presence of IS1301 in the IGR of carriage isolates compared to disease isolates. Isolates with insertion of IS1301 in the IGR are not responsible for MenC disease in UK vaccine failures. Novel polymorphisms associated with IS1301 in the IGR of UK MenB isolates do not lead to the resistance phenotype seen for IS1301 in the IGR of MenC isolates.

  9. Accomplishing Shipyard Work for the United States Navy: Institutions, Systems and Operations. Volume I. Basic Report

    Science.gov (United States)

    1975-08-01

    8217Standard Metropolitan Statistical Areas (SI4SAs) are 269 geographical areas making up the fifty states and Puerto Rico. These areas are defined by the U.S...8217 * (2) Development of revised basing policies to provide I~o ovrhals f telv mothsduration or longer, the Navy has a policy of teprrlycagn tesi ’ home

  10. Florescencia, cosecha, semillas y siembra

    Directory of Open Access Journals (Sweden)

    José Eduardo Rueda Enciso

    1996-05-01

    Full Text Available Las cuatro estaciones. Mitología y estructura social entre los u'wa. Ann Osborn. (traducción de Fabricio Cabrera Micolta. Banco de la República, Museo del Oro, Santafé de Bogotá, 1995, 269 págs., ilus.

  11. Quality of Academic Advising at UNO: Results of Student and Faculty Surveys.

    Science.gov (United States)

    ESS Reports, 1988

    1988-01-01

    This report presents the results of a student/faculty survey on the academic advising process at the University of Nebraska at Omaha, and highlights issues in improving the advising process. The survey included 195 recent graduates, 269 existing students, and 207 faculty and professional advisors. The study found that 70.8% of students were…

  12. Academic Advising at UNO. Report of the 1991 Student Survey.

    Science.gov (United States)

    Crawford, A. E.

    1991-01-01

    A study was done of student perception of academic advising at the University of Nebraska, Omaha (UNO). The study surveyed 638 students who participated in the early registration process for the Fall 1991 semester. Of those students, 269 were men and 369 were women and 8.3 percent were members of a minority group. The study instrument was the…

  13. Molecular diversity of RelA enzyme in marine bacteria- A bioinformatics analysis

    Digital Repository Service at National Institute of Oceanography (India)

    Nath, A.I.V.; Tresa, R.A.T.; Alornekar, A.; Varghese, N.S.

    cloning, nucleotide sequence, and deletion of the relA gene. Journal of Bacteriology. 176 (19), 5949-5957. 5. Gerhard Klebe (2000). Recent developments in structure-based drug design. Journal of Molecular Medicine. 78, 269-281 . 6. Gropp Michal, Strausz...

  14. Project Aprendizaje. Final Evaluation Report 1992-93.

    Science.gov (United States)

    Clark, Andrew

    This report provides evaluative information regarding the effectiveness of Project Aprendizaje, a New York City program that served 269 Spanish-speaking students of limited English proficiency (LEP). The project promoted parent and community involvement by sponsoring cultural events, such as a large Latin American festival. Students developed…

  15. Eliciting a Sensemaking Process from Verbal Protocols of Reverse Engineers

    Science.gov (United States)

    2012-08-01

    processing loop used in pro- gramming artificial agents to interface with an environment (S. Russell & Norvig , 2003), with the addition of a state to...Human factors in computing sys- tems (CHI93) (pp. 269–276). New York, New York, USA: ACM Press. Russell, S., & Norvig , P. (2003). Artificial Intelligence

  16. A General Surface Representation Module Designed for Geodesy

    Science.gov (United States)

    1980-06-01

    quantities at the points P and Q can be shown to equal T a C -Cp C CQ the variance is obtained for Q P ( Heiskanen and Moritz, 1967; p 269 ff.) I’ -14...Report No. 650Z-1, Stanford Electronics Laboratories, Stanford, California. Heiskanen , W. A. and H. Moritz (1967): Physical Geodcsy. W. H. Freeman and

  17. Potential vorticity field in the Bay of Bengal during southwest monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Rao, D.P.

    extent of the wind influence increases from around 200 m in the southern Bay to over 500 m in the central Bay. The effect of freshwater discharge is confined to the shallow depths in the northern parts of the Bay. On the shallower isopycnals ( 26.9 sigma...

  18. 78 FR 22332 - Notice of Quarterly Report (October 1, 2012-December 31, 2012)

    Science.gov (United States)

    2013-04-15

    ... infrastructure. Connectivity Project $269,212,588 Reduce travel cost $267,916,157 Average annual daily and time..., and Travel time from within the region. Guatemala to Honduras through the Northern Zone (hours and... Namibia support. Unique visits on Namibia Tourism Board website. Leisure tourist arrivals. North...

  19. 77 FR 76522 - Notice of Quarterly Report (July 1, 2012-September 30, 2012)

    Science.gov (United States)

    2012-12-28

    ... website. Leisure tourist arrivals. North American tourism businesses (travel agencies and tour operators... benefiting from strategic infrastructure. Connectivity Project $269,212,588 Reduce travel cost $254,561,921... Highway. rest of the Travel time from country, and Guatemala to Honduras within the through the...

  20. InterProScan Result: FS859370 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS859370 FS859370_4_ORF1 7AE8D53E269C5CCA PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 5.6e-12 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  1. Gclust Server: 201771 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201771 Sep_SE_p606 Cluster Sequences - 269 mobilization protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 201...771 Cluster ID 201771 Sequence ID Sep_SE_p606 Link to cluster sequences Cluster Seq

  2. Drug: D08178 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08178 Drug Menbutone (INN); Genabiline [veterinary] (TN) C15H14O4 258.0892 258.269...3 D08178.gif Choleretic veterinary medicine CAS: 3562-99-0 PubChem: 96024868 LigandBox: D08178 NIKKAJI: J8.1

  3. Does Anger Regulation Mediate the Discrimination-Mental Health Link among Mexican-Origin Adolescents? A Longitudinal Mediation Analysis Using Multilevel Modeling

    Science.gov (United States)

    Park, Irene J. K.; Wang, Lijuan; Williams, David R.; Alegría, Margarita

    2017-01-01

    Although prior research has consistently documented the association between racial/ethnic discrimination and poor mental health outcomes, the mechanisms that underlie this link are still unclear. The present 3-wave longitudinal study tested the mediating role of anger regulation in the discrimination-mental health link among 269 Mexican-origin…

  4. Solid Waste Management: A List of Available Literature, October 1972.

    Science.gov (United States)

    Environmental Protection Agency, Cincinnati, OH.

    Listed are 269 solid waste management publications available from the U. S. Environmental Protection Agency (EPA). There are EPA publications reporting on results of the research, development, and demonstrations in progress as authorized by the Solid Waste Disposal Act of 1965. Certain conference proceedings, findings of various commissions and…

  5. Evaluation of the Utility of Static and Adaptive Mesh Refinement for Idealized Tropical Cyclone Problems in a Spectral Element Shallow Water Model

    Science.gov (United States)

    2015-04-09

    of the vortex winds. However, all simulations do a reasonable job at269 capturing the vortex core wind velocity magnitude.270 c. Case 3271 The initial...the National Science Foundation (Division of410 Mathematical Sciences) through program element 121670, and the Air Force Office of Scien -411 tific

  6. Data of evolutionary structure change: 1CERR-3CIFC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERR-3CIFC 1CER 3CIF R C -MKVGINGFGRIGRQVFRILHSRG-VEVALINDLT-DNK...A 322 VAL CA 435 ALA CA 392 LEU CA 459 3CIF... C 3CIFC LYS CA 257 THR CA 269 LEU CA 387 3CIF... C 3CIFC INDPFMDVEYM<

  7. Data of evolutionary structure change: 1CERR-3CIFB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERR-3CIFB 1CER 3CIF R B -MKVGINGFGRIGRQVFRILHSRG-VEVALINDLT-DNK... VAL CA 435 ALA CA 392 LEU CA 459 3CIF... B 3CIFB LYS CA 257 THR CA 269 LEU CA 387 3CIF... B 3CIFB INDPFMDVEYM

  8. Data of evolutionary structure change: 1CERR-3CIFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERR-3CIFA 1CER 3CIF R A -MKVGINGFGRIGRQVFRILHSRG-VEVALINDLT-DNK... VAL CA 435 ALA CA 392 LEU CA 459 3CIF... A 3CIFALYS CA 257 THR CA 269 LEU CA 387 3CIF... A 3CIFA INDPFMDVEYM

  9. The Mobilization of Effort: Sergeants, Patrol Officers, and Productivity in an American Agency.

    Science.gov (United States)

    1982-02-01

    influential L.L. in directing the efforts of their police officer subordinates by virtue of their Lise of (1) small favors: (2) disciplinary rrotect...JAI Press, 209-269. Weick, Karl E. 1974 Edicational organizat ions as loosely coupled systems. Admin1st rat iye Science Quarterly. 21, 1-19. Westley

  10. Department of Clinical Investigation Annual Research Progress Report, FY 1992

    Science.gov (United States)

    1992-09-30

    Kaufinan CR, Carter P1 269-70,1992. Beck RA, Mercado DL, Cardiovascular Effects of Pseudoephedrine in Medically Seguin SM, Controlled Hypertensive...naproxen 500 mg bid for one month. If not tolerated, the subject will use ibuprofen 800 mg tid. All subjects with lateral epicondylitis will wear an

  11. AcEST: BP920562 [AcEST

    Lifescience Database Archive (English)

    Full Text Available V28|A1YV28_9POAL Photosystem I subunit C OS=Pseudoroegneri... 153 6e-36 tr|A1YV26|A1YV26_9POAL Photosystem I...bjct: 61 DFLSVRVYLG 70 >tr|A1YV28|A1YV28_9POAL Photosystem I subunit C OS=Pseudoroe

  12. EST Table: FY017864 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY017864 rbmov20m04 11/11/04 67 %/269 aa ref|XP_970542.1| PREDICTED: similar to brix... 11/11/04 63 %/284 aa gi|91090402|ref|XP_970542.1| PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS825195 bmov ...

  13. 78 FR 45575 - Duke Energy Carolinas, LLC; Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel...

    Science.gov (United States)

    2013-07-29

    ... response to a request submitted by Duke Energy Carolinas, LLC., on August 13, 2012, for the Oconee Nuclear... From the Federal Register Online via the Government Publishing Office ] NUCLEAR REGULATORY COMMISSION [Docket Nos.: 72-1004, 72-40, 50-269, 50-270, 50-287; and NRC-2013- 0135] Duke Energy Carolinas...

  14. Transcriptional Analysis of the bgIP Gene from Streptococcus mutans

    Science.gov (United States)

    2006-04-21

    Lactobacillus plantarum . FEMS Microbiol Lett 2000, 186(2):269-273. 5. Le Coq D, Lindner C, Kruger S, Steinmetz M, Stulke J: New beta- glucoside (bgl) genes in...longisporum [3], Lactobacillus plantarium [4], Bacillus subtilis [5,6], and Streptococcus mutans [7]. All of these organisms rely on the phosphoe

  15. EST Table: NM_001046698 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available NM_001046698 LOC692853 10/09/29 93 %/269 aa ref|NP_001040163.1| ischemia/reperfusio...n inducible protein [Bombyx mori] gb|ABD36179.1| ischemia/reperfusion inducible protein [Bombyx mori] 10/09/

  16. Data of evolutionary structure change: 1DFIC-3FNFD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dmax>3.134373903274536 EVID> 3 3FNF...1DFIC-3FNFD 1DFI 3FNF C D -GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTY...HHHHHHHHHHHHHH EEEEEE HHHHHHHHHHHH HHHHHHHHHHH EEEEE GGG -- ...line>ASP CA 269 ILE CA 348 VAL CA 381 3FNF... D 3FNFD ITDRLPAKAPL

  17. 75 FR 70665 - Proposed Significant New Use Rule for Cobalt Lithium Manganese Nickel Oxide

    Science.gov (United States)

    2010-11-18

    ... AGENCY 40 CFR Part 721 RIN 2070-AB27 Proposed Significant New Use Rule for Cobalt Lithium Manganese...) for the chemical substance identified as cobalt lithium manganese nickel oxide (CAS No. 182442-95-1... substance identified as cobalt lithium manganese nickel oxide (PMN P-04-269; CAS No. 182442-95-1). This...

  18. 75 FR 70583 - Cobalt Lithium Manganese Nickel Oxide; Withdrawal of Significant New Use Rule

    Science.gov (United States)

    2010-11-18

    ... AGENCY 40 CFR Parts 9 and 721 RIN 2070-AB27 Cobalt Lithium Manganese Nickel Oxide; Withdrawal of... Control Act (TSCA) for the chemical substance identified as cobalt lithium manganese nickel oxide (CAS No... cobalt lithium manganese nickel oxide (PMN P-04-269; CAS No. 182442-95-1) at 40 CFR 721.10201 because...

  19. InterProScan Result: NM_001134263 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available NM_001134263 NM_001134263_1_ORF2 F3F49457A02C269A PRINTS PR00249 GPCRSECRETIN 2.6e-...43 T IPR000832 GPCR, family 2, secretin-like Molecular Function: G-protein coupled receptor activity (GO:000

  20. 29 CFR 1910.333 - Selection and use of work practices.

    Science.gov (United States)

    2010-07-01

    ... devices on overhead power transmission or distribution lines are covered by § 1910.269 of this Part, not... paragraph (c)(3)(i)(A) of this section. Note: For voltages normally encountered with overhead power lines.... 6 in. (137 cm). (iii) Vehicular and mechanical equipment. (A) Any vehicle or mechanical...

  1. Facial Model Estimation (FME) Algorithms Using Stereo/Mono Image Sequence

    Science.gov (United States)

    2000-07-01

    aOpto-Electronics & Systems Laboratories, Industrial Technology Research Institute, Chutung, Taiwan 31040 bInstitute of Communication Engineering...34Binocular vision planning with anthropomorphic features for grasping parts by robots," Robotica , vol. 14, pp. 269- 279, 1996 10. T. Nguyen, T. Huang

  2. Energirenovering af større bygninger - metode og proces

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Laustsen, Jacob Birck; Vorre, Mette Havgaard

    ​SBi-anvisning 269 omhandler metode og proces for gennemførelse af energirenoveringsprojekter for større bygninger fra idefase til driftsfase. Større bygninger omfatter etageboliger, bygninger til privat handel- og service samt offentlige institutioner. Anvisningen giver vejledning for de...

  3. Structural and functional changes in a synthetic S5 segment of KvLQT1 channel as a result of a conserved amino acid substitution that occurs in LQT1 syndrome of human.

    Science.gov (United States)

    Verma, Richa; Ghosh, Jimut Kanti

    2010-03-01

    Mutations in various voltage gated cardiac ion channels are the cause of different forms of long QT syndrome (LQTS), which is an inherited arrhythmic disorder marked as a prolonged QT interval on electrocardiogram. Of these LQTS1 is associated with mutations in the gene encoding KCNQ1 (KvLQT1) channel. One responsible mutation, G269S, in the S5 segment of KvLQT1, that affects the proper expression and function of channel protein leads to LQTS1. Our objective was to study how G269S mutation interferes with the structure and function of a synthetic S5 segment of KvLQT1 channel. One wild type 22-residue peptide and another mutant peptide of the same length with G269S mutation, derived from the S5 segment were synthesized and labeled with fluorescent probes. The mutant peptide exhibited lower affinity towards phospholipid vesicles as compared to the wild type peptide and showed impaired assembly and localization onto the lipid vesicles as evidenced by membrane-binding, energy transfer and proteolytic cleavage experiments. Loss in the helical content of S5 mutant peptide in membrane-mimetic environments was observed. Furthermore, it was observed that G269S mutation significantly inhibited the ability of S5 peptide to permeabilize the lipid vesicles. The present studies show the basis of change in function of the selected S5 segment as a result of G269S mutation which is associated with LQT1 syndrome. We speculate that the structural and functional changes related to the glycine to serine amino acid substitution in the S5 segment may also influence the activity of the whole KvLQT1 channel.

  4. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  5. 湿润烧伤膏治疗热损伤性溃疡108例体会%Clinical Experience with MEBO in Treating 108 Cases of Ulcer Caused by Thermal Injuries

    Institute of Scientific and Technical Information of China (English)

    晁晓涛

    2001-01-01

    Objective:To summarize the efficacy of MEBO in treating ulcers caused by thermal injuries. Method: 108 cases of burn were treated with MEBO. Result:All the patients healed and the scar formation rate was 26.9% . Conclusion:MEBO is very effective in treating ulcers caused by thermal injuries.%目的:总结湿润烧伤膏( MEBO)治疗热损伤性溃疡的疗效.方法:对 1997年至 1999年 108例,因烧、烫伤所致的热损伤性溃疡采用 MEBO湿润暴露治疗.结果: 108例患者均治愈,随访瘢痕发生率为 26.9%.结论: MEBO对热损伤性溃疡有良好的作用.

  6. Cardiovascular morbidity and early mortality cluster in parents of type 1 diabetic patients with diabetic nephropathy

    DEFF Research Database (Denmark)

    Tarnow, L; Rossing, P; Nielsen, F S

    2000-01-01

    (121 of 244 [ approximately 50%] ) as compared with parents of normoalbuminuric type 1 diabetic patients (119 of 269 [approximately 44%]) (P = 0.008 [log-rank test]) partially due to an increase in cardiovascular deaths (48 of 244 [approximately 20%] vs. 42 of 269 [approximately 16%], P....05). In addition, more patients with nephropathy, as compared with the normoalbuminuric group, had at least one parent with fatal/nonfatal cardiovascular disease (46% [95% CI 38-54] vs. 36% [28-44], P = 0.05). Fathers of patients homozygous for the I-allele of the ACE/ID polymorphism had significantly less...... myocardial infarction as compared with other genotypes (P = 0.03), regardless of the nephropathic state of the offspring. CONCLUSIONS: Cardiovascular morbidity and early mortality clusters in parents of type 1 diabetic patients with diabetic nephropathy The ACE/ID polymorphism helps explain the increased...

  7. Modeling the Economic Impacts of Large Deployments on Local Communities

    Science.gov (United States)

    2008-12-01

    0.405 Hodgeman 0.287 0.176 0.430 Stevens 0.260 0.181 0.428 Jackson -0.269 -0.114 0.455 Sumner -0.858 -0.476 0.317 Jefferson -0.570 -0.307...Lauderdale 0.331 0.225 0.411 Bedford 0.050 0.056 0.478 Lawrence 0.198 0.145 0.443 Benton 0.763 0.384 0.350 Lewis 0.447 0.270 0.394 Bledsoe...1.442 0.075 Stewart 0.176 0.132 0.448 Hancock 0.356 0.269 0.394 Sullivan -0.205 -0.098 0.461 Hardeman 0.248 0.163 0.435 Sumner 0.770 0.444

  8. Role of multiple phosphorylation sites in the COOH-terminal tail of aquaporin-2 for water transport: evidence against channel gating

    DEFF Research Database (Denmark)

    Moeller, Hanne B; Macaulay, Nanna; Knepper, Mark A;

    2009-01-01

    in the COOH-terminal tail of AQP2 on protein function. When expressed in Xenopus laevis oocytes, prevention of AQP2 phosphorylation at S256A (S256A-AQP2) reduced osmotic water permeability threefold compared with wild-type (WT) AQP2-injected oocytes. In contrast, prevention of AQP2 single phosphorylation at S...... demonstrated that lack of phosphorylation at S256, S261, S264, or S269 had no effect on AQP2 unit water transport. Similarly, no effect on AQP2 unit water transport was observed for the 264D and 269D forms, indicating that phosphorylation of the COOH-terminal tail of AQP2 is not involved in gating...

  9. Deformations of three-dimensional metrics

    Science.gov (United States)

    Pugliese, Daniela; Stornaiolo, Cosimo

    2015-03-01

    We examine three-dimensional metric deformations based on a tetrad transformation through the action the matrices of scalar field. We describe by this approach to deformation the results obtained by Coll et al. (Gen. Relativ. Gravit. 34:269, 2002), where it is stated that any three-dimensional metric was locally obtained as a deformation of a constant curvature metric parameterized by a 2-form. To this aim, we construct the corresponding deforming matrices and provide their classification according to the properties of the scalar and of the vector used in Coll et al. (Gen Relativ Gravit 34:269, 2002) to deform the initial metric. The resulting causal structure of the deformed geometries is examined, too. Finally we apply our results to a spherically symmetric three geometry and to a space sector of Kerr metric.

  10. 阴沟肠杆菌对乐果的降解效果试验初探%Preliminary Study on the Degradation Characteristics of Dimethoate by Enterobacter closcae

    Institute of Scientific and Technical Information of China (English)

    马丽娜

    2011-01-01

    The degradation efficiency of dimethoate residue on water spinach(Ipomoea aquatica Forsk) by Enterobacter closcae was studied.The results showed that,the half-life of degradation of dimethoate residue on water spinach reduced to 2.69 d and the degrading rate was 47.30% at 14 d after application of fermentation liquid of E.closcae.%研究了阴沟肠杆菌对空心菜上乐果残留的降解效果,结果表明:施用阴沟肠杆菌培养液后,乐果在空心菜上的降解半衰期减少至2.69 d,施药14 d后的相对降解率为47.3%。

  11. Diversion system design of Zambia Lunzua Hydropower Station%赞比亚LUNZUA水电站引水系统设计

    Institute of Scientific and Technical Information of China (English)

    李彬

    2014-01-01

    Lunzua Hydropower Station of Zambia is a diversion-type hydropower project designed with high water head of 269.78m and long diversion pipe of 5.28 km. Combined with the engineering geological conditions, an intro-duction was made on the arrangement of diversion route, the structural design of open channel, pressure forebay and penstock.%赞比亚LUNZUA水电站为高水头引水式电站,水头高(269.78 m)、线路长(5.28 km)。结合工程沿线的工程地质条件,对引水系统线路进行了布置,并简述明渠、压力前池、压力钢管的结构设计。

  12. Confirmation of locus heterogeneity in the pure form of familial spastic paraplegia

    Energy Technology Data Exchange (ETDEWEB)

    Speer, M.C.; Gaskell, P.C.; Robinson, L.C. [Duke Univ. Medical Center, Durham, NC (United States)] [and others

    1995-08-14

    Familial spastic paraplegia (FSP), characterized by progressive spasticity of the lower extremities, is in its {open_quotes}pure{close_quotes} form generally of autosomal dominant inheritance pattern. Hazen et al. reported tight linkage of a large FSP family to the highly polymorphic microsatellite marker D14S269 with z ({sub {theta}}) = 8.49 at {sub {theta}} = 0.00. They further demonstrated evidence for locus heterogeneity when they showed that 2 FSP families were unlinked to this region. We have subsequently studied 4 FSP families (3 American, one British) and excluded the disease locus in these families for approximately 30 cM on either side of D14S269, thereby confirming evidence for locus heterogeneity within the spastic paraplegia diagnostic classification. 28 refs., 2 figs., 4 tabs.

  13. ACE genotype, phenotype and all-cause mortality in different cohorts of patients with type 1 diabetes

    DEFF Research Database (Denmark)

    Færch, Louise H; Sejling, Anne-Sophie; Lajer, Maria

    2015-01-01

    AIMS: Carrying the D-allele of the angiotensin-converting enzyme (ACE) I/D polymorphism and high ACE activity are prognostic factors in diabetic nephropathy, which predicts mortality in type 1 diabetes. We studied the association between the ACE D-allele and ACE phenotype and long-term all......-cause mortality in three single-institution outpatient cohorts. METHODS: Genotype-based analyses were performed in 269 patients from Hillerød Hospital (HIH) (follow-up: 12 years) and in 439 patients with diabetic nephropathy and 437 patients with persistent normoalbuminuria from the Steno Diabetes Center (SDC......) (follow-up: 9.5 years). Patients not on renin-angiotensin system (RAS)-blocking treatment were included in analyses of serum ACE activity (HIH: n = 208) and plasma ACE concentration (SDC: n=269). RESULTS: In the HIH cohort, carrying a D-allele was associated with excess mortality (hazard ratio (HR) = 4...

  14. Tubin, Eduard. Sonate pour violon et piano dans le mode phrygien / Pierre Gervasoni

    Index Scriptorium Estoniae

    Gervasoni, Pierre

    1995-01-01

    Uuest heliplaadist "Tubin, Eduard. Sonate pour violon et piano dans le mode phrygien. Ballade pour piano en forme de Chaconne sur un theme de Mart Saar. Sonate pour saxophone alto et piano. Le Chant des soldats enrepli. Ave Maria. Societe Chorale Estudiantine de Lund, Neeme Järvi. BIS-CD 269, distribution Harmonia Mundi (CD: 161 F), 1984/85.TT: 1h 03'46"

  15. The Determination of Predictive Construct of Physical Behavior Change on Osteoporosis Prevention Women Aged 30-50: A Trans-theoretical Method Study

    OpenAIRE

    2015-01-01

    Osteoporosis is a major public health priority in Iran and throughout the world. The prevention of osteoporosis has recently become the ultimate goal of many health professionals. Behavior change is one of the most powerful strategies to prevent osteoporosis. This study aimed to determine the predictive construct of physical preventive behavior of osteoporosis in women aged 30-50 in Khorramabad, west of Iran. This study included 269 women selected from all the health centers of Khorramabad ci...

  16. Drug: D04969 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04969 Crude, Drug White beeswax (JP16); Wax, white (NF); White wax (TN) Apis indic...n [BR:br08301] 7 Agents not mainly for therapeutic purpose 71 Dispensing medicines 712 Ointment bases 7121 Oil bases D04969 White bee...swax (JP16); Wax, white (NF) Crude drugs [BR:br08305] Animals Insects D04969 White beeswax CAS: 8012-89-3 PubChem: 17398240 NIKKAJI: J269.255D ...

  17. National Computer Security Conference Proceedings (12th): Information Systems Security: Solutions for Today - Concepts for Tomorrow Held in Baltimore, Maryland on 10-13 October 1989

    Science.gov (United States)

    1989-10-13

    Entities ( SMAEs ), Layer Managers (LMs) and Managcment Information Bases (MIBs). Figure 3 shows the placement and relation of these cttilics. The...the objects (such as GET or SET or generation of EVENTS) are performed by the. LM as directed by the SMAE . 269 The conimunikafion of the LMs and the... SMAEs % is a local nmtler and is Ocefincd inltc nally by a.? end system~. This hintcrai communication is shown by the invcrted L-shapl𔃽_ boy-s in Figur

  18. Immune Response in Male Guinea Pigs Infected with the Guinea Pig Inclusion Conjunctivitis Agent of Chlamydia Psittaci

    Science.gov (United States)

    1994-01-01

    developed areas of Africa and the Middle East and is the leading cause of preventable blindness in the world. It is estimated that trachoma afflicts about...obstruction (29). This type of immunopathology can ultimately result in ectopic pregnancy or infertility (7). The pathology associated with chlamydial...Sex. Transm. Dis. 8:203-209. 42. Randall, T. 1993. New tools ready for chlamydiae diagnosis, treatment, but teens need education most. JAMA. 269

  19. 能動的腰椎牽引治療器DRX-9000を用いた腰椎椎間板障害治療の経験

    OpenAIRE

    山本, 智章; 佐藤, 成登志; 石川, 知志; Yamamoto, Noriaki; Sato, Naritoshi; Ishikawa, Tomoji

    2008-01-01

    We reported clinical results of the treatment of lumbar disk disorder patients by using active traction apparatus DRX-9000(Axiom Worldwide, Tampa, FL, USA). Fifty patients were received 30-minites sessions every week or 2 weeks, for 3 months. Pain as measured on visual analog scale rating significantly decreased at 4.91±0.93 to 2.69±1.02 (p

  20. Caffeine, Adenosine Receptors and Estrogen in Toxin Models of Parkinson’s Disease

    Science.gov (United States)

    2009-10-01

    inversely related to clinical progression of PD. The internal consistency of the results across the primary and secondary end points sup- ports their...for myocardial infarction and stroke: the Rotterdam study. Stroke. 2006; 37(6):1503-1507. 52. Wheeler JG, Juzwishin KD, Eiriksdottir G, Gudnason V...behavior in the rat: have we wasted our time? Exp Neurol 197:269-274. MorelliM, Di Paolo T, Wardas J, Calon F, Xiao D, Schwarzschild MA (2007) Role of

  1. Gynekologer och barnmorskor inom svensk abortvård : åsikter, erfarenheter och upplevelser

    OpenAIRE

    Lindström, Meta

    2007-01-01

    Aim: To investigate gynecologists’ and midwives’ views and experiences regarding work in abortion care in Sweden. Methods: Questionnaire to gynecologists (n=269) and midwives (n=258 comprising 48 questions, response 85%. The quantitative studies (articles I-III) were supplemented by a qualitative study (article IV), consisting of focus-group interviews with gynecologists and midwives/nurses. Results: From the questionnaire studies it was apparent that all the gynecologists had worked in abort...

  2. Dicty_cDB: Contig-U05297-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : 104,622,809,269 Length adjustment: 22 Effective length of query: 88 Effective length of database: 102,296,446,593 Effective... search space: 9002087300184 Effective search space used: 9002087300184 X1: 11 (21.8 bits) ... database: 1,061,185,681 Length adjustment: 10 Effective length of query: 26 Effective... length of database: 1,028,501,201 Effective search space: 26741031226 Effective search space used: 267

  3. The C7N aminocyclitol family of natural products.

    Science.gov (United States)

    Mahmud, Taifo

    2003-02-01

    This review covers microbial secondary metabolites classified in the family of C7N aminocyclitols, a relatively new class of natural products that is increasingly gaining recognition due to their significant biomedical and agricultural uses. Their discovery and structure determinations, their biosynthetic origin, biological properties, chemical synthesis, as well as their further development for pharmaceutical uses are described. The literature from 1970 to July 2002 is reviewed, with 269 references cited.

  4. Tubin, Eduard. Sonate pour violon et piano dans le mode phrygien / Pierre Gervasoni

    Index Scriptorium Estoniae

    Gervasoni, Pierre

    1995-01-01

    Uuest heliplaadist "Tubin, Eduard. Sonate pour violon et piano dans le mode phrygien. Ballade pour piano en forme de Chaconne sur un theme de Mart Saar. Sonate pour saxophone alto et piano. Le Chant des soldats enrepli. Ave Maria. Societe Chorale Estudiantine de Lund, Neeme Järvi. BIS-CD 269, distribution Harmonia Mundi (CD: 161 F), 1984/85.TT: 1h 03'46"

  5. Realistic Bomber Training Initiative. Environmental Impact Statement. Volume 1

    Science.gov (United States)

    2000-01-01

    Brady Janelle 000697 254 Brady Jeff 000824 297 Bragg Joy & Jimmy 000702 257 Brainerd John 000699 256 Branch Sue 000521 187 Brandon Ed 000511 181...Betsy & Harold 000524 189 Sanders Christopher 000719 263 Sanders Harold 001083 424 Sanders Kelly 000858 324 Sanderson Arnold 000342 120 Sandoval E.J...Yeager William 000600 222 York Donald 000144 50 York Van 000960 369 Young Brandon 000352 123 Young Landon 000737 269 Young Lesley 000951 362 Young

  6. Asthma Education and Intervention Program: Partnership for Asthma Trigger-Free Homes (PATH)

    Science.gov (United States)

    2010-02-01

    science research and extensively documented in behavior modification protocols (Harvey-Berino et al., 2002; Hegel & Ferguson, 2000; McNeil, Watson...the maintenance of weight loss? International Journal of Obesity, 26(9), 1254-1260. Hegel , M., & Ferguson, R. (2000). Differential...Pintauro, et al. (2002). ’’Does using the intemet facilitate the maintenance of weight loss? .’’ Intcntational Journal of Obesity 26: 1254-1260. HegeL

  7. Survey of Collision Avoidance and Ranging Sensors for Mobile Robots. Revision 1

    Science.gov (United States)

    1992-12-01

    AD-A269 846 Technical Report 1194 December 1992 Survey of Collision Avoidance and Ranging Sensors for Mobile Robots Revision 1 H. R. Everett D. E...Survey of Collision Avoidance and Ranging Sensors for Mobile Robots Revision 1 H. R. Everett D. E. DeMuth E. H. Stitz Accesior. For NTIS CRA&M DTIC TAB...3.3.7 Error Eliminating Rapid Ultrasonic Firing ........................ 118 3.3.8 Potential Field Obstacle Avoidance for Large Mobile Robots ........ 118

  8. Department of Defense Atlas/Data Abstract for the United States and Selected Areas. Fiscal Year 1992

    Science.gov (United States)

    1993-01-01

    Aguadilla 89 0 89 Bayamon 9,915 7,144 2,771 Vieques 62 34 28 Caguas 9,398 3,269 6,129 Aguas Buenas 33 0 33 Navy Other Prime Contracts Over $25,000 Total...4. LIMPIEZAS CORONA S L 5,112 Custodial - Janitorial Services 4,955 5. AIR GOURND SERVICES CONSULTANT 5,104 Operation/Airport Terminals 5,104 Total

  9. Field Demonstration of Rhizosphere-Enhanced Treatment of Organics-Contaminated Soils on Native American Lands with Application to Northern FUD Sites, Ver 2

    Science.gov (United States)

    2004-06-01

    edge of an extensive coastal plain. Soils are dominated by marine beach deposits consisting of coarse sand and gravel. Some finer deposits of silt...SSSA, Madison, WI. ESTCP Project #1011, Rhizosphere Final Report 47 Actinomycetes : Starch Casein Medium 10.0 g soluble starch (Fisher...cycloheximide.1 Reference : Wellington, E.M.H., and I.K. Toth, 1994. Actinomycetes . p. 269- 290. In R.W. Weaver (ed.). Methods of soil

  10. Index of Selected Publications Through December 1983,

    Science.gov (United States)

    1984-03-01

    dealings vith Third World - PP 155, 262, foreign policy - A 1068 269, 270, 279; H 1033 post cultural revolution foreign policy naval presence during...1971, AD 727 725 PP 73 The Navy Personal Response Program is a Utgoff, Victor A. and Kashyap, R.L.,* On Behavior crose- cultural training program aimed...and Marcuse , Range Bombing from orth American Bases, 70 pp., Elaine, Performance of ANV/APS-20 Radar Against Air Jul 1949, AD A950 178 Targets: An

  11. Observation of the suppression of the flux of cosmic rays above 4x10(19) eV

    NARCIS (Netherlands)

    Abraham, J.; Abreu, P.; Aglietta, M.; Aguirre, C.; Allard, D.; Allekotte, I.; Allen, J.; Allison, P.; Alvarez-Muniz, J.; Ambrosio, M.; Anchordoqui, L.; Andringa, S.; Anzalone, A.; Aramo, C.; Argiro, S.; Arisaka, K.; Armengaud, E.; Arneodo, F.; Arqueros, F.; Asch, T.; Asorey, H.; Assis, P.; Atulugama, B. S.; Aublin, J.; Ave, M.; Avila, G.; Backer, T.; Badagnani, D.; Barbosa, A. F.; Barnhill, D.; Barroso, S. L. C.; Baughman, B.; Bauleo, P.; Beatty, J. J.; Beau, T.; Becker, B. R.; Becker, K. H.; Bellido, J. A.; BenZvi, S.; Berat, C.; Bergmann, T.; Bernardini, P.; Bertou, X.; Biermann, P. L.; Billoir, P.; Blanch-Bigas, O.; Blanco, F.; Blasi, P.; Bleve, C.; Mer, H. Blu; Bohacova, M.; Bonifazi, C.; Bonino, R.; Brack, J.; Brogueira, P.; Brown, W. C.; Buchholz, P.; Bueno, A.; Burton, R. E.; Busca, N. G.; Caballero-Mora, K. S.; Cai, B.; Camin, D. V.; Caramete, L.; Caruso, R.; Carvalho, W.; Castellina, A.; Catalano, O.; Cataldi, G.; Cazon, L.; Cester, R.; Chauvin, J.; Chiavassa, A.; Chinellato, J. A.; Chou, A.; Chudoba, J.; Chye, J.; Clark, P. D. J.; Clay, R. W.; Colombo, E.; Conceicao, R.; Connolly, B.; Contreras, F.; Coppens, J.; Cordier, A.; Cotti, U.; Coutu, S.; Covault, C. E.; Creusot, A.; Criss, A.; Cronin, J.; Curutiu, A.; Dagoret-Campagne, S.; Daumiller, K.; Dawson, B. R.; de Almeida, R. M.; de Donato, C.; de Jong, S. J.; De La Vega, G.; Junior, W. J. M. de Mello; de Mello Neto, J. R. T.; De Mitri, I.; de Souza, V.; del Peral, L.; Deligny, O.; Della Selva, A.; Delle Fratte, C.; Dembinski, H.; Di Giulio, C.; Diaz, J. C.; Diep, P. N.; Dobrigkeit, C.; D'Olivo, J. C.; Dong, P. N.; Dornic, D.; Dorofeev, A.; dos Anjos, J. C.; Dova, M. T.; D'Urso, D.; Dutan, I.; DuVernois, M. A.; Engel, R.; Epele, L.; Escobar, C. O.; Etchegoyen, A.; Luis, P. Facal San; Falcke, H.; Farrar, G.; Fauth, A. C.; Fazzini, N.; Ferrer, F.; Ferrero, A.; Fick, B.; Filevich, A.; Filipcic, A.; Fleck, I.; Fracchiolla, C. E.; Fulgione, W.; Garcia, B.; Gamez, D. Garcia; Garcia-Pinto, D.; Garrido, X.; Geenen, H.; Gelmini, G.; Gemmeke, H.; Ghia, P. L.; Giller, M.; Glass, H.; Gold, M. S.; Golup, G.; Albarracin, F. Gomez; Berisso, M. Gomez; Goncalves, P.; do Amaral, M. Goncalves; Gonzalez, D.; Gonzalez, J. G.; Gonzalez, M.; Gora, D.; Gorgi, A.; Gouffon, P.; Grassi, V.; Grillo, A. F.; Grunfeld, C.; Guardincerri, Y.; Guarino, F.; Guedes, G. P.; Gutierrez, J.; Hague, J. D.; Halenka, V.; Hamilton, J. C.; Hansen, P.; Harari, D.; Harmsma, S.; Harton, J. L.; Haungs, A.; Hauschildt, T.; Healy, M. D.; Hebbeker, T.; Hebrero, G.; Heck, D.; Hojvat, C.; Holmes, V. C.; Homola, P.; Horandel, J. R.; Horneffer, A.; Hrabovsky, M.; Huege, T.; Hussain, M.; Iarlori, M.; Insolia, A.; Ionita, F.; Italiano, A.; Kaducak, M.; Kampert, K. H.; Karova, T.; Kasper, P.; Kegl, B.; Keilhauer, B.; Kemp, E.; Kieckhafer, R. M.; Klages, H. O.; Kleifges, M.; Kleinfeller, J.; Knapik, R.; Knapp, J.; Koang, D. -H.; Krieger, A.; Kroemer, O.; Kuempel, D.; Kunka, N.; Kusenko, A.; La Rosa, G.; Lachaud, C.; Lago, B. L.; Lebrun, D.; Lebrun, P.; Lee, J.; de Oliveira, M. A. Leigui; Letessier-Selvon, A.; Leuthold, M.; Lhenry-Yvon, I.; Lopez, R.; Aguera, A. Lopez; Bahilo, J. Lozano; Lucero, A.; Garcia, R. Luna; Maccarone, M. C.; Macolino, C.; Maldera, S.; Mancarella, G.; Mancenido, M. E.; Mandat, D.; Mantsch, P.; Mariazzi, A. G.; Maris, I. C.; Falcon, H. R. Marquez; Martello, D.; Martinez, J.; Bravo, O. Martinez; Mathes, H. J.; Matthews, J.; Matthews, J. A. J.; Matthiae, G.; Maurizio, D.; Mazur, P. O.; McCauley, T.; McEwen, M.; McNeil, R. R.; Medina, M. C.; Medina-Tanco, G.; Melo, D.; Menichetti, E.; Menschikov, A.; Meurer, C.; Meyhandan, R.; Micheletti, M. I.; Miele, G.; Miller, W.; Mollerach, S.; Monasor, M.; Ragaigne, D. Monnier; Montanet, F.; Morales, B.; Morello, C.; Moreno, J. C.; Morris, C.; Mostafa, M.; Muller, M. A.; Mussa, R.; Navarra, G.; Navarro, J. L.; Navas, S.; Necesal, P.; Nellen, L.; Newman-Holmes, C.; Newton, D.; Nhung, P. T.; Nierstenhoefer, N.; Nitz, D.; Nosek, D.; Nozka, L.; Oehlschlaeger, J.; Ohnuki, T.; Olinto, A.; Olmos-Gilbaja, V. M.; Ortiz, M.; Ortolani, F.; Ostapchenko, S.; Otero, L.; Pacheco, N.; Selmi-Dei, D. Pakk; Palatka, M.; Pallotta, J.; Parente, G.; Parizot, E.; Parlati, S.; Pastor, S.; Patel, M.; Paul, T.; Pavlidou, V.; Payet, K.; Pech, M.; Pekala, J.; Pelayo, R.; Pepe, I. M.; Perrone, L.; Pesce, R.; Petrera, S.; Petrinca, P.; Petrov, Y.; Pichel, A.; Piegaia, R.; Pierog, T.; Pimenta, M.; Pinto, T.; Pirronello, V.; Pisanti, O.; Platino, M.; Pochon, J.; Privitera, P.; Prouza, M.; Quel, E. J.; Rautenberg, J.; Redondo, A.; Reucroft, S.; Revenu, B.; Rezende, F. A. S.; Ridky, J.; Riggi, S.; Risse, M.; Riviere, C.; Rizi, V.; Roberts, M.; Robledo, C.; Rodriguez, G.; Martino, J. Rodriguez; Rojo, J. Rodriguez; Rodriguez-Cabo, I.; Rodriguez-Frias, M. D.; Ros, G.; Rosado, J.; Roth, M.; Rouille-d'Orfeuil, B.; Roulet, E.; Rovero, A. C.; Salamida, F.; Salazar, H.; Salina, G.; Sanchez, F.; Santander, M.; Santo, C. E.; Santos, E. M.; Sarazin, F.; Sarkar, S.; Sato, R.; Scherini, V.; Schieler, H.; Schmidt, A.; Schmidt, F.; Schmidt, T.; Scholten, O.; Schovanek, P.; Schroeder, F.; Schulte, S.; Schuessler, F.; Sciutto, S. J.; Scuderi, M.; Segreto, A.; Semikoz, D.; Settimo, M.; Shellard, R. C.; Sidelnik, I.; Siffert, B. B.; Sigl, G.; De Grande, N. Smetniansky; Smialkowski, A.; Smida, R.; Smith, A. G. K.; Smith, B. E.; Snow, G. R.; Sokolsky, P.; Sommers, P.; Sorokin, J.; Spinka, H.; Squartini, R.; Strazzeri, E.; Stutz, A.; Suarez, F.; Suomijaervi, T.; Supanitsky, A. D.; Sutherland, M. S.; Swain, J.; Szadkowski, Z.; Takahashi, J.; Tamashiro, A.; Tamburro, A.; Tarutina, T.; Tascau, O.; Tcaciuc, R.; Thao, N. T.; Thomas, D.; Ticona, R.; Tiffenberg, J.; Timmermans, C.; Tkaczyk, W.; Peixoto, C. J. Todero; Tome, B.; Tonachini, A.; Torres, I.; Travnicek, P.; Tripathi, A.; Tristram, G.; Tscherniakhovski, D.; Tuci, V.; Tueros, M.; Tunnicliffe, V.; Ulrich, R.; Unger, M.; Urban, M.; Galicia, J. F. Valdes; Valino, I.; Valore, L.; van den Berg, A. M.; van Elewyck, V.; Vazquez, R. A.; Veberic, D.; Veiga, A.; Velarde, A.; Venters, T.; Verzi, V.; Videla, M.; Villasenor, L.; Vorobiov, S.; Voyvodic, L.; Wahlberg, H.; Wahrlich, P.; Wainberg, O.; Walker, P.; Warner, D.; Watson, A. A.; Westerhoff, S.; Wieczorek, G.; Wiencke, L.; Wilczynska, B.; Wilczynski, H.; Wileman, C.; Winnick, M. G.; Wu, H.; Wundheiler, B.; Yamamoto, T.; Younk, P.; Zas, E.; Zavrtanik, D.; Zavrtanik, M.; Zaw, I.; Zepeda, A.; Ziolkowski, M.

    2008-01-01

    The energy spectrum of cosmic rays above 2.5 x 10(18) eV, derived from 20 000 events recorded at the Pierre Auger Observatory, is described. The spectral index gamma of the particle flux, J proportional to E(-gamma), at energies between 4 x 10(18) eV and 4 x 10(19) eV is 2.69 +/- 0.02(stat) +/- 0.06

  12. Smooth Optimization Approach for Sparse Covariance Selection

    OpenAIRE

    Lu, Zhaosong

    2009-01-01

    In this paper we first study a smooth optimization approach for solving a class of nonsmooth strictly concave maximization problems whose objective functions admit smooth convex minimization reformulations. In particular, we apply Nesterov's smooth optimization technique [Y.E. Nesterov, Dokl. Akad. Nauk SSSR, 269 (1983), pp. 543--547; Y. E. Nesterov, Math. Programming, 103 (2005), pp. 127--152] to their dual counterparts that are smooth convex problems. It is shown that the resulting approach...

  13. Noise in Broad-Band Hydrophones

    Science.gov (United States)

    1975-05-01

    accolertion and pressure in water A• / , ILLUS’.RATIONrs (coat 1d ) 22 Aaplifiar and titrisi nOise backgnnumd JMT 1 BUTION’ . ... . .. t. .* .*. . *. . *** o. o...Then, Z (fros equation (49c)) W 2 1 S2 2n,- - 2(69)QU 2ni(69 This appriisate relationship has boon used in the following ezW , even wtare the element is

  14. Silk or Spandex : Chinas Problematic One Road, One Belt Plan to Expand its Economic Boundaries as Seen Through the Lens of American, British, and Japanese Experience

    Science.gov (United States)

    2016-04-04

    135. 31 Liza G. Steele and Scott M. Lynch, “The Pursuit of Happiness in China: Individualism, Collectivism, and Subjective Well-Being during...level of consumption, a reduction in the availability of health care, and a significant loss of jobs in certain textile industries suggesting growing...2001): 269-81. Steel, Ronald. Pax Americana. New York: The Viking Press, 1967. Steele, Liza G. and Scott M. Lynch. “The Pursuit of Happiness in

  15. Fixed-asset investment in textile industry slows in Q1-Q3 as cubs weigh on economy

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Fixed asset investment growth in China’s textile industry slowed in the first three quarters this year, mainly resulting from the yuan appreciation, the rising material and labor costs, as well as dismal overseas market hit by the subprime lending crisis. From January to September, the total fixed-assets investment in the textile industry was up 10.15% to RMB 202.269 billion year-on-year,

  16. Effects of a Novel Cooling Shirt on Various Physical Performance Parameters in Elite Athletes

    Science.gov (United States)

    2015-06-03

    Dynamic warmup; total body lift, functional circuit on indoor turf Physiological variables including exercise HR, acceleration, HR variability, and...269-277. 9. Gordon NF, Bogdanffy GM, Wilkinson J. Effect of a practical neck cooling device on core temperature during exercise . Med Sci Sports ...operations and sport matches. The primary purpose of this short-term field observation was to determine the effects of a technical cooling shirt and

  17. Open-System Quantum Annealing in Mean-Field Models with Exponential Degeneracy

    Science.gov (United States)

    2016-08-25

    Research Center, Mail Stop 269-3, Moffett Field, California 94035 USRA, NASA Ames Research Center, Moffett Field, California 94035, USA 2Google, 150 Main...principle, be reproduced using an analog quantum annealer. Before outlining the formal calculation, we discuss the qualitative picture of the effect of...performance (computation time) of SA and QA is charac- terized by the numerical scaling factors in the exponent (in front ofN),whichhave tobecarefully

  18. The impact of elevated serum creatinine on the prognosis of acute myocardial infarction

    Institute of Scientific and Technical Information of China (English)

    李帮清

    2006-01-01

    Objective To evaluate the clinical features and outcomes in patients suffering from acute myocardial infarction combined with elevated serum creatinine. Methods We enrolled 340 consecutive patients suffering from acute myocardial infarction admitted into our hospital from 2003.2.1 -2004.8.31. The patients were divided into the following 2 groups, 269 patients in a group with normal serum creatinine and 71 patients in a group with elevated serum creatinine, according to the normal limit of

  19. A Poética Sociológica de Medviédev e Sua Atualidade

    OpenAIRE

    Matheus de Brito

    2013-01-01

    Review of Pável Nikoláievitch Medviédev. O método formal nos estudos literários: introdução crítica a uma poética sociológica, Trad. Ekaterina Vólkova Américo e Sheila Camargo Grillo, São Paulo, Contexto, 2012, 269 pp. [1ª ed., Leningrado, Pribói, 1928]. ISBN 978-85-7244-725-6

  20. Why Do Entrepreneurial Parents Have Entrepreneurial Children?

    OpenAIRE

    Lindquist, Matthew; Sol, Joeri; Van Praag, Mirjam

    2015-01-01

    This discussion paper resulted in a publication in the 'Journal of Labor Economics' , 33(2), (April 2015), 269-296. Parental entrepreneurship is a strong, probably the strongest, determinant of own entrepreneurship. We explore the origins of this intergenerational association in entrepreneurship. In particular, we identify the separate effects of pre- and post-birth factors (nature and nurture), by using a unique dataset of Swedish adoptees. Its unique characteristic is that it not only inclu...

  1. Muscular disease

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930186 The diagnostic value of MRI on neuro-muscular disease.CHEN Qingtang(陈清棠),etal.Dept Neurol,1st Hosp,Beijing Med Univ,100034.Chin J Neurol & Psychiat 1992;25(5):267-269.The article concentrated on the study ofskeletal muscles of four extremities in 12 casesof different kinds of neuromuscular diseases and4 volunteers with MRI.The results revealed:MRI could clearly display individual muscle,muscle groups or abnormal muscles morphologi-

  2. Dicty_cDB: Contig-U05428-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available th of query: 254 Length of database: 104,622,809,269 Length adjustment: 23 Effective length of query: 231 Effective... length of database: 102,190,702,835 Effective search space: 23606052354885 Effective...th of query: 84 Length of database: 1,061,185,681 Length adjustment: 54 Effective length of query: 30 Effective... length of database: 884,689,489 Effective search space: 26540684670 Effective search space used: 2654068

  3. USSR and Eastern Europe Scientific Abstracts, Electronics and Electrical Engineering, No. 43.

    Science.gov (United States)

    2007-11-02

    VJ- ?■ 1 ■■ , .- ■ v. - "’■ ! .. Dkii i .v^vr-n w.’- ■F .’«?."• •5’- LV "*3 19980707 269 U. S. JOINT PUBLICATIONS RESEARCH...Russian Vol 23 No 5, May 78 pp 984-992 manuscript received 11 Sep 75; after revision 4 Apr 77 POLYAK , B.I. [Abstract] An examination is

  4. Modeling Effects of Crystalline Microstructure, Energy Storage Mechanisms, and Residual Volume Changes on Penetration Resistance of Precipitate-Hardened Aluminum Alloys

    Science.gov (United States)

    2009-08-01

    treatment of geometrically nonlinear, single crystal elastoplasticity extends previous theory [4,5] to account for free energy accumulation associated...Role of plastic relaxation. Phil Mag 1971;23:1201–33. [3] Cho A, Bes B. Damage tolerance capability of an Al–Cu–Mg–Ag alloy (2139). Mater Sci Forum 2006...2008;35:269–89. [8] Clayton JD, McDowell DL. A multiscale multiplicative decomposition for elastoplasticity of polycrystals. Int J Plasticity 2003;19:1401

  5. De novo transcriptome assembly and comprehensive expression profiling in Crocus sativus to gain insights into apocarotenoid biosynthesis

    OpenAIRE

    Mukesh Jain; Prabhakar Lal Srivastava; Mohit Verma; Rajesh Ghangal; Rohini Garg

    2016-01-01

    Saffron (Crocus sativus L.) is commonly known as world’s most expensive spice with rich source of apocarotenoids and possesses magnificent medicinal properties. To understand the molecular basis of apocarotenoid biosynthesis/accumulation, we performed transcriptome sequencing from five different tissues/organs of C. sativus using Illumina platform. After comprehensive optimization of de novo transcriptome assembly, a total of 105, 269 unique transcripts (average length of 1047 bp and N50 leng...

  6. Studies on Decomposition and Combustion Mechanism of Solid Fuel Rich Propellants

    Science.gov (United States)

    2010-08-30

    energetic plasticizers in place of conventional inert binders and inert plasticizers like organic phthalates and acetates . FRP formulations based on poly...9), 1994, pp. 269-278. 16) Singh, H; Shekhar, H. Science and Technology of rocket propellants, Printed by Print well, Tow -Chowk, Darbhanga, (India...diazido 3,3 nitroazo pentane) -- -80 554 -- Diethylene glycol bis- azido acetate 1 -100 -392 -- Trimethylol nitro methane 1.4 -72 -230

  7. Computerized Algorithms: Evaluation of Capability to Predict Graduation from Air Force Training.

    Science.gov (United States)

    1980-09-01

    196 5.7 Table A2. Distribution of the ASVAB Mechanical Aptitude Test Scores bribe 1976 AFSC 43131 Population Airmen Falling in Score nerval ...Popukilon Ahmen F&Blg in ScowI nerval Seem Interval OPem lie.) Number Pezeent អ 88 4.5 50-59 269 13.8 60-69 353 18.0 70-79 390 19.9 80-89 396 20.2

  8. AcEST: DK948692 [AcEST

    Lifescience Database Archive (English)

    Full Text Available L3 OS=Drosophila melan... 269 1e-71 sp|P49149|RL3_TOXCA 60S ribosomal protein L3 OS=Toxocara canis G... 267...ibosomal protein L3 OS=Toxocara canis GN=RPL3 PE=2 SV=2 Length = 402 Score = 267 bits (682), Expect = 4e-71 ...DTSSKMGHGRFQT 381 Query: 527 SQEKAKTFGRVK 562 +K G +K Sbjct: 382 PADKLAFMGPLK 393 >sp|P49149|RL3_TOXCA 60S r

  9. Structure and Dynamics of Shear Bands in Metallic Glasses and Nanophase Composites

    Science.gov (United States)

    2007-11-02

    FUNDING NUMBERS DAAG55-98-1-0487 6. AUTHOR(S) T. C. Hufnagel 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Johns ...ATTN: AMSRL-R0-S (TR) P. O. Box 12211 Research Triangle Park, NC 27709-2211 Submitted by: Department of Materials Science and Engineering Johns ...H. Liebermann, editor, Rapidly Solidified Alloys, pages 269–301. Marcel Dekker, New York, 1993. [7] S. C. Glade , R. Busch, D. S. Lee, W. L. Johnson, R

  10. 2011 Behavioral Health Risk Assessment Data Report (BH-RADR)

    Science.gov (United States)

    2015-09-01

    such as post-traumatic stress disorder (PTSD) symptoms, depression symptoms, and hazardous drinking behavior . Utilization of the Standarized...780.58, V69.4 Suicide and Self Injury E95, E95.9, E98, E989 Legend: BH- Behavioral Health; NOS – not otherwise specified Note: a Each code...81 Negative PHQ-8 and PCL-C 71 269 340 Total 106 315 421 Legend: BH- Behavioral Health; PC-PTSD - Primary Care Post-Traumatic Stress

  11. Foundations of Effective Influence Operations: A Framework for Enhancing Army Capabilities

    Science.gov (United States)

    2009-01-01

    sounding board for campaign and policy themes.” According to veteran Democratic pollster William Hamilton (1995, p. 178), polling is the “central nervous...School: The Origins of Positive Political Theory,” Annual Review of Political Science, Vol. 2, 1999, pp. 269–295. Anderson, Lynn R., and William J...Uleman and J. A. Bargh , Unintended Thought, New York: Guilford Press, 1989, pp. 212–252. Cheney, Richard, speech at the Veterans of Foreign Wars 103rd

  12. Observation of the suppression of the flux of cosmic rays above 4x10(19) eV

    NARCIS (Netherlands)

    Abraham, J.; Abreu, P.; Aglietta, M.; Aguirre, C.; Allard, D.; Allekotte, I.; Allen, J.; Allison, P.; Alvarez-Muniz, J.; Ambrosio, M.; Anchordoqui, L.; Andringa, S.; Anzalone, A.; Aramo, C.; Argiro, S.; Arisaka, K.; Armengaud, E.; Arneodo, F.; Arqueros, F.; Asch, T.; Asorey, H.; Assis, P.; Atulugama, B. S.; Aublin, J.; Ave, M.; Avila, G.; Backer, T.; Badagnani, D.; Barbosa, A. F.; Barnhill, D.; Barroso, S. L. C.; Baughman, B.; Bauleo, P.; Beatty, J. J.; Beau, T.; Becker, B. R.; Becker, K. H.; Bellido, J. A.; BenZvi, S.; Berat, C.; Bergmann, T.; Bernardini, P.; Bertou, X.; Biermann, P. L.; Billoir, P.; Blanch-Bigas, O.; Blanco, F.; Blasi, P.; Bleve, C.; Mer, H. Blu; Bohacova, M.; Bonifazi, C.; Bonino, R.; Brack, J.; Brogueira, P.; Brown, W. C.; Buchholz, P.; Bueno, A.; Burton, R. E.; Busca, N. G.; Caballero-Mora, K. S.; Cai, B.; Camin, D. V.; Caramete, L.; Caruso, R.; Carvalho, W.; Castellina, A.; Catalano, O.; Cataldi, G.; Cazon, L.; Cester, R.; Chauvin, J.; Chiavassa, A.; Chinellato, J. A.; Chou, A.; Chudoba, J.; Chye, J.; Clark, P. D. J.; Clay, R. W.; Colombo, E.; Conceicao, R.; Connolly, B.; Contreras, F.; Coppens, J.; Cordier, A.; Cotti, U.; Coutu, S.; Covault, C. E.; Creusot, A.; Criss, A.; Cronin, J.; Curutiu, A.; Dagoret-Campagne, S.; Daumiller, K.; Dawson, B. R.; de Almeida, R. M.; de Donato, C.; de Jong, S. J.; De La Vega, G.; Junior, W. J. M. de Mello; de Mello Neto, J. R. T.; De Mitri, I.; de Souza, V.; del Peral, L.; Deligny, O.; Della Selva, A.; Delle Fratte, C.; Dembinski, H.; Di Giulio, C.; Diaz, J. C.; Diep, P. N.; Dobrigkeit, C.; D'Olivo, J. C.; Dong, P. N.; Dornic, D.; Dorofeev, A.; dos Anjos, J. C.; Dova, M. T.; D'Urso, D.; Dutan, I.; DuVernois, M. A.; Engel, R.; Epele, L.; Escobar, C. O.; Etchegoyen, A.; Luis, P. Facal San; Falcke, H.; Farrar, G.; Fauth, A. C.; Fazzini, N.; Ferrer, F.; Ferrero, A.; Fick, B.; Filevich, A.; Filipcic, A.; Fleck, I.; Fracchiolla, C. E.; Fulgione, W.; Garcia, B.; Gamez, D. Garcia; Garcia-Pinto, D.; Garrido, X.; Geenen, H.; Gelmini, G.; Gemmeke, H.; Ghia, P. L.; Giller, M.; Glass, H.; Gold, M. S.; Golup, G.; Albarracin, F. Gomez; Berisso, M. Gomez; Goncalves, P.; do Amaral, M. Goncalves; Gonzalez, D.; Gonzalez, J. G.; Gonzalez, M.; Gora, D.; Gorgi, A.; Gouffon, P.; Grassi, V.; Grillo, A. F.; Grunfeld, C.; Guardincerri, Y.; Guarino, F.; Guedes, G. P.; Gutierrez, J.; Hague, J. D.; Halenka, V.; Hamilton, J. C.; Hansen, P.; Harari, D.; Harmsma, S.; Harton, J. L.; Haungs, A.; Hauschildt, T.; Healy, M. D.; Hebbeker, T.; Hebrero, G.; Heck, D.; Hojvat, C.; Holmes, V. C.; Homola, P.; Horandel, J. R.; Horneffer, A.; Hrabovsky, M.; Huege, T.; Hussain, M.; Iarlori, M.; Insolia, A.; Ionita, F.; Italiano, A.; Kaducak, M.; Kampert, K. H.; Karova, T.; Kasper, P.; Kegl, B.; Keilhauer, B.; Kemp, E.; Kieckhafer, R. M.; Klages, H. O.; Kleifges, M.; Kleinfeller, J.; Knapik, R.; Knapp, J.; Koang, D. -H.; Krieger, A.; Kroemer, O.; Kuempel, D.; Kunka, N.; Kusenko, A.; La Rosa, G.; Lachaud, C.; Lago, B. L.; Lebrun, D.; Lebrun, P.; Lee, J.; de Oliveira, M. A. Leigui; Letessier-Selvon, A.; Leuthold, M.; Lhenry-Yvon, I.; Lopez, R.; Aguera, A. Lopez; Bahilo, J. Lozano; Lucero, A.; Garcia, R. Luna; Maccarone, M. C.; Macolino, C.; Maldera, S.; Mancarella, G.; Mancenido, M. E.; Mandat, D.; Mantsch, P.; Mariazzi, A. G.; Maris, I. C.; Falcon, H. R. Marquez; Martello, D.; Martinez, J.; Bravo, O. Martinez; Mathes, H. J.; Matthews, J.; Matthews, J. A. J.; Matthiae, G.; Maurizio, D.; Mazur, P. O.; McCauley, T.; McEwen, M.; McNeil, R. R.; Medina, M. C.; Medina-Tanco, G.; Melo, D.; Menichetti, E.; Menschikov, A.; Meurer, C.; Meyhandan, R.; Micheletti, M. I.; Miele, G.; Miller, W.; Mollerach, S.; Monasor, M.; Ragaigne, D. Monnier; Montanet, F.; Morales, B.; Morello, C.; Moreno, J. C.; Morris, C.; Mostafa, M.; Muller, M. A.; Mussa, R.; Navarra, G.; Navarro, J. L.; Navas, S.; Necesal, P.; Nellen, L.; Newman-Holmes, C.; Newton, D.; Nhung, P. T.; Nierstenhoefer, N.; Nitz, D.; Nosek, D.; Nozka, L.; Oehlschlaeger, J.; Ohnuki, T.; Olinto, A.; Olmos-Gilbaja, V. M.; Ortiz, M.; Ortolani, F.; Ostapchenko, S.; Otero, L.; Pacheco, N.; Selmi-Dei, D. Pakk; Palatka, M.; Pallotta, J.; Parente, G.; Parizot, E.; Parlati, S.; Pastor, S.; Patel, M.; Paul, T.; Pavlidou, V.; Payet, K.; Pech, M.; Pekala, J.; Pelayo, R.; Pepe, I. M.; Perrone, L.; Pesce, R.; Petrera, S.; Petrinca, P.; Petrov, Y.; Pichel, A.; Piegaia, R.; Pierog, T.; Pimenta, M.; Pinto, T.; Pirronello, V.; Pisanti, O.; Platino, M.; Pochon, J.; Privitera, P.; Prouza, M.; Quel, E. J.; Rautenberg, J.; Redondo, A.; Reucroft, S.; Revenu, B.; Rezende, F. A. S.; Ridky, J.; Riggi, S.; Risse, M.; Riviere, C.; Rizi, V.; Roberts, M.; Robledo, C.; Rodriguez, G.; Martino, J. Rodriguez; Rojo, J. Rodriguez; Rodriguez-Cabo, I.; Rodriguez-Frias, M. D.; Ros, G.; Rosado, J.; Roth, M.; Rouille-d'Orfeuil, B.; Roulet, E.; Rovero, A. C.; Salamida, F.; Salazar, H.; Salina, G.; Sanchez, F.; Santander, M.; Santo, C. E.; Santos, E. M.; Sarazin, F.; Sarkar, S.; Sato, R.; Scherini, V.; Schieler, H.; Schmidt, A.; Schmidt, F.; Schmidt, T.; Scholten, O.; Schovanek, P.; Schroeder, F.; Schulte, S.; Schuessler, F.; Sciutto, S. J.; Scuderi, M.; Segreto, A.; Semikoz, D.; Settimo, M.; Shellard, R. C.; Sidelnik, I.; Siffert, B. B.; Sigl, G.; De Grande, N. Smetniansky; Smialkowski, A.; Smida, R.; Smith, A. G. K.; Smith, B. E.; Snow, G. R.; Sokolsky, P.; Sommers, P.; Sorokin, J.; Spinka, H.; Squartini, R.; Strazzeri, E.; Stutz, A.; Suarez, F.; Suomijaervi, T.; Supanitsky, A. D.; Sutherland, M. S.; Swain, J.; Szadkowski, Z.; Takahashi, J.; Tamashiro, A.; Tamburro, A.; Tarutina, T.; Tascau, O.; Tcaciuc, R.; Thao, N. T.; Thomas, D.; Ticona, R.; Tiffenberg, J.; Timmermans, C.; Tkaczyk, W.; Peixoto, C. J. Todero; Tome, B.; Tonachini, A.; Torres, I.; Travnicek, P.; Tripathi, A.; Tristram, G.; Tscherniakhovski, D.; Tuci, V.; Tueros, M.; Tunnicliffe, V.; Ulrich, R.; Unger, M.; Urban, M.; Galicia, J. F. Valdes; Valino, I.; Valore, L.; van den Berg, A. M.; van Elewyck, V.; Vazquez, R. A.; Veberic, D.; Veiga, A.; Velarde, A.; Venters, T.; Verzi, V.; Videla, M.; Villasenor, L.; Vorobiov, S.; Voyvodic, L.; Wahlberg, H.; Wahrlich, P.; Wainberg, O.; Walker, P.; Warner, D.; Watson, A. A.; Westerhoff, S.; Wieczorek, G.; Wiencke, L.; Wilczynska, B.; Wilczynski, H.; Wileman, C.; Winnick, M. G.; Wu, H.; Wundheiler, B.; Yamamoto, T.; Younk, P.; Zas, E.; Zavrtanik, D.; Zavrtanik, M.; Zaw, I.; Zepeda, A.; Ziolkowski, M.

    2008-01-01

    The energy spectrum of cosmic rays above 2.5 x 10(18) eV, derived from 20 000 events recorded at the Pierre Auger Observatory, is described. The spectral index gamma of the particle flux, J proportional to E(-gamma), at energies between 4 x 10(18) eV and 4 x 10(19) eV is 2.69 +/- 0.02(stat) +/- 0.06

  13. Proceedings of the Army Science Conference (14th) Held at the United States Military Academy, West Point, New York on 19-21 June 1984. Volume 3. Principal Authors P through Z.

    Science.gov (United States)

    1984-06-22

    91 Under Optical Countermeasures Fackler, Martin L. Visualization and Quantification of 1 269 Wounding Effects in Muscle Tissue with Gelatin Blocks...253 Johnson, Robert D. See Tofsted, David H. V 261 Keesee, Robin L. See Daws, Robert N., Jr. V 45 Keown , Malcolm P. Ground Penetrating Radar...I1 157 Lund, David J. See Stamper, David A. V 225 Lundien, Jerry R. See Keown , Malcolm P. IV 115 * Lu, Pai-Lien Investigation of Shaped Charge II 111

  14. Bibliography of Soviet Laser Developments, Number 59, May - June 1982.

    Science.gov (United States)

    1983-06-01

    Parametric Processes 181. Mishchenko, V.P. (84). Four-photon parametric processes at a degenerate transition in a magnetic field and their use for...laser coagulation interventions for macular pathology. OZh, no. 4, 1982, 209-211. 269. Kalmykov, P.G. (353). Effect of a laser and ultrashort electro... Rehabilitation of the Visually Impaired ( ’lskovskiy tsentr reabilitatsii invalidov po zreniyu). 680. Rostov Medical Institute (Rostovskiy meditsinskiy

  15. Psychiatric Genocide: Nazi Attempts to Eradicate Schizophrenia

    OpenAIRE

    Torrey, E. Fuller; Yolken, Robert H.

    2009-01-01

    Although the Nazi genocide of Jews during World War II is well known, the concurrent Nazi genocide of psychiatric patients is much less widely known. An attempt was made to estimate the number of individuals with schizophrenia who were sterilized and murdered by the Nazis and to assess the effect on the subsequent prevalence and incidence of this disease. It is estimated that between 220 000 and 269 500 individuals with schizophrenia were sterilized or killed. This total represents between 73...

  16. Violence, Burnout and Minor Psychiatric Disorders in Hospital Work

    OpenAIRE

    2015-01-01

    OBJECTIVE Identifying the violence suffered by the health team workers and their association with Burnout and minor psychiatric disorders. METHODS Cross-sectional study with 269 health team professionals of a public hospital in southern Brazil. Data were collected through the use of the Survey Questionnaire: Workplace Violence in the Health Sector, Maslach Inventory Burnout and Self-Report Questionnaire. RESULTS Workplace violence struck 63.2% of workers, prevailing mostly in women (p = 0.001...

  17. Mammographic Breast Density and Serum Phytoestrogen Levels

    OpenAIRE

    Lowry, Sarah J.; Sprague, Brian L; Bowles, Erin J. Aiello; Hedman, Curtis J.; Hemming, Jocelyn; Hampton, John M.; Burnside, Elizabeth S.; Sisney, Gale A.; Buist, Diana S. M.; Trentham-Dietz, Amy

    2012-01-01

    Some forms of estrogen are associated with breast cancer risk as well as with mammographic density (MD), a strong marker of breast cancer risk. Whether phytoestrogen intake affects breast density, however, remains unclear. We evaluated the association between serum levels of phytoestrogens and MD in postmenopausal women. We enrolled 269 women, ages 55–70 yr, who received a screening mammogram and had no history of postmenopausal hormone use. Subjects completed a survey on diet and factors rel...

  18. Dicty_cDB: Contig-U14945-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8788 |pid:none) Bacillus velezensis strain NRRL BD... 270 9e-71 EU138750_1( EU138...750 |pid:none) Bacillus velezensis strain NRRL B-... 270 9e-71 EU138764_1( EU138764 |pid:none) Bacillus velez...ensis strain NRRL BD... 269 2e-70 EU138732_1( EU138732 |pid:none) Bacillus velezensis strain NRRL B-... 268

  19. Digimyynnin haasteet Savon Sanomissa

    OpenAIRE

    2015-01-01

    Opinnäytetyön tavoitteena oli sanomalehti Savon Sanomien myynnin kehittäminen digitaalisten tuotteiden osalta. Työssä haluttiin selvittää mainostajien mielipiteet Savon Sanomien mainosvaihtoehdoista ja verkkomainonnasta yleensä. Savon Sanomat on Keskisuomalainen-konsernin Savon alueella ilmestyvä maakuntalehti, jonka kokonaistavoittavuus on 269 000 lukijaa. Tutkimuksen teoriaosuudessa käsiteltiin myyntiprosessia ja digitaalista markkinointia. Myyntiprosessia ja digitaalisen markkinoinnin ...

  20. Combustion and Fuels in Gas Turbine Engines

    Science.gov (United States)

    1988-06-01

    269 (July 1981) Rocket Altitude Test Facility Register AGARD AG 297 (March 1987) Manual for Aeroelasticity in Turbomachines AGARD AG 298/1 (March 1987...Technology Instituto Superior Tecnico Cranfield, Bedford MK43 OAL, UK Avenida Rovisco Pais 1096 Lisboa Codex, Portugal Professor L.De Luca Politecnico...automating the generation of the inlet swirler velocity boundary conditions thus eliminating the tedious task of generating the model input manually

  1. Marine Advisor Advantage: Institutionalizing Security Force Assistance

    Science.gov (United States)

    2013-04-16

    serve as a plank -holder in the formation of the Marine Corps Training and Advisory Group (MCTAG) which later merged with the Security Cooperation...Focus: The Future of Your Company Depends on It (New York: Harper Business, 1996), 269 54 Max Boot, The Savage Wars of Peace: Small Wars and the...Gazette, November, 2011, 44-47. Boot, Max . “Iraq’s Advisor Gap.” Los Angeles Times, October 18, 2006. Boot, Max . The Savage Wars of Peace

  2. Positron Lifetime Modulation by Electric Field Induced Positronium Formation on a Gold Surface

    Science.gov (United States)

    2012-03-22

    are oppositely charged. The intrinsic angular momentum of positrons is in half integer values of the Plank constant divided by 2π denoted ħ meaning...fit to that feature at half of the peak height typically referred to as the full width half max (FWHM). Resolution (6) (6) This was...ratio1 = (mean(waveform1))/ max (waveform1); int1 = sum(waveform1)*timewindow; if ( max (waveform1) <= 2.69) && (sum

  3. Reversible Suppression of Menstruation with Antiprogestins

    Science.gov (United States)

    1999-10-01

    proliferative effects of estradiol , resulting in reduced endometrial mass and thickness. No untoward effects of ZK 230 211 were detected in the...oviduct. Human Reproduction 1998; 13: 269-277. 10 Table 1. Endometral thickness, and myometrial and endometrial weight in E2 + ZK 230 211- treated...represent the mass from 1/4 of the uterus of each animal. Table 2. Endometral thickness, and myometrial and endometrial weight E2 + P+ ZK-treated

  4. A contribution to the knowledge of HMX decomposition and application of results. [at atmospheric pressure

    Science.gov (United States)

    Kraeutle, K. J.

    1980-01-01

    The decomposition of cyclotramethylenetetranitramine (HMX) in the solid and liquid phase was studied by isothermal and nonisothermal heating at atmospheric pressure. Decomposition rates of solid HMX changed with sample size and gaseous environment. Kinetic parameters were obtained from weight loss measurements in the temperature range 229 C - 269 C. These tests also yielded highly porous solid residues. Qualitative aspects of solid and liquid phase decomposition of HMX with additives were also investigated in isothermal and nonisothermal tests.

  5. Computational Thermodynamics Characterization of 7075, 7039, and 7020 Aluminum Alloys Using JMatPro

    Science.gov (United States)

    2011-09-01

    cooling transformation (CCT) diagrams. The main approach utilizes the well- known Johnson -Mehl-Avrami (2, 7) equation as follows: ⁄ 1 , (27) where is...BLDG 655 RM 115 2230 TENTH ST WRIGHT-PATTERSON AFB OH 45433-7817 1 AIR FORCE ARMAMENT LAB AFATL DLJW W COOK EGLIN AFB FL 32542...1 FOSTER-MILLER R SYKES 195 BEAR HILL RD WALTHAM MA 02451 1 RMI TITANIUM CO W PALLANTE PO BOX 269 1000 WARREN AVE NILES

  6. Domain Modeling: NP_001607.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001607.1 chr2 Crystal structure of Activin receptor type II kinase domain from h...uman p2qlua_ chr2/NP_001607.1/NP_001607.1_holo_192-485.pdb blast 198K,199A,206V,217A,247L,267T,268A,269F,270H,271E,273G,329L 322D,324K,326K __A 0 ...

  7. A Review of Anthropometric Data of German Air Force and United States Air Force Flying Personnel 1967-1968

    Science.gov (United States)

    1975-04-01

    BREADTH .12q .27? .364 .258 .227 417 .292 .135 .453 .465 43 CHEST CEFTH -",6i .152 ,.66 &222 .113 e297 .213 .03’ .412 .347 44 WAIST CEFTH .1139 .070...225 *330 .188 .151 127 MAX HEAD U"AG/MF NT .223 .2115 e127 .210 e297 o15 .S 311 .306 .217 b235 128 MAX HEAO LJIAG/NUCH .108 o269 .134 .074 .223 .156

  8. The moderating effects of contact with lesbian and gay friends on the relationships among religious fundamentalism, sexism, and sexual prejudice.

    Science.gov (United States)

    Cunningham, George B; Melton, E Nicole

    2013-01-01

    The purpose of this study was to examine the degree to which contact with lesbian and gay friends moderated the effects of religious fundamentalism and sexism on sexual prejudice. The authors gathered data from 269 heterosexual adults living in Texas. Results indicate that the effects of religious fundamentalism on sexual prejudice were reduced when contact was high. However, the positive association between modern sexism and sexual prejudice was not moderated by contact. The authors discuss theoretical and practical implications.

  9. Prevention of Ovarian High Grade Serous Carcinoma by Elucidating Its Early Changes

    Science.gov (United States)

    2015-10-01

    associated precursor lesions are modifiable by oral contraceptives (OCPs) or anti- inflammatory agents as OCPs in particular are known to prevent ovarian...all patients in study was 26.9 months (range, 0.3-52.7). Of those with STIC lesions , 70 (75.3%) were reported in the original pathology report; 23...representative tubal sections, 8 (6%) were tubal carcinomas without STIC lesions , and 79 (59%) are pending review. After pathologic re-review of cases

  10. Coordinating Information and Decisions of Hierarchical Distributed Decision Units in Crises

    Science.gov (United States)

    1997-08-01

    Creating conditions for effective teamwork , 449-504. Hackman , J. (1968). Effects of task characteristics on group products. Journal...and those that don’t): Creating conditions for effective teamwork . San Francisco: Jossey-Bass, 427-448. Ginnett, R. (1993). Crews as groups: Their...Psychology, 2nd edition, 3, 269-313. Hackman , J. ( 1990 ). Creating more effective work groups in organizations. In Hackman , J. (Ed.),

  11. On the complete convergence for weighted sums of a class of random variables

    Directory of Open Access Journals (Sweden)

    Jinghuan Zhao

    2016-09-01

    Full Text Available Abstract In this article, some new results as regards complete convergence for weighted sums ∑ i = 1 n a n i X i $\\sum_{i=1}^{n}a_{ni}X_{i}$ of random variables satisfying the Rosenthal type inequality are established under some mild conditions. These results extend the corresponding theorems of Deng et al. (Filomat 28(3:509-522, 2014 and Gan and Chen (Acta Math. Sci. 28(2:269-281, 2008.

  12. Outcome and medical costs of patients with invasive aspergillosis and acute myelogenous leukemia-myelodysplastic syndrome treated with intensive chemotherapy: An observational study

    OpenAIRE

    Slobbe, Lennert; Polinder, Suzanne; Doorduijn, Jeanette; Lugtenburg, Pieternella; Barzouhi, Abdelilah; Steyerberg, Ewout; Rijnders, Bart

    2008-01-01

    textabstractBackground. Invasive aspergillosis (IA) is a leading cause of mortality in patients with acute leukemia. Management of IA is expensive, which makes prevention desirable. Because hospital resources are limited, prevention costs have to be compared with treatment costs and outcome. Methods. In 269 patients treated for acute myelogenous leukemia-myelodysplastic syndrome (AML-MDS) during 2002-2007, evidence of IA was collected using high-resolution computed tomography and galactomanna...

  13. Stochastic Orbit Prediction Using KAM Tori

    Science.gov (United States)

    2011-03-24

    central body (like the rings of Saturn ), or coalesce into a moon or planet. Hannes Alfvén famously described this coalescing of debris using apples...collision, the smashed remnants lose their inclination and eccentricity until eventually a cloud of dust orbits in a ring about the equator of the...269) One method to verify the two-body analytical formation of ⃑ ⃑ ⁄ is to numerically differentiate a

  14. A single amino acid difference between alpha and beta Ca2+/calmodulin-dependent protein kinase kinase dictates sensitivity to the specific inhibitor, STO-609.

    Science.gov (United States)

    Tokumitsu, Hiroshi; Inuzuka, Hiroyuki; Ishikawa, Yumi; Kobayashi, Ryoji

    2003-03-28

    We recently developed STO-609, a selective inhibitor of Ca(2+)/calmodulin-dependent protein kinase kinase (CaM-KK), and we demonstrated that CaM-KK beta is more sensitive to STO-609 than the CaM-KK alpha isoform (Tokumitsu H., Inuzuka H., Ishikawa Y., Ikeda M., Saji I., and Kobayashi R. (2002) J. Biol. Chem. 277, 15813-15818). By using catalytic chimera and point mutants of both isoforms, we demonstrated that Val(269) in CaM-KK beta/Leu(233) in CaM-KK alpha confers a distinct sensitivity ( approximately 10-fold) to STO-609 on CaM-KK isoforms. Various mutations of Val(269) in CaM-KK beta indicate that substitution by hydrophobic residues with bulky side chains significantly decreases drug sensitivity and that the V269F mutant is the most effective drug-resistant enzyme ( approximately 80-fold higher IC(50) value). These findings are consistent with a result obtained with a full-length mutant expressed in COS-7 cells. Furthermore, suppression of CaM-KK-mediated CaM-KIV activation in transfected HeLa cells by STO-609 treatment was completely abolished by the co-expression of the CaM-KK beta V269F mutant. Based on the results that the distinct sensitivity of CaM-KK isoforms to STO-609 is because of a single amino acid substitution (Val/Leu) in the ATP-binding pocket, we have generated an STO-609-resistant CaM-KK mutant, which might be useful for validating the pharmacological effects and specificity of STO-609 in vivo.

  15. Frequent manual repositioning and incidence of pressure ulcers among bedbound elderly hip fracture patients

    OpenAIRE

    Rich, Shayna E.; Margolis, David; Shardell, Michelle; Hawkes, William G; Miller, Ram R.; Amr, Sania; Baumgarten, Mona

    2010-01-01

    Frequent manual repositioning is an established part of pressure ulcer (PU) prevention, but there is little evidence for its effectiveness. This study examined the association between repositioning and PU incidence among bedbound elderly hip fracture patients, using data from a 2004–2007 cohort study in nine Maryland and Pennsylvania hospitals. Eligible patients (n=269) were age≥65 years, underwent hip fracture surgery, and were bedbound at index study visits (during the first five days of ho...

  16. Evaluation of noni (Morinda citrifolia) volatile profile by dynamic headspace and gas chromatography-mass spectrometry

    OpenAIRE

    Sousa, A.; M. A. SOUZA NETO; GARRUTI, D. dos S.; Sousa, J. A.; BRITO, E. S. de

    2010-01-01

    Noni is a fruit that has interested the scientific community due to its medicinal and functional activities. Different products that contain noni are already in the market, but their consumption could be impaired by their distinctive unpleasant aroma and flavor. The aim of this work was to evaluate the noni pulp volatile profile by dynamic headspace and gas chromatography-mass spectrometry. Thirty seven volatile compounds were detected, mainly alcohols (63.3%), esters (26.9%), cetones (7.4%),...

  17. RHELP (Regenerative High Efficiency Low Pressure) Air Purification System

    Science.gov (United States)

    2009-06-18

    4 (3), 269. 10. Allen, M. D. and Raabe, O. G., "Re-evaluation of millikan’s oil drop data for the motion of small particles in air," Journal of...rigorous physical filtration testing for collection efficiency, pressure drop , most penetrating particle size, and microwave sensitivity, among other...increased quality factor. More importantly, the synthesized filters were found to exceed military standards for HEPA filter with lower pressure drop . This

  18. International Symposium On the Ecological Effects of Arctic Airborne Contaminants, held in Reykjavik, Iceland on October 4 - 8, 1993. Abstracts

    Science.gov (United States)

    1993-10-08

    AD-A269 955 0nal On The Ecological Effects of Arctic Airborne Contaminants Hotel Saga ’ Reykjavik, Iceland October 4-8, 1993 DT I C_ F. ELECTE...EDITIONS ARE OBSOLETE DEC 91 International Symposium On The Ecological Effects ofArctic Airborne Contaminants Accesion For Hotel Saga * Reykjavik, Iceland...foregoing effect might be most significant in the Arctic and Antarctic. Mt. McKinley in the twilight sky, taken from Fairbanks, Alaska, just below the

  19. EST Table: FY018987 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ribosome biogenesis protein brix [Nasonia vitripennis] 11/11/04 65 %/216 aa FBpp0127933|DanaGF24741-PA 11/11...1/04 65 %/217 aa gnl|Amel|GB12626-PA 11/11/04 60 %/269 aa gi|91090402|ref|XP_970542.1| PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS825195 bmov ...

  20. Fully Coupled Thermomechanical Finite Element Analysis of Material Evolution During Friction-Stir Welding of AA5083

    Science.gov (United States)

    2009-09-03

    Sharma, S. R., and Mishra, R. S. Effect of friction stir processing on the microstructure of cast A356 aluminum . Mater. Sci. Engng A, 2006, 433, 269...J. and Thomas, W. M. Friction stir process welds aluminum alloys. Welding J., 1996, 75, 41–52. 3 Thomas, W. M. and Dolby, R. E. Friction stir welding...273. 8 Su, J. Q., Nelson, T. W., Mishra, R., and Mahoney, M. Microstructural investigation of friction stir welded 7050-T651 aluminum . Acta Mater., 2003

  1. Computational Investigation of Hardness Evolution During Friction-Stir Welding of AA5083 and AA2139 Aluminum Alloys

    Science.gov (United States)

    2011-01-01

    and R.S. Mishra, Effect of Friction Stir 940Processing on the Microstructure of Cast A356 Aluminum , Mater. Sci. 941Eng. A, 2006, 433, p 269–278...REPORT Computational Investigation of Hardness Evolution During Friction-Stir Welding of AA5083 and AA2139 Aluminum Alloys 14. ABSTRACT 16. SECURITY...is combined with the basic physical metallurgy of two wrought aluminum alloys to predict/assess their FSW behaviors. The two alloys selected are AA5083

  2. Public Affairs Career Field AFSCs 791X0, 791X1, and 791X2.

    Science.gov (United States)

    1985-09-01

    video materials for postproduction personnel. A more senior group (NCOICs and Managers job type) of personnel serve as TV producers. They uniquely edit...TIMING, AND SEQUENCING OF VIDEO MATERIALS FOR TELEVISION POSTPRODUCTION EDITING 7 33 -26 M416 DIRECT VIDEOTAPE EDITING 14 40 -26 G269 WRITE TELEVISION...DRUMS 63 M414 DETERMINE SELECTION, TIMING, AND SEQUENCING OF VIDEO MATERIALS FOR TELEVISION POSTPRODUCTION EDITING 63 L383 EDIT OR SPLICE AUDIO TAPES

  3. Changing scenario of micronutrient deficiencies in India during four decades and its impact on crop responses and nutritional health of human and animals

    OpenAIRE

    M. V. Singh; Narwal, R P; G, Bhupal Raj; Patel, K P; Sadana, U S

    2009-01-01

    Changing scenario of micronutrient deficiencies phase wise during four decades (1968-2008) was studied in soils of India, their impact of crop production and changes in micronutrient concentration in seeds and fodders, thereby influences on animal and human health. Results of 269,000 soil sample analysis revealed that mean deficiency of zinc, iron, copper, manganese, boron, molybdenum was found in 49, 12, 3, 5, 33 and 13% samples, respectively. Throughout country, zinc deficiency is increasin...

  4. Immobilization of Pepsin onto Chitosan Silica Nanobeads with Glutaraldehyde as Crosslink Agent

    Directory of Open Access Journals (Sweden)

    Sari Edi Cahyaningrum

    2014-10-01

    Full Text Available Glutaraldehyde crosslinked chitosan - silica nanobeads have been used as a support in the immobiliza-tion process of pepsin. The effect of pH, pepsin concentration, and temperature on the characteristics of both free and immobilized pepsin had been investigated in this study. The results showed that the im-mobilized pepsin has wider pH range, better capacity, performance and stability to high temperatures compared with those of free pepsin. The immobilized pepsin can be used for 8 to 10 times at which the activity remains 20%, whereas the free pepsin can only be used once. These results suggested promis-ing applications of immobilized enzyme as biocatalyst. © 2014 BCREC UNDIP. All rights reserved.Received: 1st July 2014; Revised: 3rd September 2014; Accepted: 3rd September 2014How to Cite: Cahyaningrum, S.E., Sianita, M.M. (2014. Immobilization of Pepsin onto Chitosan Silica Nanobeads with Glutaraldehyde as Crosslink Agent. Bulletin of Chemical Reaction Engineering & Catalysis, 9 (3: 263-269. (doi:10.9767/bcrec.9.3.7060.263-269 Permalink/DOI: http://dx.doi.org/10.9767/bcrec.9.3.7060.263-269

  5. A novel presenilin-1 mutation: increased beta-amyloid and neurofibrillary changes.

    Science.gov (United States)

    Gómez-Isla, T; Wasco, W; Pettingell, W P; Gurubhagavatula, S; Schmidt, S D; Jondro, P D; McNamara, M; Rodes, L A; DiBlasi, T; Growdon, W B; Seubert, P; Schenk, D; Growdon, J H; Hyman, B T; Tanzi, R E

    1997-06-01

    The prevalence of known mutations in presenilin genes (PS1 and PS2) causing early-onset familial Alzheimer's disease (FAD) was assessed in a population of 98 singleton early-onset AD cases, 29 early-onset FAD cases, and 15 late-onset FAD cases. None of the cases tested positive for the eight mutations initially reported, and none of these mutations were observed in 60 age-matched controls. A novel mutation (R269H) in PS1 was found in a single case of early-onset AD but not in any other AD or control case. Thus, the PS mutations tested are quite rare in early-onset AD. Amyloid beta protein (A beta) deposition was investigated in the temporal cortex of the R269H mutation case using end-specific monoclonal antibodies to detect the presence of A beta x-40 and A beta x-42 subspecies. Stereologically unbiased tangle and neuropil thread counts were obtained from the same region. R269H PS1 mutation was associated with early age of dementia onset, higher amounts of total A beta and A beta x-42, and increased neuronal cytoskeletal changes. Thus, if the changes observed on this case prove to be typical of PS1 mutations, PS1 mutations may impact both amyloid deposition and neurofibrillary pathology.

  6. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......, the DHQs were accompanied by six histrionicotoxins (HTXs), viz., 283A, 285A, 285B, 285C, 287A, and 287D. This co-occurrence of the HTX and DHQ alkaloids is the usual pattern seen in dendrobatid frogs. This finding contrasts with our earlier study, where workers of a Brazilian ant, Solenopsis (Diplorhoptrum......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...

  7. MEASURING CUSTOMER’S SATISFACTION ON BUS TRANSPORTATION

    Directory of Open Access Journals (Sweden)

    Rabiul Islam

    2014-01-01

    Full Text Available The purpose of the study is to examine the factors measuring customers’ satisfaction, especially the impact of service quality on customers’ satisfaction in public transportation industry in the university town of Sintok located in Kedah province of Malaysia. In order to assess the relationships between service quality and customer satisfaction survey http://www.scientificjournals.org/journals2007/articles/1003.htmdata were collected from 300 Bus commuters. All hypotheses were tested using Pearson correlations, controlling for the background variables of gender, marital status, ethnicity and education. The results indicate that hypotheses 1 through 5 were supported. Using multiple regressions as a basis for causal paths, a model was developed that examined the influence of all five dimensions of service quality on customers’ satisfaction. The model explained 26.9% of the variance which indicates that 26.9% of the changes in the dependent variable are explained by the independent variables. Altogether, independent variables explained 26.9% of the variations.

  8. Identification of novel TFG mutation in HMSN-P pedigree: Emphasis on variable clinical presentations.

    Science.gov (United States)

    Khani, Marzieh; Shamshiri, Hosein; Alavi, Afagh; Nafissi, Shahriar; Elahi, Elahe

    2016-10-15

    We aimed to identify the genetic cause of neurological disease in an Iranian pedigree whose manifestations suggested hereditary motor and sensory neuropathy with proximal predominance (HMSN-P). Identification of a p.Gly269Val mutation in TFG, the known HMSN-P causative gene, provided supportive evidence. Subjective, biochemical, electrodiagnostic, and imaging data were compared with previously reported HMSN-P patients, including patients of an earlier described Iranian pedigree. Although notable clinical variability was found, comparable involvement of proximal and distal muscles was observed in both Iranian pedigrees. Interestingly, the same p.Gly269Val mutation was recently reported as cause of Charcot-Marie-Tooth disease type 2 in a Taiwanese pedigree. The likelihood that the two pedigrees with the p.Gly269Val mutation are not affected with different diseases is discussed. Identification of a second Iranian HMSN-P pedigree further confirms that HMSN-P is not confined to the Far East. Furthermore, p.Pro285Leu that has been the only TFG mutation thus far reported in HMSN-P patients is not the only mutation that can cause the disease. It is emphasized HMSN-P is a neuronopathy. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. A novel nonsense mutation of the GPR143 gene identified in a Chinese pedigree with ocular albinism.

    Directory of Open Access Journals (Sweden)

    Naihong Yan

    Full Text Available BACKGROUND: The purpose of this study was to elucidate the molecular basis of ocular albinism type I in a Chinese pedigree. METHODOLOGY/PRINCIPAL FINDINGS: Complete ophthalmologic examinations were performed on 4 patients, 7 carriers and 17 unaffected individuals in this five-generation family. All coding exons of four-point-one (4.1, ezrin, radixin, moesin (FERM domain-containing 7 (FRMD7 and G protein-coupled receptor 143 (GPR143 genes were amplified by polymerase chain reaction (PCR, sequenced and compared with a reference database. Ocular albinism and nystagmus were found in all patients of this family. Macular hypoplasia was present in the patients including the proband. A novel nonsense hemizygous mutation c.807T>A in the GPR143 gene was identified in four patients and the heterozygous mutation was found in seven asymptomatic individuals. This mutation is a substitution of tyrosine for adenine which leads to a premature stop codon at position 269 (p.Y269X of GPR143. CONCLUSIONS/SIGNIFICANCE: This is the first report that p.Y269X mutation of GPR143 gene is responsible for the pathogenesis of familial ocular albinism. These results expand the mutation spectrum of GPR143, and demonstrate the clinical characteristics of ocular albinism type I in Chinese population.

  10. Stimulation of fat storage by prostacyclin and selective agonists of prostanoid IP receptor during the maturation phase of cultured adipocytes.

    Science.gov (United States)

    Khan, Ferdous; Syeda, Pinky Karim; Nartey, Michael Nii N; Rahman, Mohammad Shahidur; Islam, Mohammad Safiqul; Nishimura, Kohji; Jisaka, Mitsuo; Shono, Fumiaki; Yokota, Kazushige

    2016-12-01

    We have previously shown that cultured adipocytes have the ability to biosynthesize prostaglandin (PG) I2 called alternatively as prostacyclin during the maturation phase by the positive regulation of gene expression of PGI synthase and the prostanoid IP receptor. To clarify how prostacyclin regulates adipogenesis, we investigated the effects of prostacyclin and the specific agonists or antagonists for the IP receptor on the storage of fats during the maturation phase of cultured adipocytes. Exogenous PGI2 and the related selective agonists for the IP receptor including MRE-269 and treprostinil rescued the storage of fats attenuated by aspirin, a cyclooxygenase inhibitor. On the other hand, selective antagonists for IP such as CAY10441 and CAY10449 were effective to suppress the accumulation of fats as GW9662, a specific antagonist for peroxisome proliferator-activated receptor (PPAR)γ. Thus, pro-adipogenic action of prostacyclin can be explained by the action mediated through the IP receptor expressed at the maturation stage of adipocytes. Cultured adipocytes incubated with each of PGI2 and MRE-269 together with troglitazone, an activator for PPARγ, exhibited additively higher stimulation of fats storage than with either compound alone. The combined effect of MRE-269 and troglitazone was almost abolished by co-incubation with GW9662, but not with CAY10441. Increasing concentrations of troglitazone were found to reverse the inhibitory effect of CAY10441 in a dose-dependent manner while those of MRE-269 failed to rescue adipogenesis suppressed by GW9662, indicating the critical role of the PPARγ activation as a downstream factor for the stimulated adipogenesis through the IP receptor. Treatment of cultured adipocytes with cell permeable stable cAMP analogues or forskolin as a cAMP elevating agent partly restored the inhibitory effect of aspirin. However, excess levels of cAMP stimulated by forskolin attenuated adipogenesis. Supplementation with H-89, a cell

  11. Atherosclerotic ischemic renal disease. Diagnosis and prevalence in an hypertensive and/or uremic elderly population

    Directory of Open Access Journals (Sweden)

    Rossi Michele

    2003-02-01

    Full Text Available Abstract Background Atherosclerotic ischemic renal disease is a frequent cause of end-stage renal failure leading to dialysis among the elderly; Its prevalence is inferred from autopsy or retrospective arteriographic studies. This study has been conducted on 269 subjects over 50 with hypertension and/or CRF, unrelated to other known causes of renal disease. Methods All 269 patients were studied either by color-flow duplex sonography (n = 238 or by renal scintigraphy (n = 224, and 199 of the 269 patients were evaluated using both of these techniques. 40 patients, found to have renal artery stenosis (RAS, were subjected to 3D-contrast enhancement Magnetic Resonance Angiography (MRA and/or Selective Angiography (SA. An additional 23 cases, negative both to scintigraphy and to ultrasound study, underwent renal angiography (MRA and/or SA. Results Color-duplex sonography, carried out in 238 patients, revealed 49 cases of RAS. MR or SA was carried out in 35 of these 49 patients, and confirmed the diagnosis in 33. Color-duplex sonography showed a PPV value of 94.3% and NPV of 87.0% while renal scintigraphy, carried out in 224 patients, had a PPV of 72.2% and a NPV of 29.4%. Patients with RAS showed a higher degree of renal insufficiency compared to non stenotic patients while there were no differences in proteinuria. RAS, based on color-duplex sonography studies, was present in 11% of patients in the age group 50–59, 18% in the 60–69 and 23% at age 70 and above. Conclusions A relatively large percentage of the elderly population with renal insufficiency and/or hypertension is affected by RAS and is at risk of developing end-stage renal failure. Color-duplex ultrasonography is a valid routine method of investigation of population at risk for renal artery stenosis.

  12. The molecular profile of metastatic melanoma in Australia.

    Science.gov (United States)

    Lyle, Megan; Haydu, Lauren E; Menzies, Alexander M; Thompson, John F; Saw, Robyn P M; Spillane, Andrew J; Kefford, Richard F; Mann, Graham J; Cooper, Wendy A; Yu, Bing; Scolyer, Richard A; O'Toole, Sandra A; Long, Georgina V

    2016-02-01

    Targeted therapy directed at driver oncogenic mutations offers an effective treatment option for select patients with metastatic melanoma. The aim of this study was to assess the prevalence of clinically significant somatic mutations, specifically BRAF, NRAS and KIT, in a large cohort of Australian patients with metastatic melanoma. We performed a cross-sectional cohort study of consecutive patients with American Joint Committee on Cancer (AJCC) stage IIIc unresectable or stage IV melanoma managed at Melanoma Institute Australia, and affiliated sites, that underwent molecular testing between 22 June 2009 and 19 July 2013. Additionally, we examined the change in BRAF testing methodology and patient population over time, and how this influenced the prevalence of mutations. A total of 767 molecular tests were conducted for 733 patients. BRAF V600 mutation testing was performed for 713 patients (97.2%), with an overall mutation prevalence of 37.7% (269/713); 74.3% (200/269) were the V600E genotype and 22.3% (60/269) V600K. The BRAF mutation prevalence and proportion of BRAF V600E and V600K genotypes varied across the study period, as did testing methodology and the median age of the cohorts. Of 222 patients who underwent NRAS testing, 58 (26.1%) had a mutation identified. The overall prevalence of KIT mutations was 3.7% (11/296). In Australia the prevalence of BRAF mutations is lower than initially reported, although this remains the most common mutation identified in metastatic melanoma and an important therapeutic target. NRAS mutations are more prevalent than initially described; however, other mutations reported in melanoma, including KIT, are rare in an unselected population of patients.

  13. Metabolism and pharmacokinetics of indacaterol in humans.

    Science.gov (United States)

    Kagan, Mark; Dain, Jeremy; Peng, Lana; Reynolds, Christine

    2012-09-01

    The metabolism, pharmacokinetics, and excretion of [(14)C]indacaterol were investigated in healthy male subjects. Although indacaterol is administered to patients via inhalation, the dose in this study was administered orally. This was done to avoid the complications and concerns associated with the administration of a radiolabeled compound via the inhalation route. The submilligram doses administered in this study made metabolite identification and structural elucidation by mass spectrometry especially challenging. In serum, the mean t(max), C(max), and AUC(0-last) values were 1.75 h, 0.47 ng/ml, and 1.81 ng · h/ml for indacaterol and 2.5 h, 1.4 ngEq/ml, and 27.2 ngEq · h/ml for total radioactivity. Unmodified indacaterol was the most abundant drug-related compound in the serum, contributing 30% to the total radioactivity in the AUC(0-24h) pools, whereas monohydroxylated indacaterol (P26.9), the glucuronide conjugate of P26.9 (P19), and the 8-O-glucuronide conjugate of indacaterol (P37) were the most abundant metabolites, with each contributing 4 to 13%. In addition, the N-glucuronide (2-amino) conjugate (P37.7) and two metabolites (P38.2 and P39) that resulted from the cleavage about the aminoethanol group linking the hydroxyquinolinone and diethylindane moieties had a combined contribution of 12.5%. For all four subjects in the study, ≥90% of the radioactivity dose was recovered in the excreta (85% in feces and 10% in urine, mean values). In feces, unmodified indacaterol and metabolite P26.9 were the most abundant drug-related compounds (54 and 17% of the dose, respectively). In urine, unmodified indacaterol accounted for ∼0.3% of the dose, with no single metabolite accounting for >1.3%.

  14. High-Performance Monopropellants and Catalysts Evaluated

    Science.gov (United States)

    Reed, Brian D.

    2004-01-01

    The NASA Glenn Research Center is sponsoring efforts to develop advanced monopropellant technology. The focus has been on monopropellant formulations composed of an aqueous solution of hydroxylammonium nitrate (HAN) and a fuel component. HAN-based monopropellants do not have a toxic vapor and do not need the extraordinary procedures for storage, handling, and disposal required of hydrazine (N2H4). Generically, HAN-based monopropellants are denser and have lower freezing points than N2H4. The performance of HAN-based monopropellants depends on the selection of fuel, the HAN-to-fuel ratio, and the amount of water in the formulation. HAN-based monopropellants are not seen as a replacement for N2H4 per se, but rather as a propulsion option in their own right. For example, HAN-based monopropellants would prove beneficial to the orbit insertion of small, power-limited satellites because of this propellant's high performance (reduced system mass), high density (reduced system volume), and low freezing point (elimination of tank and line heaters). Under a Glenn-contracted effort, Aerojet Redmond Rocket Center conducted testing to provide the foundation for the development of monopropellant thrusters with an I(sub sp) goal of 250 sec. A modular, workhorse reactor (representative of a 1-lbf thruster) was used to evaluate HAN formulations with catalyst materials. Stoichiometric, oxygen-rich, and fuelrich formulations of HAN-methanol and HAN-tris(aminoethyl)amine trinitrate were tested to investigate the effects of stoichiometry on combustion behavior. Aerojet found that fuelrich formulations degrade the catalyst and reactor faster than oxygen-rich and stoichiometric formulations do. A HAN-methanol formulation with a theoretical Isp of 269 sec (designated HAN269MEO) was selected as the baseline. With a combustion efficiency of at least 93 percent demonstrated for HAN-based monopropellants, HAN269MEO will meet the I(sub sp) 250 sec goal.

  15. Endoplasmic reticulum protein quality control is determined by cooperative interactions between Hsp/c70 protein and the CHIP E3 ligase.

    Science.gov (United States)

    Matsumura, Yoshihiro; Sakai, Juro; Skach, William R

    2013-10-25

    The C terminus of Hsp70 interacting protein (CHIP) E3 ligase functions as a key regulator of protein quality control by binding the C-terminal (M/I)EEVD peptide motif of Hsp/c70(90) with its N-terminal tetratricopeptide repeat (TPR) domain and facilitating polyubiquitination of misfolded client proteins via its C-terminal catalytic U-box. Using CFTR as a model client, we recently showed that the duration of the Hsc70-client binding cycle is a primary determinant of stability. However, molecular features that control CHIP recruitment to Hsp/c70, and hence the fate of the Hsp/c70 client, remain unknown. To understand how CHIP recognizes Hsp/c70, we utilized a dominant negative mutant in which loss of a conserved proline in the U-box domain (P269A) eliminates E3 ligase activity. In a cell-free reconstituted ER-associated degradation system, P269A CHIP inhibited Hsc70-dependent CFTR ubiquitination and degradation in a dose-dependent manner. Optimal inhibition required both the TPR and the U-box, indicating cooperativity between the two domains. Neither the wild type nor the P269A mutant changed the extent of Hsc70 association with CFTR nor the dissociation rate of the Hsc70-CFTR complex. However, the U-box mutation stimulated CHIP binding to Hsc70 while promoting CHIP oligomerization. CHIP binding to Hsc70 binding was also stimulated by the presence of an Hsc70 client with a preference for the ADP-bound state. Thus, the Hsp/c70 (M/I)EEVD motif is not a simple anchor for the TPR domain. Rather CHIP recruitment involves reciprocal allosteric interactions between its TPR and U-box domains and the substrate-binding and C-terminal domains of Hsp/c70.

  16. Prolonged university outbreak of meningococcal disease associated with a serogroup B strain rarely seen in the United States.

    Science.gov (United States)

    Mandal, Sema; Wu, Henry M; MacNeil, Jessica R; Machesky, Kimberly; Garcia, Jocelyn; Plikaytis, Brian D; Quinn, Kim; King, Larry; Schmink, Susanna E; Wang, Xin; Mayer, Leonard W; Clark, Thomas A; Gaskell, James R; Messonnier, Nancy E; DiOrio, Mary; Cohn, Amanda C

    2013-08-01

    College students living in residential halls are at increased risk of meningococcal disease. Unlike that for serogroups prevented by quadrivalent meningococcal vaccines, public health response to outbreaks of serogroup B meningococcal disease is limited by lack of a US licensed vaccine. In March 2010, we investigated a prolonged outbreak of serogroup B disease associated with a university. In addition to case ascertainment, molecular typing of isolates was performed to characterize the outbreak. We conducted a matched case-control study to examine risk factors for serogroup B disease. Five controls per case, matched by college year, were randomly selected. Participants completed a risk factor questionnaire. Data were analyzed using conditional logistic regression. Between January 2008 and November 2010, we identified 13 meningococcal disease cases (7 confirmed, 4 probable, and 2 suspected) involving 10 university students and 3 university-linked persons. One student died. Ten cases were determined to be serogroup B. Isolates from 6 confirmed cases had an indistinguishable pulsed-field gel electrophoresis pattern and belonged to sequence type 269, clonal complex 269. Factors significantly associated with disease were Greek society membership (matched odds ratio [mOR], 15.0; P = .03), >1 kissing partner (mOR, 13.66; P = .03), and attending bars (mOR, 8.06; P = .04). The outbreak was associated with a novel serogroup B strain (CC269) and risk factors were indicative of increased social mixing. Control measures were appropriate but limited by lack of vaccine. Understanding serogroup B transmission in college and other settings will help inform use of serogroup B vaccines currently under consideration for licensure.

  17. External loops at the ferredoxin-NADP(+) reductase protein-partner binding cavity contribute to substrates allocation.

    Science.gov (United States)

    Sánchez-Azqueta, Ana; Martínez-Júlvez, Marta; Hervás, Manuel; Navarro, José A; Medina, Milagros

    2014-02-01

    Ferredoxin-NADP(+) reductase (FNR) is the structural prototype of a family of FAD-containing reductases that catalyze electron transfer between low potential proteins and NAD(P)(+)/H, and that display a two-domain arrangement with an open cavity at their interface. The inner part of this cavity accommodates the reacting atoms during catalysis. Loops at its edge are highly conserved among plastidic FNRs, suggesting that they might contribute to both flavin stabilization and competent disposition of substrates. Here we pay attention to two of these loops in Anabaena FNR. The first is a sheet-loop-sheet motif, loop102-114, that allocates the FAD adenosine. It was thought to determine the extended FAD conformation, and, indirectly, to modulate isoalloxazine electronic properties, partners binding, catalytic efficiency and even coenzyme specificity. The second, loop261-269, contains key residues for the allocation of partners and coenzyme, including two glutamates, Glu267 and Glu268, proposed as candidates to facilitate the key displacement of the C-terminal tyrosine (Tyr303) from its stacking against the isoalloxazine ring during the catalytic cycle. Our data indicate that the main function of loop102-114 is to provide the inter-domain cavity with flexibility to accommodate protein partners and to guide the coenzyme to the catalytic site, while the extended conformation of FAD must be induced by other protein determinants. Glu267 and Glu268 appear to assist the conformational changes that occur in the loop261-269 during productive coenzyme binding, but their contribution to Tyr303 displacement is minor than expected. Additionally, loop261-269 appears a determinant to ensure reversibility in photosynthetic FNRs. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Structure of the buffalo secretory signalling glycoprotein at 2.8 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Ethayathulla, Abdul S.; Srivastava, Devendra B.; Kumar, Janesh; Saravanan, Kolandaivelu; Bilgrami, Sameeta; Sharma, Sujata; Kaur, Punit; Srinivasan, Alagiri; Singh, Tej P., E-mail: tps@aiims.aiims.ac.in [Department of Biophysics, All India Institute of Medical Sciences, New Delhi 110029 (India)

    2007-04-01

    The crystal structure of a signalling glycoprotein isolated from buffalo dry secretions (SPB-40) has been determined at 2.8 Å resolution. Two unique residues, Tyr120 and Glu269, found in SPB-40 distort the shape of the sugar-binding groove considerably. The water structure in the groove is also different. The conformations of three flexible loops, His188–His197, Phe202–Arg212 and Tyr244–Pro260, also differ from those found in other structurally similar proteins. The crystal structure of a 40 kDa signalling glycoprotein from buffalo (SPB-40) has been determined at 2.8 Å resolution. SPB-40 acts as a protective signalling factor by binding to viable cells during the early phase of involution, during which extensive tissue remodelling occurs. It was isolated from the dry secretions of Murrah buffalo. It was purified and crystallized using the hanging-drop vapour-diffusion method with 19% ethanol as the precipitant. The protein was also cloned and its complete nucleotide and amino-acid sequences were determined. When compared with the sequences of other members of the family, the sequence of SPB-40 revealed two very important mutations in the sugar-binding region, in which Tyr120 changed to Trp120 and Glu269 changed to Trp269. The structure showed a significant distortion in the shape of the sugar-binding groove. The water structure in the groove is also drastically altered. The folding of the protein chain in the flexible region comprising segments His188–His197, Phe202–Arg212 and Tyr244–Pro260 shows large variations when compared with other proteins of the family.

  19. Improving MILSATCOM (Military Satellite Communication) Acquisition Outcomes: Lease versus Buy,

    Science.gov (United States)

    1985-01-01

    Economic Organization," American Economic Review , Vol. 62, No. 5, December 1q72. Arrow, K. J., "Discounting and Public Investment Criteria," in A. V...Praeger, New York, 1972, pp. 269-293. Baumol, W. J., "On the Social Rate of Discount," American Economic Review , Vol. 58, 1968, pp. 788-802. Bradford...D. F., "Constraints on Government Investment Opportunities and the Choice of Discount Rate," American Economic Review , 1975, Vol. ’S 65, pp. 887-895

  20. Growth and Development of The Kunlun Type of Wild Yak

    Institute of Scientific and Technical Information of China (English)

    李吉叶

    2005-01-01

    The observation of body height and weight of 10 captured wild yak shows the body height and weight of the wild yak at three and four months old were similar with that of domestic yak. At their 24 months old, the body height and weight were higher by 26.9 % and 62.5 % than that of the domestic ones. The results indicate that, once adapted to the half-shed and half-grazing conditions, the tamed Kunlun type of wild yak with superior genetics would grow and develop faster than the domestic yak at elder ages.

  1. VIMOS Integral Field Spectroscopy of Gaseous Nebulae in Local Group Dwarf Galaxies

    Science.gov (United States)

    Held, E. V.; Gullieuszik, M.; Saviane, I.; Sabbadin, F.; Momany, Y.; Rizzi, L.; Bresolin, F.

    The study of very metal-poor dwarf irregular (dIrr) galaxies is fundamental to test the cosmological scenarios of galaxy formation. Among Local Group galaxies, Leo A and SagDIG are probably the most metal-poor dwarfs, as suggested by estimates of their nebular abundances based on the empirical method [I. Saviane, L. Rizzi, E.V. Held, F. Bresolin, Y. Momany in Astron. Astrophys. 390, 59 (2002); E.D. Skillman, R. Terlevich, J. Melnick in Mon. Not. R. Astron. Soc. 240, 563 (1989); L. van Zee, E.D. Skillman, M.P. Haynes in Astrophys. J. 637, 269 (2006)].

  2. The crystal structure of tryptophan hydroxylase with bound amino acid substrate

    DEFF Research Database (Denmark)

    Windahl, Michael Skovbo; Petersen, Charlotte Rode; Christensen, Hans Erik Mølager

    2008-01-01

    acid hydroxylase with bound natural amino acid substrate. The iron coordination can be described as distorted trigonal bipyramidal coordination with His273, His278, and Glu318 (partially bidentate) and one imidazole as ligands. The tryptophan stacks against Pro269 with a distance of 3.9 Å between...... of the neurotransmitter and hormone serotonin (5-hydroxytryptamine). We have determined the 1.9 Å resolution crystal structure of the catalytic domain (Δ1−100/Δ415−445) of chicken TPH isoform 1 (TPH1) in complex with the tryptophan substrate and an iron-bound imidazole. This is the first structure of any aromatic amino...

  3. 3-Cyclohexylsulfonyl-5-iodo-2,7-dimethyl-1-benzofuran

    Directory of Open Access Journals (Sweden)

    Pil Ja Seo

    2011-08-01

    Full Text Available In the title compound, C16H19IO3S, the cyclohexyl ring adopts a chair conformation. In the crystal, pairs of intermolecular I...O contacts [3.269 (2 Å] link the molecules into inversion dimers. These dimers are further stabilized by a slipped π–π interaction between the benzene and furan rings of adjacent molecules [centroid–centroid distance = 3.701 (3 Å, interplanar distance = 3.372 (3 Å and slippage = 1.525 (3 Å].

  4. Cultural Resources Survey, Harry S. Truman Dam and Reservoir Project, Missouri. Volume 9. Preliminary Studies of Early and Middle Archaic Components.

    Science.gov (United States)

    1983-02-01

    sults of preliminary testing at several sites in the lower Pomme de Terre River valley. Volume VIII contains the results of excavations in rock shelters...Griffin and Michael K. Trimble, pp. 269- 349 Volume VI: EURO-AMERICAN SETTLEMENT OF THE LOWER POMME DE TERRE RIVER VALLEY, by Russell L. Miller. 75 pp...Soils and Soil-Geomorphic Investigations in ’TIC the Lower Pomme de Terre Valley, by Donale DI Lee Johnson, pp. 59-139 Dp16trA’ iDiSt ’ _ /’.V

  5. Superconductivity in Metals and Alloys

    Science.gov (United States)

    1963-02-01

    sintered material (Reed, Gatos , LaFleur, and Roddy, 1962). It has great importance for any materials work, since generalizations based only on stoichio...1961),Phys. Rev. Letters 6, 597. Goodman, B. B., (1962) IBM J. Research and Development 6, 63. Gor’kov, L. P., (1960), Soy . Phys. JETP 10, 998...34Superconductivity in Metals and Alloys-Technical Documentary Report No. ASD-TDR-62-269, Contract No. AF 33(616)-640 5. Reed, T. B., Gatos , H. C., LaFleur, W. j

  6. [The nutritional status of children in intensive care units].

    Science.gov (United States)

    Uglitskikh, A K; Kon', I Ia; Ostreĭkov, I F; Shilina, N M; Smirnov, V F

    2008-01-01

    The paper deals with the nutritional status of infants in intensive care units (ICU). It shows nutritional trends in 269 children aged 1 month to 15 years, treated in the ICU of a Tushino children's city hospital, Moscow, for brain injury, abdominal surgical diseases, and severe pneumonia. The paper evaluates the physical development of children in the ICU, shows the trends in weight-height, somatometric, laboratory parameters, and balance study data. The values of protein losses and nitrogen balance in children in the postaggression period and their relationship to age and feeding mode (enteral, parenteral-enteral) are shown.

  7. Friction of Plastic Rotating Bands

    Science.gov (United States)

    1984-11-01

    for speeds eve ., the rdnge: 10 - 300 cm/s. Overwhelming evidence was presented to support a melt phenomena. Melt depth of: polymer, pins on a glass disk...Polymers," Proc. Roy. Soc., (London),. A291 (1966), p. 186. 24. Rabinowicz , S., et al., "The Effect of Hydrostatic Pressure on the Shear Yield Behavior of...34 Proc. Roy.,Soc., (London), A269. (19620 p. 368. 51. Carignan, F. J., and Rabinowicz , E., "Friction and Wear at ligh Sliding Speeds," ASLE Trans., 24

  8. Center for Coastline Security Technology, Year 3

    Science.gov (United States)

    2008-05-01

    Figure 2.6.8: Close-Up Photograph of RPUUV Tail Section. Figure 2.6.9: Force and moments applied on a hydrofoil . Figure 2.6.10: The NACA 21016... hydrofoil profile. Florida Atlantic University 4/28/08 Page 10 Center for Coastline Security Technology Year Three-Final Report Figure...as a 3D wing with a NACA 21016 hydrofoil profile (Figure 2.6.10) held by 3 cylinders (Figure 2.6.8). Center for Coastline Security Technology Year

  9. Estimation of above ground biomass in boreal forest using ground-based Lidar

    Science.gov (United States)

    Taheriazad, L.; Moghadas, H.; Sanchez-Azofeifa, A.

    2017-05-01

    Assessing above ground biomass of forest is important for carbon storage monitoring in boreal forest. In this study, a new model is developed to estimate the above ground biomass using ground based Lidar data. 21 trees were measured and scanned across the plot area study in boreal forests of Alberta, Canada. The study area was scanned in the summer season 2014 to quantify the green biomass. The average of total crown biomass and green biomass in this study was 377 kg (standard deviation, S.D. = 243 kg) and 6.42 kg (S.D. = 2.69 m), respectively.

  10. Drug in Adhesive Patch of Zolmitriptan: Formulation and In vitro/In vivo Correlation

    OpenAIRE

    2015-01-01

    The objective of the present study was to develop transdermal patch for zolmitriptan, determine its in vivo absorption using the rabbit skin. Solvent evaporation technique prepared zolmitriptan patch was settled in two-chamber diffusion cell combined with excised rabbit abdomen skin for permeation study. A sufficient cumulative penetration amount of zolmitriptan (258.5 ± 26.9 μg/cm2 in 24 h) was achieved by the formulation of 4% zolmitriptan, 10% Azone, and adhesive of DURO-TAK® 87–4098. Phar...

  11. Engaged or exhausted—How does it affect dentists’ clinical productivity?

    Directory of Open Access Journals (Sweden)

    Jari J. Hakanen

    2014-06-01

    Full Text Available This cross-sectional study examines whether job burnout (exhaustion and work engagement are associated with the clinical productivity of dentists measured by the amount of paid procedure fees in a single month. We conducted an OLS regression analyses of data on dentists working at municipal health centers in Finland (N = 269; response rate 37%. The results indicated that work engagement was positively associated with the amount of procedure fees and consequently with dentists’ pay level after several work-related and demographic background variables were controlled for. However, exhaustion was not related to productivity after controlling for the impact of other factors.

  12. Fishery and life history of spot-tail mantis shrimp, Squilla mantis (Crustacea: Stomatopoda), in the Gulf of Cadiz (eastern central Atlantic)

    OpenAIRE

    Yolanda Vila; Ignacio Sobrino; Mª Paz Jiménez

    2013-01-01

    La galera Squilla mantis es una especie de importancia económica en el Golfo de Cádiz (Atlántico Centro-oriental), capturada principalmente por la flota de arrastre de fondo de Sanlúcar de Barrameda. Los desembarcos anuales oscilaron entre 24 t en 1999 y 600 t en 2003 con un valor medio de 269 t en el periodo comprendido entre 1984 y 2010. Las capturas tienen una marcada estacionalidad, con un pico máximo en invierno y registrándose los valores más bajos en verano. La abundancia de larvas est...

  13. Asteroid Lightcurve Analysis at CS3-Palmer Divide Station: 2016 April-July

    Science.gov (United States)

    Warner, Brian D.

    2016-10-01

    Lightcurves for nine main-belt asteroids were obtained at the Center for Solar System Studies-Palmer Divide Station (CS3-PDS) from 2016 April to July. Of the group, four are known Hungaria binary asteroids: 1727 Mette, 2047 Smetana, 5899 Jedicke, and (18890) 2000 EV26. The Mars-crosser (54697) 2001 FA70 appears to be a newly-confirmed binary with P1 = 2.7075 h and POrb = 16.269 h. A third period, P2 = 2.1239 h, appears to be real. If so, it could be due to the asynchronous rotation of the satellite or a third body in the system.

  14. Characterization of a t(5;8)(q31;q21) translocation in a patient with mental retardation and congenital heart disease: implications for involvement of RUNX1T1 in human brain and heart development

    DEFF Research Database (Denmark)

    Zhang, Litu; Tümer, Zeynep; Møllgård, Kjeld

    2009-01-01

    The chromosome break points of the t(8;21)(q21.3;q22.12) translocation associated with acute myeloid leukemia disrupt the RUNX1 gene (also known as AML1) and the RUNX1T1 gene (also known as CBFA2T3, MTG8 and ETO) and generate a RUNX1-RUNX1T1 fusion protein. Molecular characterization of the trans...... development and support the notion that disruption of the RUNX1T1 gene is associated with the patient's phenotype.European Journal of Human Genetics advance online publication, 28 January 2009; doi:10.1038/ejhg.2008.269....

  15. Psychological distress of female caregivers of significant others with cancer

    Directory of Open Access Journals (Sweden)

    Tony Cassidy

    2015-12-01

    Full Text Available This study explored the role of time since diagnosis and whether the care recipient was a child, a parent, or a spouse, on caregiver’s perceptions of the caring role, with a group of 269 female cancer caregivers. Questionnaire measures were used to explore psychological and social resources and psychological distress. Analysis of variance and hierarchical multiple regression were used and identified significant effects of time since diagnosis and care recipient. This study concludes that a more tailored approach to understanding the needs of caregivers is required particularly in terms of time since diagnosis and care recipient, in order to provide more effective support.

  16. Effectiveness of an integrated real-time PCR method for detection of the Mycobacterium tuberculosis complex in smear-negative extrapulmonary samples in an area of low tuberculosis prevalence.

    Science.gov (United States)

    Moure, Raquel; Martín, Rogelio; Alcaide, Fernando

    2012-02-01

    Early extrapulmonary tuberculosis (EPTB) diagnosis is particularly difficult. Among 108 smear-negative extrapulmonary samples showing a positive culture for Mycobacterium tuberculosis complex (43 body fluids and 65 nonliquid specimens), 63 (58.3%) were positive with the Xpert MTB/RIF assay (GX). GX sensitivity was quite low for samples from sterile locations (especially for pleural fluids: 26.9%) but high for some nonliquid samples, like abscess aspirates (76.5%). In summary, GX may be a useful tool to be considered for EPTB diagnosis.

  17. Long-term effect of early-life stress from earthquake exposure on working memory in adulthood

    OpenAIRE

    Li, Na; Wang, Yumei; Zhao, Xiaochuan; Gao, Yuanyuan; Song, Mei; Yu, Lulu; Wang, Lan; Li, Ning; Chen, Qianqian; Li, Yunpeng; Cai,Jiajia; Wang, Xueyi

    2015-01-01

    Objective The present study aimed to investigate the long-term effect of 1976 Tangshan earthquake exposure in early life on performance of working memory in adulthood. Methods A total of 907 study subjects born and raised in Tangshan were enrolled in this study. They were divided into three groups according to the dates of birth: infant exposure (3–12 months, n=274), prenatal exposure (n=269), and no exposure (born at least 1 year after the earthquake, n=364). The prenatal group was further d...

  18. New Evidence on Household Valuation of Curbside Recycling

    OpenAIRE

    David M. Aadland; Caplan, Arthur J.

    1999-01-01

    This paper looks at the willingness to pay for and participate in a curbside recycling program based on a survey of 401 residents in Ogden, Utah. Modifying the Cameron and James ("Efficient Estimation Methods for 'Close-Ended' Contingent Valuation Surveys," The Review a/Economics and Statistics 69(1987):269-76) econometric model to fit ordered-interval data, we estimate that the mean willingness to pay for curbside recycling is $2.05 per month, and that 72% of the residents would willingly pa...

  19. Thermal optimum for pikeperch (Sander lucioperca) and the use of ventilation frequency as a predictor of metabolic rate

    DEFF Research Database (Denmark)

    Frisk, Michael; Skov, Peter Vilhelm; Steffensen, John Fleng

    2012-01-01

    that pikeperch have an ontogenetic shift in their thermal optimum, emphasizing the importance of considering fish size when deciding the temperature in aquaculture facilities. As a secondary objective we investigated whether gill ventilation frequency (fV) could be used as an accurate predictor of oxygen......) was found at 18.8 °C. Defining the optimal temperature as the thermal range where fish canmaintain 80% of MSMAX, shows that adult pikeperch have a broad thermal optimum between 10.4 and 26.9 °C. Since earlier studies on juvenile pikeperch have reported an optimal temperature range of 25–30 °C, we show...

  20. On the Effectiveness of Military Institutions: Historical Case Studies from World War I, The Interwar Period and World War II. Volume 2. The Interwar Period

    Science.gov (United States)

    1986-04-01

    criticizlnq CP 40(39), "Staff Conve.:satlons with France and Belgium." 246. I i42 Murray, _ n__L the uropean Balance of Power, pp. 269-74, 43. N.H. Gibbs ... Regla Aeronautica fighter pIlot training continued to instill biplane tactics.IS2 3 Nonetheless, the growing possibility after 1934 that the 8"ia...to Implement such a policy. As a re.sult of this £ failure, from the outset of Italian Intervention in the Second World War, the Regla ezonautica

  1. Structural evidence for induced fit and a mechanism for sugar/H+ symport in LacY

    DEFF Research Database (Denmark)

    Mirza, Osman Asghar; Guan, Lan; Verner, Gill

    2006-01-01

    Cation-coupled active transport is an essential cellular process found ubiquitously in all living organisms. Here, we present two novel ligand-free X-ray structures of the lactose permease (LacY) of Escherichia coli determined at acidic and neutral pH, and propose a model for the mechanism...... of coupling between lactose and H+ translocation. No sugar-binding site is observed in the absence of ligand, and deprotonation of the key residue Glu269 is associated with ligand binding. Thus, substrate induces formation of the sugar-binding site, as well as the initial step in H+ transduction....

  2. Consumption and direct-use values of savanna bio-resources used by rural households in Mametja, a semi-arid area of Limpopo province, South Africa

    CSIR Research Space (South Africa)

    Twine, W

    2003-09-01

    Full Text Available ^ ^ 1996/97 from the Department of Agri- culture, was as follows: Finale (269 households), 976 t; Mabins (538 house- holds), 2399 t; Willows (1109 house- holds), 6044 t. Most respondents perceived declin- ing availability over the past 5?10 years... This study Finale A 4911 17.71 8.21 This study Mabins A 6191 22.01 12.11 This study The Willows 8031 11.91 8.11 Banks et al. (1996)25 Athol 5002 ?? Banks et al. (1996)25 Welverdiend 5552 ?? Dovie et al. (2002)16 Thorndale 692 3.13 25.0 Shackleton et al. (1999...

  3. Dicty_cDB: VSI810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSI810 (Link to dictyBase) - - - Contig-U13850-1 VSI810P (Link... to Original site) VSI810F 347 VSI810Z 269 VSI810P 616 - - Show VSI810 Library VS (Link to library) Clone ID VSI810 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13850-1 Original site URL http://dict...nce kykythnvcpksiis*nqqrc*fkthrnpr*ecpkdwf*cph*eersrkftfrg*trc*i ktr*d***ictkd**kyyn*tkqslciir*n*skgcr*LKKRN...HIFYCNFKLKKK--- ---ININIHTMXAPNPLLAEINKGXDLEHTETQDKSAPKIGFDVHIKKNDHASLLSEVEQ GAKLKHAEXDDNICT

  4. Detection of antimicrobial sensitiveness of isolates of Listeria monocytogenes from food chain using Vitek 2 Compact Biomerieux

    Directory of Open Access Journals (Sweden)

    Jankuloski Dean

    2010-05-01

    Full Text Available Sensitivity of 26 Listeria monocytogenes isolates toward 18 antimicrobial substances used in veterinary and human medicine was examined using the automated VITEK 2 Compact system bioMerieux. The obtained results indicate that L. monocytogenes strains isolated from food and food processing environment had resistance to several or more antimicrobial substances that are commonly used in the treatment in animals and humans. Results showed resistance of all 26 (100% isolates toward Benzylpenicilin, Ampicilin/Sublactam, Oxacillin, Imipenem and Fosfomycine. Also 7 of the isolates (26.9% were resistant to Clindamiycin, 3 (11.5% to Quinupristion/Dalfopristin and 1 strain to Teicoplanin, Vancomycin, Tetracycline and Fusic acid, respectively.

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB628 (Link to dictyBase) - - - Contig-U16602-1 VFB628F (Link... to Original site) VFB628F 269 - - - - - - Show VFB628 Library VF (Link to library) Clone ID VFB628 (Link to di...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...vesicles of secretory system 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: Golgi >> predi

  6. Effect of cyclic, low dose pyrimethamine treatment in patients with Late Onset Tay Sachs: an open label, extended pilot study

    OpenAIRE

    Osher, Etty; Fattal-Valevski, Aviva; Sagie, Liora; Urshanski, Nataly; Sagiv, Nadav; Peleg, Leah; Lerman-Sagie, Tally; Zimran, Ari; Elstein, Deborah; Navon, Ruth; Valevski, Avi; Stern, Naftali

    2015-01-01

    Background Late Onset Tay- Sachs disease (LOTS) is a rare neurodegenerative lysosomal storage disease which results from mutations in the gene encoding the α subunit (HEXA) of β-hexosaminidase enzyme (HexA). At the present time, no effective treatment exists for LOTS and other neurodegenerative diseases involving the central nerve system (CNS). Pyrimethamine (PMT) was previously shown to act as a HexA chaperone in human fibroblasts in vitro carrying some (e.g., αG269S), but not all LOTS-relat...

  7. Evaluating the rate of migration of an uranium deposition front within the Uitenhage Aquifer

    CSIR Research Space (South Africa)

    Vogel, JC

    1999-07-01

    Full Text Available of Geochemical Exploration 66 (1999) 269?276 www.elsevier.com/locate/jgeoexp Evaluating the rate of migration of an uranium deposition front within the Uitenhage Aquifer J.C. Vogel a,A.S.Talmaa, T.H.E. Heaton b, J. Kronfeld c,* a Quaternary Dating Research Unit... to this will be a significant rise in the 234U=238U activity ratio as the 234U isotope se- lectively is injected from the accumulating U source into the water by alpha-recoil processes (Kigoshi, 1971; Kronfeld, 1974). Though reducing zones have been often encoun...

  8. Distribution and origin of seamounts in the central Indian Ocean Basin

    Digital Repository Service at National Institute of Oceanography (India)

    Das, P.; Iyer, S.D.; Kodagali, V.N.; Krishna, K.S.

    . 1989). It is noteworthy that the CIOB seamounts have a limited but an unambiguous distribution between chrons A24 and A23 (Figure 1). In the CIOB, the production rate of seamounts (total seamounts/crustal age) has ranged between 20 and 30 seamounts/10 6...–269, 2005 Copyright © Taylor & Francis Inc. ISSN: 0149-0419 print / 1521-060X online DOI: 10.1080/01490410500204637 Distribution and Origin of Seamounts in the Central Indian Ocean Basin PRANAB DAS, 1 SRIDHAR D. IYER, 1 V. N. KODAGALI, 2 AND K. S. KRISHNA 3...

  9. Some aspects of volcanic ash layers in the Central Indian Basin.

    Digital Repository Service at National Institute of Oceanography (India)

    Sukumaran, N.P.; Banerjee, R.; Borole, D.V.; Gupta, S.M.

    that explosive eruptions in the past have reached the levels required to cause signi cant climatic cooling (Bray 1977; Lamb 1971). Furthermore, Rampino and Self (1993) suggest a possible general feedback coup- ling between explosive eruption and climatic change... the Toba super-eruption. Nature 359 : 50—52 Rampino MR and Self S (1993) Climate-Volcanism feedback and the Toba eruption of &74,000 years ago. Quaternary Research 40 : 269—280 Rampino MR, Self S, and Fairbridge RM (1979) Can rapid climatic change can cause...

  10. Indices of methylation in sperm DNA from fertile men differ between distinct geographical regions

    DEFF Research Database (Denmark)

    Consales, C; Leter, G; Bonde, J P E

    2014-01-01

    sequences from peripheral blood lymphocyte, can vary with age, gender, alcohol consumption and white blood cell counts. STUDY DESIGN, SIZE, DURATION: A cross-sectional study. Individual data were collected from 269 young healthy men of proven fertility living in three geographical regions: Inuits from...... parameters, sperm chromatin integrity, biomarkers of accessory gland function and the plasma concentration of reproductive hormones were associated with sperm DNA methylation levels in men. Associations were evaluated by analysis of variance and linear regression analyses. MAIN RESULTS AND THE ROLE OF CHANCE...

  11. Triterpenoids and Prevention of Prostate Cancer

    Science.gov (United States)

    2001-10-01

    constituents of rose-bay willow- herb . J. Chem. Soc. (C) biosynthesis of nitric oxide. J. Biol. Chem. 1994, 269, 13725- 1967, 510-515. 13728. (c) Anggard, E...cells were obtained from Dr. Gustav Lienhard (Dart- 1. Tang W, Eisenbrand G 1992 Chinese Drugs of Plant mouth Medical School, Hanover, NH). Cells were...2711-2714 tion of diabetic and obese mice to insulin by retinoid X 8. Suh N, Wang Y, Honda T, Gribble GW, Dmitrovsky E, receptor agonists. Nature 386

  12. Air-Sea Interaction Studies of the Indian and Pacific Oceans

    Science.gov (United States)

    2014-09-30

    1 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Air-Sea Interaction Studies of the Indian and Pacific...2014 2. REPORT TYPE 3. DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Air-Sea Interaction Studies of the Indian and Pacific Oceans...applied to ship- generated waves in the 1989 Loch Linnhe experiment, J. Geophys. Res., 98, 10,259-10,269. Wikipedia, 2013: “Crow’s Nest”, http://en.wikipedia.org/wiki/ Crow %27s_nest, Referenced May 30, 2013.

  13. Intervención educativa sobre salud bucal en portadores de prótesis parcial removible en Amancio

    OpenAIRE

    Tomás de la Paz Suárez; Carmen García Alguacil; María Soledad Botello

    2014-01-01

    Se realizó un estudio de intervención educativa en servicios de salud, con la finalidad de elevar el nivel de conocimientos sobre salud bucal de los pacientes del consultorio 12-62 en el municipio de Amancio, Las Tunas, que son portadores de prótesis parcial removible, en el período de mayo de 2012 a julio de 2013. El universo estuvo constituido por 269 personas portadoras de prótesis dental, la muestra quedó conformada por 51 pacientes portadores de prótesis parcial. Se realizó una entrevist...

  14. Department of Defense Base Structure Report (A Summary of DoD’s Real Property Inventory). Fiscal Year 2004 Baseline

    Science.gov (United States)

    2004-01-01

    542Army Active Kahuku Tng Area Kahuku 96857 15 21,325 9,409 8,241 27.1Army Active Kilauea Mil Reserve Hilo 96857 85 157,030 72 55 71.0 0 11 81 92Army Active...Pohakuloa Training Area Hilo 96857 164 269,266 107,872 84,816 193.1 21 104 28 153808-438-3501Army Active Pupukea Paalaa Uka Mil Road Wahiawa 96857 109...La Plata 18 45,792 306 306 17.1Navy Active NRL Washington DC (Chesapeake Bay Detach) Chesapeake Beach 42 171,494 157 157 68.9Navy Active NSWC DIV

  15. Research on Health Inequalities in Latin America and the Caribbean: Bibliometric Analysis (1971–2000) and Descriptive Content Analysis (1971–1995)

    Science.gov (United States)

    Almeida-Filho, Naomar; Kawachi, Ichiro; Filho, Alberto Pellegrini; Dachs, J. Norberto W.

    2003-01-01

    We conducted a bibliometric and content analysis of research on health inequalities produced in Latin American and Caribbean countries. In our bibliometric analysis (n = 576), we used indexed material published between 1971 and 2000. The content analysis (n = 269) covered the period 1971 to 1995 and included unpublished material. We found recent rapid growth in overall output. Brazil, Chile, and Mexico contributed mostly empirical research, while Ecuador and Argentina produced more conceptual studies. We found, in the literature reviewed, a relative neglect of gender, race, and ethnicity issues. We also found remarkable diversity in research designs, however, along with strong consideration of ecological and ethnographic methods absent in other research traditions. PMID:14652329

  16. Research on health inequalities in Latin America and the Caribbean: bibliometric analysis (1971-2000) and descriptive content analysis (1971-1995).

    Science.gov (United States)

    Almeida-Filho, Naomar; Kawachi, Ichiro; Filho, Alberto Pellegrini; Dachs, J Norberto W

    2003-12-01

    We conducted a bibliometric and content analysis of research on health inequalities produced in Latin American and Caribbean countries. In our bibliometric analysis (n = 576), we used indexed material published between 1971 and 2000. The content analysis (n = 269) covered the period 1971 to 1995 and included unpublished material. We found recent rapid growth in overall output. Brazil, Chile, and Mexico contributed mostly empirical research, while Ecuador and Argentina produced more conceptual studies. We found, in the literature reviewed, a relative neglect of gender, race, and ethnicity issues. We also found remarkable diversity in research designs, however, along with strong consideration of ecological and ethnographic methods absent in other research traditions.

  17. A Poética Sociológica de Medviédev e Sua Atualidade

    Directory of Open Access Journals (Sweden)

    Matheus de Brito

    2013-07-01

    Full Text Available Review of Pável Nikoláievitch Medviédev. O método formal nos estudos literários: introdução crítica a uma poética sociológica, Trad. Ekaterina Vólkova Américo e Sheila Camargo Grillo, São Paulo, Contexto, 2012, 269 pp. [1ª ed., Leningrado, Pribói, 1928]. ISBN 978-85-7244-725-6

  18. The DNA gyrase-quinolone complex. ATP hydrolysis and the mechanism of DNA cleavage

    DEFF Research Database (Denmark)

    Kampranis, S C; Maxwell, A

    1998-01-01

    Quinolone binding to the gyrase-DNA complex induces a conformational change that results in the blocking of supercoiling. Under these conditions gyrase is still capable of ATP hydrolysis which now proceeds through an alternative pathway involving two different conformations of the enzyme (Kampranis......, S. C., and Maxwell, A. (1998) J. Biol. Chem. 269, 22606-22614). The kinetics of ATP hydrolysis via this pathway have been studied and found to differ from those of the reaction of the drug-free enzyme. The quinolone-characteristic ATPase rate is DNA-dependent and can be induced in the presence...

  19. Observations of Interrank Conflicts at the Company Level: Drug and Alcohol Abuse.

    Science.gov (United States)

    1975-12-01

    N L (N N Marihuana 40.3 (683) 26.7 (452) 30.0 (508) 3.0 (51) 100.0 (1694) Hashish 26.9 (455) 27.9 (473) 42.0 (712) 3.2 (54) i00.0 (1694) Cocaine 5.6...7) (5) free time Legalize soft drugs, allow 0 0 5 9 8 10 alcohol in the barracks (0) (0) (1) (2) (3) (4) Don’t open clubs until 0 0 5 0 0 2 Beatter

  20. Weather Incorporated for Needs Development (W.I.N.D.)

    Energy Technology Data Exchange (ETDEWEB)

    Paul Gunderson; Melinda Martin; Jay Johnson

    2012-01-30

    The OSHA Power Generation Standard states that power generation employees shall be trained in specific applications of the standard that apply to individual job requirements. The intent of the project objective, then, is to create a tailored course that identifies standard requirements that apply to wind energy technicians.The purpose of this project is to develop an OSHA Power Generation Standard (1910.269) training course for both college based wind energy technician students and for continued workforce training of already employed wind technicians.

  1. Cine y humanidades: prólogo al libro Escapando de Matrix (Eikasia, Oviedo, 2007) de Laura Díaz y Javier González

    OpenAIRE

    Pérez Herranz, Fernando Miguel

    2007-01-01

    Publicado en forma de artículo en Eikasia: Revista de Filosofía, año III, 16 (enero 2008), pp. 263-269. http://www.revistadefilosofia.org El libro que se prologa podría ser leído y valorado como un referente de las Humanidades en busca de sus propias materialidades, en este caso, el cine. "Escapando de Matrix", cuyo título ya es un aviso, nos pone en camino de la mejor tradición hispana del renacimeinto y del barroco, cuando la filosofía se hallaba vinculada al teatro.

  2. PRELIMINARY RESULTS REGARDING THE SENSITIVITY OF TULIPA GESNERIANA L. MERISTEMATIC ROOT CELLS TO FUNGICIDE FOLPAN

    Directory of Open Access Journals (Sweden)

    Nicoleta Anca Şuţan

    2015-07-01

    Full Text Available The genotoxicity of the pesticide Folpan was evaluated in meristematic root cells of Tulipa gesneriana cv. ‘Leen van der Mark’. The statistical analyses of the results showed that the pesticide studied has a concentration-dependent toxicity and induces chromosomal aberrations. The lowest mitotic index (2,69% was related with the highest tested concentration of Folpan (900 ppm. Various types of chromosomal and mitotic abnormalities such as binucleated cells, laggards, and disturbed ana-telophase with multiple chromosomal bridges revealed the clastogenic potential of pesticide tested.

  3. Search for the process $e^+e^-\\to \\eta^\\prime(958)$ with the CMD-3 detector

    CERN Document Server

    Akhmetshin, R R; Aulchenko, V M; Banzarov, V Sh; Bashtovoy, N S; Berkaeva, D E; Bondar, A E; Bragin, A V; Eidelman, S I; Epifanov, D A; Epshteyn, L B; Erofeev, A L; Fedotovich, G V; Gayazov, S E; Grebenuk, A A; Grigoriev, D N; Gromov, E N; Ignatov, F V; Karpov, S V; Kazanin, V F; Khazin, B I; Koop, I A; Kovalenko, O A; Kozyrev, A N; Kozyrev, E A; Krokovny, P P; Kuzmenko, A E; Kuzmin, A S; Logashenko, I B; Lukin, P A; Mikhailov, K Yu; Muchnoi, N Yu; Okhapkin, V S; Pestov, Yu N; Perevedentsev, E A; Popov, A S; Razuvaev, G P; Rogovsky, Yu A; Romanov, A L; Ruban, A A; Ryskulov, N M; Ryzhenenkov, A E; Shebalin, V E; Shemyakin, D N; Shwartz, B A; Shwartz, D B; Sibidanov, A L; Shatunov, P Yu; Shatunov, Yu M; Solodov, E P; Titova, V M; Talyshev, A A; Vorobiov, A I; Yudin, Yu V

    2014-01-01

    A search for the process $\\epem\\to \\eta^\\prime(958)$ in the $\\pipi\\eta\\to\\pipi\\gamma\\gamma$ final state has been performed with the CMD-3 detector at the VEPP-2000 $e^+e^-$ collider. Using an integrated luminosity of 2.69 pb$^{-1}$ collected at the center-of-mass energy \\Ecm = 957.68 MeV we set an upper limit for the product of electronic width and branching fractions $\\Gamma_{\\eta^\\prime(958)\\to\\epem}\\cdot\\BR_{\\eta^\\prime(958)\\to\\pipi\\eta}\\cdot\\BR_{\\eta\\to\\gamma\\gamma}<0.00041$ eV at 90\\% C.L.

  4. 33 CFR 161.45 - Vessel Traffic Service St. Marys River.

    Science.gov (United States)

    2010-07-01

    ...°57′ N. (De Tour Reef Light) to the south, to 46°38.7′ N. (Ile Parisienne Light) to the north, except... Parisienne Ile Parisienne Light 46°37.3′ N; 84°45.9′ W Downbound Only. 2 Gros Cap Reef Gros Cap Reefs Light 46°30.6′ N; 84°37.1′ W Upbound Only. 3 Round Island Round Island Light 32 46°26.9′ N; 84°31.7′W....

  5. Evaluation of an ELISA for the diagnosis of brucellosis.

    Science.gov (United States)

    Mathai, E; Singhal, A; Verghese, S; D'Lima, D; Mathai, D; Ganesh, A; Thomas, K; Moses, P

    1996-06-01

    Brucela serology using ELISA and standard agglutination test was performed on 23 patients with prolonged fever where the test was requested, on 26 randomly chosen patients with prolonged fever where it was not requested and on 17 controls. ELISA was positive in 39.1, 26.9 and 0 per cent respectively in these groups. Brucellosis may often be unsuspected because of its varied clinical manifestations and may be a more important cause of fever than previously considered. Our data reaffirm that ELISA is superior to the standard agglutination test for the diagnosis of brucellosis.

  6. NCBI nr-aa BLAST: CBRC-OPRI-01-0823 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0823 ref|ZP_04645978.1| amino acid permease [Lactobacillus jensenii 26...9-3] ref|ZP_04675408.1| amino acid permease [Lactobacillus jensenii 1153] ref|ZP_05865791.1| amino acid permease [Lactobacillus... jensenii SJ-7A-US] gb|EEQ24039.1| amino acid permease [Lactobacillus jensenii 269-3] gb|...EEQ68948.1| amino acid permease [Lactobacillus jensenii 1153] gb|EEX27396.1| amino acid permease [Lactobacillus jensenii SJ-7A-US] ZP_04645978.1 1.4 31% ...

  7. Technology priorities for transport in Asia: assessment of economy-wide CO2 emissions reduction for Lebanon

    DEFF Research Database (Denmark)

    Dhar, Subash; Marpaung, Charles O. P.

    2015-01-01

    mitigations actions (NAMA) given their strong contribution for development and therefore a methodology based on in-put out-put decomposition analysis is proposed for analysing economy wide CO2 emissions reductions. The methodology has been applied for the transport sector of Lebanon where alternative fuels......,improvement to cars (private and taxis) and buses for public transport were prioritized by stakeholders. The economy-wide CO2 emission reduce by 2,269 thousand tons by 2020 if the prioritized technologies are implemented in Lebanon. Fuel mix effect and structural effect would reduce CO2 emission by 2,611 thousand...

  8. An observational comparative study of cost between branded medicines and generic medicines

    Directory of Open Access Journals (Sweden)

    Meenu Pichholiya

    2015-04-01

    Conclusions: Most of the drugs available in the market have brand names whether they are branded or generic medicines. Hence, doctor should write a cheapest known brand with the name of the generic salt in bracket so that the patient can buy another if that brand is not available. Furthermore, the Drug Controller of India should release a website where every doctor should be able to find the cheapest and approved drugs in the market. [Int J Basic Clin Pharmacol 2015; 4(2.000: 269-272

  9. Functional performance and physical activity levels of subjects enrolled at an Open University of the Third Age at the School of Arts, Sciences and Humanities of the University of São Paulo (UnATI EACH-USP

    Directory of Open Access Journals (Sweden)

    Ruth Caldeira de Melo

    2013-05-01

    Full Text Available The aim of this study was to evaluate the functional performance, according to the physical activity levels, of the students of UnATI EACH-USP. The study included 269 subjects, of both sexes, aged between 50 and 80 years-old. The most active group showed better functional performance in balance, mobility and lower limb strength tests compared with the sedentary group. On the other hand, perform physical activities in an irregular fashion was not associated to better functional performance in middleaged/older subjects.

  10. ASSESSMENT OF PLASTIC FLOWS AND STOCKS IN SERBIA USING MATERIAL FLOW ANALYSIS

    Directory of Open Access Journals (Sweden)

    Goran Vujić

    2010-01-01

    Full Text Available Material flow analysis (MFA was used to assess the amounts of plastic materials flows and stocks that are annually produced, consumed, imported, exported, collected, recycled, and disposed in the landfills in Serbia. The analysis revealed that approximatelly 269,000 tons of plastic materials are directly disposed in uncontrolled landfills in Serbia without any preatretment, and that siginificant amounts of these materials have already accumulated in the landfills. The substantial amounts of landfilled plastics represent not only a loss of valuable recourses, but also pose a seriuos treath to the environment and human health, and if the trend of direct plastic landfilling is continued, Serbia will face with grave consecequnces.

  11. 澳门戒烟门诊戒烟人士吸烟原因及行为分析%Analysis for causes of smoking and its related behavior among visitors at smoking cessation clinics in Macao

    Institute of Scientific and Technical Information of China (English)

    罗子超; 萧巧玲; 杨咏瑶; 区敏琪; 余育璇

    2011-01-01

    以简单随机取样方法对戒烟门诊接受戒烟服务的269名戒烟者采用统一问卷做调查.起初吸烟的原因中以受朋友影响最为常见(53名,占53.0%),感觉吸烟能减压的88名(占32.7%),心瘾是阻碍戒烟的最常见原因(221名,占82.2%),继续吸烟的原因中以心瘾、烦闷、心情不佳及无聊、孤独等心理原因最常见,占79.6%(214名).提示诱使吸烟与吸烟者的心理因素有关系,现阶段要对戒烟人士加强心理卫生教育,协助戒烟者放松心情、减压和消除负面情绪的技巧.相关部门应针对青少年进行烟害防治的宣传教育,预防青少年成为惯性吸烟者.%Two-hundred and sixty-nine smokers who visited smoking cessation clinics in Macao were recruited into the study by simple random sampling, and each of them was interviewed with a standardized questionnaire. The most common causes of initiating smoking included peer influence (53/100, 53% ) and belief in that smoking could relieve stress (88/269, 32. 7% ). The most common barrier to smoking cessation was psychological dependence (221/269, 82.2%), and others such as annoyance, low spirit, boredom and loneliness that lead them to continue smoking, which accounting for 79. 6% (214/269). It issuggested that smoking initiation relates to human psychological factors. At current stage, psychological health education needs to be strengthened for those who want to quit, helping them to learn skills of relaxation, stress relief and elimination of negative emotion. In order to prevent young people from being habitual smokers, relevant sectors should organize more anti-smoking campaigns targeted at adolescents.

  12. Ellipsomyxa syngnathi sp. n. (Myxozoa, Myxosporea) in the pipefish Syngnathus typhle and S. rostellatus (Teleostei, Syngnathidae) from Denmark

    DEFF Research Database (Denmark)

    Køie, Marianne; Karlsbakk, Egil

    2009-01-01

    A new species Ellipsomyxa syngnathi sp. n. (Myxozoa) is described from Syngnathus typhle L. and Syngnathus rostellatus Nilsson, 1855 (Syngnathidae), using spore morphology and SSU rDNA sequence data. Monosporic plasmodia develop in the internal gallbladder wall. The ellipsoid myxospore has two...... pyriform polar capsules which discharge at opposite sides some distance from both sutural line and spore ends. The myxospore mainly differs from that of Ellipsomyxa gobii Køie (Folia Parasitol 50:269-271, 2003) in being monosporic and in having the sutural line oblique to the thickness axis. Zschokkella...

  13. Drug: D08148 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08148 Drug Loxapine hydrochloride; Desconex (TN) C18H18ClN3O. HCl 363.0905 364.269...IPSYCHOTICS N05AH Diazepines, oxazepines and thiazepines N05AH01 Loxapine D08148 Loxapine hydrochloride USP ...drug classification [BR:br08302] Antipsychotics 1st Generation/Typical Loxapine D08148 Loxapine hydrochlorid...hodopsin family Dopamine dopamine D2-receptor [HSA:1813] [KO:K04145] Loxapine [ATC:N05AH01] D08148 Loxapine

  14. The prognostic value of functional tumor volume and total lesion glycolysis in patients with colorectal cancer liver metastases undergoing {sup 90}Y selective internal radiation therapy plus chemotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Gulec, Seza A.; Suthar, Rekha R.; Barot, Tushar C. [Jackson North Medical Center, Florida International University College of Medicine, North Miami Beach, FL (United States); Pennington, Kenneth [Center for Cancer Care, Goshen, IN (United States)

    2011-07-15

    Functional tumor volume (FTV) and total lesion glycolysis (TLG) are measures of metabolic activity of tumors determined by fluorodeoxyglucose (FDG) positron emission tomography (PET)/CT images. These parameters could potentially have clinical value in response to treatment evaluation and disease prognostication. The objectives of this study were to investigate the relationship between functional tumor parameters (FTV and TLG) and clinical outcomes in patients with colorectal cancer liver metastases (CRCLM) undergoing {sup 90}Y-resin microsphere selective internal radiation therapy (SIRT) (SIR-Spheres {sup registered}, Sirtex Medical Limited, Lane Cove, NSW, Australia). FDG PET/CT studies of 20 patients with unresectable CRCLM who underwent {sup 90}Y SIRT under a phase II clinical trial were analyzed. FTV and TLG were calculated using PET VCAR (GE Healthcare, Milwaukee, WI, USA) on pretreatment and 4-week posttreatment scans. The effects of pretreatment and posttreatment functional tumor activity on patient survival were evaluated using Kaplan-Meier survival curves. The median survival in the study group was 14.8 months (range 2.0-27.7 months). The median survival for patients with pretreatment FTV values of above and below 200 cc were 11.2 and 26.9 months, respectively (p < 0.05). The median survival for patients with 4-week posttreatment FTV values of above and below 30 cc were 10.9 and 26.9 months, respectively (p < 0.05). The median survival for patients with pretreatment TLG values of above and below 600 g were 11.2 and 26.9 months, respectively (p < 0.05). The median survival for patients with 4-week posttreatment TLG values of above and below 100 g were 10.9 and 26.9 months, respectively (p < 0.05). Pretreatment and posttreatment FTV and TLG showed very strong association with survival. These values can be useful quantitative criteria for patient selection and disease prognostication when {sup 90}Y SIRT is contemplated in patients with CRCLM. (orig.)

  15. SECAGEM DE SEMENTES DE SOJA EM SILO COM DISTRIBUIÇÃO RADIAL DO FLUXO DE AR: I. MONITORAMENTO FÍSICO DRYING OF SOYBEAN SEEDS IN A RADIAL AIR FLOW DRYER: I. PHYSICAL MONITORING

    Directory of Open Access Journals (Sweden)

    LUIZ CARLOS MIRANDA

    1999-11-01

    Full Text Available O trabalho foi desenvolvido com o objetivo de avaliar a evolução física do processo de remoção de água das sementes em secador estacionário, com cilindro central perfurado e distribuição radical de ar. A pesquisa foi conduzida com sementes de soja, variando o fluxo (26,9, 28,4 e 33,2 m³/minuto/t e a temperatura do ar insuflado (42, 46 e 50ºC, considerando a posição das sementes (17, 34 e 51 cm em relação ao cilindro de insuflação e o tempo de secagem (zero a doze horas, com intervalos de duas horas. Foram caracterizados o ar ambiente, o ar insuflado, as temperaturas e os teores de água da massa, as velocidades e curvas de secagem. As avaliações realizadas destacaram vantagens físicas operacionais da combinação de 28,4 m³/minuto/t com 46ºC e o contrário, com a combinação de 26,9 m³/minuto/t com 42ºC.The purpose of this research was to study several physical parameters of soybean seed drying submitted to stationary process with radial air distribution by combining different air flows (26.9, 28.4 and 33.2 m³/minute/ton and temperatures (42, 46 and 50ºC, considering seed positions in the seed mass (17, 34 and 51 cm in relation to the insuflation cylinder and drying periods (zero to twelve hours with two-hour intervals. Environmental air, insuflation air, seed temperatures, moisture content of seeds, drying speed and drying curves were characterized. Considering the evaluated parameters during the drying process, the physical advantages of the combination of 28.4 m³/minute/ton with 46ºC, and the desadvantage of the combination of 26.9 m³/minute/ton with 42ºC were observed.

  16. Methods for using argon-39 to age-date groundwater using ultra-low-background proportional counting

    Energy Technology Data Exchange (ETDEWEB)

    Mace, Emily; Aalseth, Craig; Brandenberger, Jill; Day, Anthony; Hoppe, Eric; Humble, Paul; Keillor, Martin; Kulongoski, Justin; Overman, Cory; Panisko, Mark; Seifert, Allen; White, Signe; Wilcox Freeburg, Eric; Williams, Richard

    2017-08-01

    Argon-39 can be used as a tracer for age-dating glaciers, oceans, and more recently, groundwater. With a half-life of 269 years, 39Ar fills an intermediate age range gap (50-1,000 years) not currently covered by other common groundwater tracers. Therefore, adding this tracer to the data suite for groundwater studies provides an important tool for improving our understanding of groundwater systems. We present the methods employed for arriving at an age-date for a given sample of argon degassed from groundwater.

  17. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 08, Revision 5 (FGE.08Rev5): Aliphatic and alicyclic mono-, di-, tri-, and polysulphides with or without additional oxygenated functional groups from chemical

    DEFF Research Database (Denmark)

    Larsen, John Christian; Nørby, Karin Kristiane; Beltoft, Vibe Meister

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate 80 flavouring substances in the Flavouring Group Evaluation 08, Revision 4, using the Procedure in Commission Regulation (EC) No 1565/2000. Since...... of a genotoxic potential in vitro. Therefore, in the absence of further genotoxicity data, the Panel concluded that the Procedure could not be applied to these five substances. For four substances, 3-mercaptooctanal [FL-no: 12.268], 3-mercaptodecanal [FL-no: 12.269], methanedithiol diacetate [FL-no: 12...

  18. Poultry Production and Marketing in Nepal : with Comparison to Other South Asian Countries.

    OpenAIRE

    1999-01-01

    The present study is an attempt to assess the present situation of the Nepalese poultry industry and its comparison to other South Asian Countries with the help of survey and available secondary data. There were about 15.9 million poultry producing 10,962 Mt meat and 421,460 thousands of eggs including commercial and backyard poultry in the year 1996/97. The commercial poultry produced 269 eggs in 48 weeks of production with feed conversion ratio 2.9. The per Kg production cost of eggs was ab...

  19. Evaluation of the Genetic Response of U937 and Jurkat Cells to 10-Nanosecond Electrical Pulses (nsEP)

    Science.gov (United States)

    2016-05-02

    77 (43%) genes changing due to nsEP exposure. For the Jurkat cells, the top canonical pathway was the “ Hepatic Fibrosis / Hepatic Stellate Cell...150kv nsEP vs. sham Hs.446125 male germ cell-associated kinase MAK 4.483 0.00081 Hs.155111 hepatitis A virus cellular receptor 2 HAVCR2 4.453 0.00479...Symbol Fold change 150kVnsEP vs. sham p-Value 150kv nsEP vs. sham Hs.25647 v-fos FBJ murine osteosarcoma viral oncogene homolog FOS 7.269 0.00031 Hs

  20. EVALUATION OF THE REFRACTORY CHARACTERISTICS OF DUKKU CLAY DEPOSIT

    OpenAIRE

    A.M. Yami; M. A. B. Hassan; Umaru, S.

    2007-01-01

    Dukku clay was investigated to determine its refractory characteristics. The result shows that it has a bulk modulus of 9.27g/cm2, porosity of 27.84%, linear shrinkage of 1.27% and cold crushing strength of 80.20kg/cm3.A thermal shock resistance of 25 cycles was obtained with specific gravity of 2.69g and refractoriness of 1300oC.The sample was also analyzed to determine its chemical composition by atomic absorption spectra photometry method (AAS969). The result of the chemical analysis shows...

  1. Sonochemistry in the service of SOFC research.

    Science.gov (United States)

    Sakkas, Petros M; Schneider, Oliver; Sourkouni, Georgia; Argirusis, Christos

    2014-11-01

    Decoration of SOFC anode cermets with metal nanoparticles (NPs) enchance their ability and stability in natural gas to hydrogen reform. A novel sonoelectrochemical approach of Au-NPs synthesis (mean 12.31±2.69nm) is suggested, according to which the sonication is held constant while the electrochemical activity is either pulsed or continuous. The gold colloidal solution is cosonicated with state of the art cermet powder to yield particles decorated with Au-NPs. Nevertheless sonochemical routes of mixed molybdenum, rhenium or tungsten mixed oxides synthesis are utilized in order to decorate SOFC anode cermets. The decoration loading achieved spanned from 0.1 to 10.0wt.%.

  2. Pratiques budgétaires : proposition d'une typologie

    OpenAIRE

    Sponem, Samuel; Lambert, Caroline

    2008-01-01

    International audience; L'objectif de cet article est de proposer une typologie des pratiques budgétaires afin de mieux comprendre les rôles que le budget remplit et les critiques qui peuvent lui être adressées. A partir d'une analyse classificatoire (taxinomie) des pratiques de 269 entreprises françaises et d'une analyse typologique, cinq styles budgétaires sont identifiés : le budget strict, le budget diagnostic, le budget interactif, le budget souple et le budget indicatif. Ces styles se d...

  3. Immunization coverage and infant mortality rate in developing countries.

    Science.gov (United States)

    Shimouchi, A; Ozasa, K; Hayashi, K

    1994-01-01

    We examined whether immunization coverage (IMC) is one of the predictors of infant mortality rate (IMR), as a single indicator representing the availability of primary health care (PHC) services in developing countries. Multiple regression analysis showed that partial correlation coefficients for IMR with immunization coverage (-0.224), logarithm of per capita GNP (-0.294), total fertility rate (0.269), and adult literacy rate (-0.325) were all statistically significant (p immunization coverage is one of the main predictors of the infant mortality rate. It represents one of the health intervention components which can be used as a proxy indicator of the availability of PHC service in developing countries.

  4. Neutron background measurements at China Jinping underground laboratory with a Bonner multi-sphere spectrometer

    Science.gov (United States)

    Hu, Qingdong; Ma, Hao; Zeng, Zhi; Cheng, Jianping; Chen, Yunhua; He, Shengming; Li, Junli; Shen, Manbin; Wu, Shiyong; Yue, Qian; Yue, Jianfeng; Zhang, Hui

    2017-07-01

    The neutron background spectrum from thermal neutron to 20 MeV fast neutron was measured at the first experimental hall of China Jinping underground laboratory with a Bonner multi-sphere spectrometer. The measurement system was validated by a 252Cf source and inconformity was corrected. Due to micro charge discharge, the dataset was screened and background from the steel of the detectors was estimated by MC simulation. Based on genetic algorithm we obtained the energy distribution of the neutron and the total flux of neutron was (2.69±1.02) ×10-5 cm-2 s-1.

  5. The INSIG2 rs7566605 polymorphism is not associated with body mass index and breast cancer risk

    DEFF Research Database (Denmark)

    Campa, Daniele; Hüsing, Anika; McKay, James D.

    2010-01-01

    fatness was a genome-wide association study (GWAS) which used BMI as the primary phenotype. Many follow-up studies sought to validate the association of rs7566605 with various markers of obesity, with several publications reporting inconsistent findings. BMI is considered to be one of the measures...... of choice to evaluate body fatness and there is evidence that body fatness is related with an increased risk of breast cancer (BC). Methods we tested in a large-scale association study (3,973 women, including 1,269 invasive BC cases and 2,194 controls), nested within the EPIC cohort, the involvement of rs...

  6. Final Project Report Project 10749-4.2.2.1 2007-2009

    Energy Technology Data Exchange (ETDEWEB)

    Zacher, Alan H.; Holladay, Johnathan E.; Frye, J. G.; Brown, Heather M.; Santosa, Daniel M.; Oberg, Aaron A.

    2009-05-11

    This is the final report for the DOE Project 10749-4.2.2.1 for the FY2007 - FY2009 period. This report is non-proprietary, and will be submitted to DOE as a final project report. The report covers activities under the DOE Project inside CRADA 269 (Project 53231) as well as project activites outside of that CRADA (Project 56662). This is the final report that is summarized from the non-proprietary quarterlies submitted to DOE over the past 2.5 years, which in turn are summaries from the proprietary technical reporting to UOP.

  7. Same-Sex Sexual Attraction Does Not Spread in Adolescent Social Networks

    OpenAIRE

    2013-01-01

    Peers have a powerful effect on adolescents' beliefs, attitudes, and behaviors. Here, we examine the role of social networks in the spread of attitudes towards sexuality using data from the National Longitudinal Study of Adolescent Health (Add Health). Although we found evidence that both sexual activity (OR = 1.79) and desire to have a romantic relationship (OR = 2.69) may spread from person to person, attraction to same sex partners did not spread (OR = 0.96). Analyses of comparable power t...

  8. Growth hormone, interferon-gamma, and leukemia inhibitory factor promoted tyrosyl phosphorylation of insulin receptor substrate-1

    DEFF Research Database (Denmark)

    Argetsinger, L S; Hsu, G W; Myers, M G

    1995-01-01

    , GH-dependent tyrosyl phosphorylation of IRS-1 was detected by 1 min and at GH concentrations as low as 5 ng/ml (0.23 nM). Tyrosyl phosphorylation of IRS-1 was transient, with maximal stimulation detected at 30 min and diminished signal detected at 60 min. The ability of GH receptor (GHR) to transduce......., Campbell, G. S., Allevato, G., Billestrup, N., Norstedt, G., and Carter-Su, C. (1994) J. Biol. Chem. 269, 21709-21717). When other cytokines that activate JAK2 were tested for the ability to stimulate the tyrosyl phosphorylation of IRS-1, stimulation was detected with interferon-gamma and leukemia...

  9. Evaporation Dynamics of a Seven-Component Mixture Containing Nerve Agent Simulants

    Science.gov (United States)

    2014-02-01

    250 °C Hydrogen flow rate: 450 mL/min Air flow rate: 450mL/min Constant make up flow Mass Spectrometer Detector (MSD) Transfer Line Heater...Points Average VP (Pa) Antoine Equation VP (Pa) % Difference 100(Pexp-Pcalc)/Pcalc Standard Deviation 5.0 7 24.09 23.46 2.69 0.067 10.0 15...curve illustrating agreement between this work and Antoine Equation of Buchanan et al. 10 100 34.0 34.5 35.0 35.5 36.0 D M M P Va po r P re ss ur e

  10. EST Table: FS919769 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS919769 E_FL_fufe_48F20_F_0 11/12/09 10/09/28 94 %/274 aa ref|NP_001040124.1| exuperant...ia [Bombyx mori] gb|ABD36117.1| exuperantia [Bombyx mori] 10/09/13 37 %/281 aa FBpp0277938|Dpseexu1-PA .../268 aa gnl|Amel|GB19360-PA 10/09/10 49 %/269 aa gi|91085815|ref|XP_974770.1| PREDICTED: similar to exuperantia [Tribolium castaneum] FS919769 fufe ...

  11. Delineating groundwater and subsurface structures by

    Directory of Open Access Journals (Sweden)

    Sultan Awad Sultan Araffa

    2015-06-01

    One hundred and fifty-three ground magnetic measurements are collected using two Proton magnetometers (Envimag. The corrected magnetic data are represented by total magnetic intensity map that was reduced to the magnetic pole. 3D magnetic modeling was applied to detect the depth of basaltic sheet and basement complex. The results indicated that the elevation of upper surface of basalt is ranging from 148 to −153 m and the elevation of lower surface of basalt is ranging from 148 to 269 m.

  12. Proteomics

    DEFF Research Database (Denmark)

    Tølbøll, Trine Højgaard; Danscher, Anne Mette; Andersen, Pia Haubro;

    2012-01-01

    different proteins were identified, with 146 proteins available for identification in C, 279 proteins in D and 269 proteins in L. A functional annotation of the identified proteins was obtained using the on-line Blast2GO tool. Three hundred and sixteen of the identified proteins could be subsequently...... grouped manually to one or more of five major functional groups related to metabolism, cell structure, immunity, apoptosis and angiogenesis. These were chosen to represent basic cell functions and biological processes potentially involved in the pathogenesis of CHD. The LC–MS/MS-based proteomic analysis...

  13. McNamara, Clifford, and the Burdens of Vietnam, 1965-1969 (Secretaries of Defense Historical Series, Volume 6)

    Science.gov (United States)

    2011-01-01

    influential and longest serving, Colonel (later Lieutenant General) Robert E. Purs- ley , served under three secretaries from 1966 to August 1972. Military...67, FRUS 1964-68, 5:381 -83. 79. McNamara, In Retrospect, 269 (quote); SecDef DPM for Pres, 19 May 67, FRUS 1964-68, 5:423-38; Shap- ley , Promise and...92 IIIA 50-64 I1IB 31-49 IVA 21-30 IVB 16-20 1VC 10-15 V 1-9. 20. Memo SecDef for Pres, 2 Mar 66, memo SecDef for SvcSecs, 2 Mar 66: fldr

  14. Alain Bègue, Carlos Mata Induráin and Pietro Taravacci, eds., Comedia burlesca y teatro breve del Siglo de Oro - Felipe B. Pedraza Jiménez, Rafael González Cañal and Elena E. Marcello, eds., La desvergüenza en la comedia española

    Directory of Open Access Journals (Sweden)

    Fernando Plata

    2015-01-01

    Full Text Available Review of Alain Bègue, Carlos Mata Induráin and Pietro Taravacci, eds., Comedia burlesca y teatro breve del Siglo de Oro, Eunsa, Pamplona, 2013, 269 pp. ISBN: 9788431329228 and Felipe B. Pedraza Jiménez, Rafael González Cañal and Elena E. Marcello, eds., La desvergüenza en la comedia española. XXXIV Jornadas de teatro clásico. Almagro, 5, 6 y 7 de julio de 2011, Universidad de Castilla-La Mancha, Cuenca, 2013, 290 pp. ISBN: 9788490440421.

  15. Genetic and Hormonal Risk Factors for Cancer in African American Men

    Science.gov (United States)

    2006-05-01

    incidence, mortality, and survival trends in the United States: 1981–2001. Semin Urol Oncol 2002;20:3–9. 3. Robbins JM , Vaccarino V, Zhang HP, Kasl SV...cancer risk. Br JCancer 2003;88:263–269. 9. Cooney KA, Strawderman MS, Wojno KJ, Doerr KM, Taylor A, Alcser KH, Heeringa SG, Taylor JM , Wei JT, Montie...905–908. 6 Kim J, Coetzee GA. Prostate specific antigen gene regulation by androgen receptor. J Cell Biochem 2004; 93: 233–241. 7 Cramer SD, Chang

  16. Nursing Education and the Black Nurse ... An Overview

    Directory of Open Access Journals (Sweden)

    J.P. Samson

    1978-09-01

    Full Text Available In 1907, Cecilia Makiwane passed the final examination for general nurses of the Cape Colonial Medical Council, and on 7 January 1908 became the first Black registered professional nurse in South Africa (1:269. On 31 December 1977 there were 18 362 Black nurses on the registers of the South African Nursing Council3. At the time when a new Health Act (63/1977 and a new Nursing Act (50/1978 have been promulgated, and “Curationis” makes its début, it is well to look at the highlights of the development of nursing education for Blacks during the past 70 years.

  17. Small volumes of n-propanol (60%) applied for 3 minutes may be ineffective for surgical hand disinfection

    OpenAIRE

    Kampf, Günter; Ostermeyer, Christiane

    2014-01-01

    Background There is a trend in some countries to recommend the use of surgical hand disinfectants at volumes as low as 4 ml per application. Aim To determine whether the volume applied and hand size influence the efficacy of surgical hand disinfection. Methods Thirteen experiments, according to EN 12791, resulting in 269 datasets from 75 subjects were analyzed. Hands were first washed for one minute with soap. The pre-values were obtained by rubbing the finger tips in tryptic soy broth for on...

  18. The Role of GADD34 (Growth Arrest and DNA Damage-Inducible Protein) in Regulating Apoptosis, Proliferation, and Protein Synthesis in Human Breast Cancer Cells

    Science.gov (United States)

    2005-07-01

    and Lee, E. Y. (1994) J. Biol. Chein . 269, 12. Wakula, P., Bcullena, M., Ceulemans, H,, Stalinans, W., and Bollen, M. (2003) 13766-13770 J. Biol... Chein . 271, 28478-28484 14. Conner. J. H., Kicernan, T., Banik. S., Honkanen, R. E., and Shenolikar, S. 34. Schiender, K. K., Wang, W., and Wilson, S...E. (1989) Biochem. Biophys. Res. (1999) J. Riol. Chein .. 274, 22366-22372 Commun. 159, 72-78 15. Watanabe, T., Huang, H. B., Horiuchi, A., da Cruze

  19. Disorganising Bureaucracies

    DEFF Research Database (Denmark)

    Hundebøl, Jesper

    2008-01-01

    for contracts. Command 5b dictates the public client to request that the design team produces a 3D building model. The building model must be object oriented and exchangeable via the IFC-format. The goal of the initiative - Digital Construction - is to spark efficiency in construction by introducing information...... a representational (41% return) sample of 269 architects, engineers, clients, etc. Collected between 2007-2008. Methods assemblage. Inspired by a breed of alternative methodologies my research strategy draws on actor-network theory (ANT), taking an ontologically relativist, yet empirically realist approach...

  20. Disorganising Bureaucracies

    DEFF Research Database (Denmark)

    Hundebøl, Jesper

    for contracts. Command 5b dictates the public client to request that the design team produces a 3D building model. The building model must be object oriented and exchangeable via the IFC-format. The goal of the initiative - Digital Construction - is to spark efficiency in construction by introducing information...... a representational (41% return) sample of 269 architects, engineers, clients, etc. Collected between 2007-2008. Methods assemblage. Inspired by a breed of alternative methodologies my research strategy draws on actor-network theory (ANT), taking an ontologically relativist, yet empirically realist approach...