Extraction systems for the study of dubnium
International Nuclear Information System (INIS)
Gates, J.M.; Sudowe, R.; Ali, M.N.; Calvert, M.G.; Dragojevic, I.; Ellison, P.A.; Garcia, M.A.; Gharibyan, N.; Gregorich, K.E.; Nelson, S.L.; Neumann, S.H.; Parsons-Moss, T.; Stavsetra, L.; Nitsche, H.
2007-01-01
The chemistry of transactinide elements (Z (ge) 104) is a topic of great interest in current nuclear chemistry research. The chemical systems that can be used in these studies are limited by the short half-lives of the isotopes and the small production rates of atoms per minute or even atoms per week. In the initial investigations, the chemistry used had to be very selective to the periodic group of interest to separate the transactinide atom from all the other unwanted nuclear reaction products, e.g., transfer products. By using the Berkeley Gas-filled Separator (BGS) as a physical pre-separator, we are able concentrate on systems that are selective between the members of the group of interest, because all other interfering products and the beam are being suppressed by the BGS [1]. We are developing suitable extraction systems for the study of element 105, dubnium. For this purpose we have studied the extraction of niobium and tantalum, the lighter homologs of dubnium, from mineral acids with different organophosphorus compounds. All studies were performed online, using short-lived niobium and tantalum produced in the 124 Sn( 51 V,5n) 170 Ta and 74 Se( 18 O,p3n) 88 Nb reactions. This allowed for the study of the lighter homologues at metal concentrations of 10 -16 M. At these low metal concentrations, the formation of polymeric species is largely prohibited. As seen in Fig. 1, by varying the extractant and the hydrochloric acid concentration from 1 to 11 M, we are able to see a difference in extraction behavior between niobium and tantalum. While the system is suitable for determining chemical differences between the lighter homologues, the extraction of tantalum from hydrochloric acid shows slow kinetics. Figure 2 shows that after 90 seconds of mixing, the system is not in equilibrium. However, experiments indicate that equilibrium is reached faster at higher acid concentrations. We have studied the influence of hydrogen ion concentration on the extraction
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Gambling. 25.7 Section 25.7 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.7 Gambling. Participating in games for money or other personal property or operating gambling...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Definition. 257.3 Section 257.3 National Defense... SERVICE OF PROCESS § 257.3 Definition. Service of Process. When applied to the filing of a court action... delivery of a subpoena for any other reason whether or not the matter involves the United States. ...
6 CFR 25.7 - Litigation management.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Litigation management. 25.7 Section 25.7 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.7 Litigation management. (a) Liability for all claims...
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 257.3-8 Section 257.3-8... and Practices § 257.3-8 Safety. (a) Explosive gases. The concentration of explosive gases generated by... shall not pose a hazard to the safety of persons or property from fires. This may be accomplished...
40 CFR 257.3-4 - Ground water.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Ground water. 257.3-4 Section 257.3-4... and Practices § 257.3-4 Ground water. (a) A facility or practice shall not contaminate an underground drinking water source beyond the solid waste boundary or beyond an alternative boundary specified in...
40 CFR 257.3-3 - Surface water.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Surface water. 257.3-3 Section 257.3-3... and Practices § 257.3-3 Surface water. (a) For purposes of section 4004(a) of the Act, a facility... Water Act, as amended. (b) For purposes of section 4004(a) of the Act, a facility shall not cause a...
27 CFR 40.257 - Processed tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Processed tobacco. 40.257 Section 40.257 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND...
29 CFR 25.7 - Fees; cost; expenses; decisions.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Fees; cost; expenses; decisions. 25.7 Section 25.7 Labor... ORDER 10988 § 25.7 Fees; cost; expenses; decisions. (a) Arbitrator's fees, per diem and travel expenses... entirely by the agency. (b) The standard fee for the services of an arbitrator should be $100 per day...
40 CFR 264.257 - Special requirements for incompatible wastes.
2010-07-01
... DISPOSAL FACILITIES Waste Piles § 264.257 Special requirements for incompatible wastes. (a) Incompatible... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 264.257 Section 264.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
40 CFR 265.257 - Special requirements for incompatible wastes.
2010-07-01
..., STORAGE, AND DISPOSAL FACILITIES Waste Piles § 265.257 Special requirements for incompatible wastes. (a... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.257 Section 265.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
43 CFR 2.57 - Accounting for disclosures.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Accounting for disclosures. 2.57 Section 2... INFORMATION ACT Privacy Act § 2.57 Accounting for disclosures. (a) Maintenance of an accounting. (1) Where a... the person or agency to whom the disclosure was made. (3) Accountings prepared under this section...
40 CFR 257.3-2 - Endangered species.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Endangered species. 257.3-2 Section... Disposal Facilities and Practices § 257.3-2 Endangered species. (a) Facilities or practices shall not cause or contribute to the taking of any endangered or threatened species of plants, fish, or wildlife. (b...
7 CFR 2.57 - Administrator, Food and Nutrition Service.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Food and Nutrition Service. 2.57... for Food, Nutrition, and Consumer Services § 2.57 Administrator, Food and Nutrition Service. (a... delegations of authority are made by the Under Secretary for Food, Nutrition, and Consumer Services to the...
42 CFR 447.257 - FFP: Conditions relating to institutional reimbursement.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false FFP: Conditions relating to institutional reimbursement. 447.257 Section 447.257 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF...: Conditions relating to institutional reimbursement. FFP is not available for a State's expenditures for...
SISAK liquid-liquid extraction experiments with preseparated 257Rf
International Nuclear Information System (INIS)
Omtvedt, Jon Petter; Alstad, J.; Breivik, H.; Dyve, J.E.; Eberhardt, K.; Folden III, C.M.; Ginter, T.; Gregorich, K.E.; Hult, E.A.; Johansson, M.; Kirbach, U.W.; Lee, D.M.; Mendel, M.; Nahler, A.; Ninov, V.; Omtvedt, L.A.; Patin, J.B.; Skarnemark, G.; Stavsetra, L.; Sudowe, R.; Wiehl, N.; Wierczinski, B.; Wilk, P.A.; Zielinski, P.M.; Kratz, J.V.; Trautmann, N.; Nitsche, H.; Hoffman, D.C.
2002-01-01
The SISAK liquid-liquid extraction system was used to extract 4.0-s 257Rf. The 257Rf was produced in the reaction 208Pb(50Ti, 1n)257Rf with 237-MeV beam energy on target, separated in the Berkeley Gas-filled Separator (BGS) and transferred to a gas jet using the Recoil Transfer Chamber (RTC). The activity delivered by the gas jet was dissolved in 6-M HNO3 and Rf was extracted into 0.25-M dibutyl-phosphoric acid in toluene. This was the first time a transactinide, i.e., an element with Z >= 104, was extracted and unequivocally identified by the SISAK system. Thus, this pilot experiment demonstrates that the fast liquid-liquid extraction system SISAK, in combination with liquidscintillation detectors, can be used for investigating the chemical properties of the transactinides. The extraction result is in accordance with the behaviour shown by the Rf group IV homologues Zr and Hf
50 CFR 216.257 - Letters of Authorization.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.257 Letters of Authorization. (a) A Letter of Authorization, unless suspended or revoked...
SISAK liquid-liquid extraction experiments with preseparated {sup 257}Rf
Energy Technology Data Exchange (ETDEWEB)
Omtvedt, Jon Petter; Alstad, J.; Breivik, H. [University of Oslo, Department of Chemistry, Oslo (NO)] (and others)
2002-06-01
The SISAK liquid-liquid extraction system was used to extract 4.0-s {sup 257}Rf. The {sup 257}Rf was produced in the reaction {sup 208}Pb({sup 50}Ti, 1n){sup 257}Rf with 237-MeV beam energy on target, separated in the Berkeley Gas-filled Separator (BGS) and transferred to a gas jet using the Recoil Transfer Chamber (RTC). The activity delivered by the gas jet was dissolved in 6-M HNO{sub 3} and Rf was extracted into 0.25-M dibutyl-phosphoric acid in toluene. This was the first time a transactinide, i.e., an element with Z{>=}104, was extracted and unequivocally identified by the SISAK system. Thus, this pilot experiment demonstrates that the fast liquid-liquid extraction system SISAK, in combination with liquid-scintillation detectors, can be used for investigating the chemical properties of the transactinides. The extraction result is in accordance with the behaviour shown by the Rf group IV homologues Zr and Hf. (author)
Photoelectron Emission Studies in CsBr at 257 nm
International Nuclear Information System (INIS)
Maldonado, Juan R.; Liu, Zhi; Sun, Yun; Pianetta, Piero A.; Pease, Fabian W.
2006-01-01
CsBr/Cr photocathodes were found [1,2] to meet the requirements of a multi-electron beam lithography system operating with a light energy of 4.8 eV (257nm). The fact that photoemission was observed with a light energy below the reported 7.3 eV band gap for CsBr was not understood. This paper presents experimental results on the presence of intra-band gap absorption sites (IBAS) in CsBr thin film photo electron emitters, and presents a model based on IBAS to explain the observed photoelectron emission behavior at energies below band gap. A fluorescence band centered at 330 nm with a FWHM of about 0.34 eV was observed in CsBr/Cr samples under 257 nm laser illumination which can be attributed to IBAS and agrees well with previously obtained synchrotron photoelectron spectra[1] from the valence band of CsBr films
Energy Technology Data Exchange (ETDEWEB)
Gates, Jacklyn M. [Univ. of California, Berkeley, CA (United States)
2008-07-31
Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070$+1100\\atop{-760}$ pb was measured at an excitation energy of 16.0 ± 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660$+450\\atop{-370}$ pb was measured at 22.0 ± 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480$+1730\\atop{-1370}$ pb at an excitation energy of 16.0 ± 1.6 MeV. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier. The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid and mixed hydrochloric acid/lithium chloride media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments was to find a system that demonstrates selectivity among the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z = 105). Experiments with niobium and tantalum were performed with carrier (10-6 M), carrier free (10-10 M) and trace (10-16 M) concentrations of metal using hydrochloric acid solution with concentrations ranging from 1 - 11 M. The extraction of niobium and tantalum from mixed hydrochloric acid/lithium chloride media by HDEHP and BEHP as a function of hydrogen ion (H+) concentration was also investigated. The data obtained are used as the basis to discuss the speciation of niobium and tantalum under the conditions studied and to evaluate possible extraction mechanisms. The 74Se(18O,p3n)88gNb excitation function was measured to determine the best energy for producing the 88Nb used in chemistry experiments. A maximum cross section of 495 +- 5 mb was observed at an 18O energy of 74.0 Me
International Nuclear Information System (INIS)
Rojas Martinez, Y.; Bustos Rodriguez, H.; Oyola Lozano, D.; Perez Alcazar, G. A.; Paz, J. C.
2007-01-01
The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb 0.257-x Nd x Fe 0.743 alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the α and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.
Loci and candidate genes conferring resistance to soybean cyst nematode HG type 2.5.7.
Zhao, Xue; Teng, Weili; Li, Yinghui; Liu, Dongyuan; Cao, Guanglu; Li, Dongmei; Qiu, Lijuan; Zheng, Hongkun; Han, Yingpeng; Li, Wenbin
2017-06-14
Soybean (Glycine max L. Merr.) cyst nematode (SCN, Heterodera glycines I,) is a major pest of soybean worldwide. The most effective strategy to control this pest involves the use of resistant cultivars. The aim of the present study was to investigate the genome-wide genetic architecture of resistance to SCN HG Type 2.5.7 (race 1) in landrace and elite cultivated soybeans. A total of 200 diverse soybean accessions were screened for resistance to SCN HG Type 2.5.7 and genotyped through sequencing using the Specific Locus Amplified Fragment Sequencing (SLAF-seq) approach with a 6.14-fold average sequencing depth. A total of 33,194 SNPs were identified with minor allele frequencies (MAF) over 4%, covering 97% of all the genotypes. Genome-wide association mapping (GWAS) revealed thirteen SNPs associated with resistance to SCN HG Type 2.5.7. These SNPs were distributed on five chromosomes (Chr), including Chr7, 8, 14, 15 and 18. Four SNPs were novel resistance loci and nine SNPs were located near known QTL. A total of 30 genes were identified as candidate genes underlying SCN resistance. A total of sixteen novel soybean accessions were identified with significant resistance to HG Type 2.5.7. The beneficial alleles and candidate genes identified by GWAS might be valuable for improving marker-assisted breeding efficiency and exploring the molecular mechanisms underlying SCN resistance.
24 CFR 983.257 - Owner termination of tenancy and eviction.
2010-04-01
... (iv) do not apply to the PBV program. (In the PBV program, “good cause” does not include a business or... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.257 Owner termination of tenancy... good cause as stated in paragraph (a) of this section; (3) Refuse to renew the lease without good cause...
2010-07-01
... compliance with §§ 257.7 through 257.30 prior to the receipt of CESQG hazardous waste. (b) Definitions.... Waste management unit boundary means a vertical surface located at the hydraulically downgradient limit.../operators of non-municipal non-hazardous waste disposal units that receive Conditionally Exempt Small...
24 CFR 257.401 - Notice of false information from mortgagor-procedure.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of false information from... HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM Enforcement Mortgagor False Information § 257.401 Notice of false information from mortgagor-procedure. (a) If FHA finds that the mortgagor has...
2010-04-01
... mortgage insurance premiums for H4H program mortgages. 257.203 Section 257.203 Housing and Urban... mortgage insurance premiums for H4H program mortgages. (a) Applicable premiums. Any mortgage presented for... LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM...
Energy Technology Data Exchange (ETDEWEB)
Rojas Martinez, Y., E-mail: yarojas@ut.edu.co; Bustos Rodriguez, H.; Oyola Lozano, D. [University of Tolima, Department of Physics (Colombia); Perez Alcazar, G. A.; Paz, J. C. [University of Valle, Department of Physics (Colombia)
2007-02-15
The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb{sub 0.257-x}Nd{sub x}Fe{sub 0.743} alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the {alpha} and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for operations in the band 29.1-29.25 GHz between NGSO MSS and LMDS. 25.257 Section 25.257 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25...
2-(5,7-Dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetic acid
Directory of Open Access Journals (Sweden)
Hong Dae Choi
2008-08-01
Full Text Available The title compound, C13H14O3S, was prepared by alkaline hydrolysis of ethyl 2-(5,7-dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetate. In the crystal structure, the carboxyl groups are involved in intermolecular O—H...O hydrogen bonds, which link the molecules into centrosymmetric dimers. These dimers are further packed into stacks along the a axis by weak C—H...π interactions.
Structure of the conserved hypothetical protein MAL13P1.257 from Plasmodium falciparum
International Nuclear Information System (INIS)
Holmes, Margaret A.; Buckner, Frederick S.; Van Voorhis, Wesley C.; Mehlin, Christopher; Boni, Erica; Earnest, Thomas N.; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Zucker, Frank; Schoenfeld, Lori W.; Hol, Wim G. J.; Merritt, Ethan A.
2006-01-01
The crystal structure of a conserved hypothetical protein, MAL13P1.257 from P. falciparum, has been determined at 2.17 Å resolution. The structure represents a new protein fold and is the first structural representative for Pfam sequence family PF05907. The structure of a conserved hypothetical protein, PlasmoDB sequence MAL13P1.257 from Plasmodium falciparum, Pfam sequence family PF05907, has been determined as part of the structural genomics effort of the Structural Genomics of Pathogenic Protozoa consortium. The structure was determined by multiple-wavelength anomalous dispersion at 2.17 Å resolution. The structure is almost entirely β-sheet; it consists of 15 β-strands and one short 3 10 -helix and represents a new protein fold. The packing of the two monomers in the asymmetric unit indicates that the biological unit may be a dimer.
Fox, Raymond G; Magness, Scott; Kujoth, Gregory C; Prolla, Tomas A; Maeda, Nobuyo
2012-05-01
Changes in intestinal absorption of nutrients are important aspects of the aging process. To address this issue, we investigated the impact of accelerated mitochondrial DNA mutations on the stem/progenitor cells in the crypts of Lieberkühn in mice homozygous for a mitochondrial DNA polymerase gamma mutation, Polg(D257A), that exhibit accelerated aging phenotype. As early as 3-7 mo of age, the small intestine was significantly enlarged in the PolgD257A mice. The crypts of the PolgD257A mice contained 20% more cells than those of their wild-type littermates and exhibited a 10-fold increase in cellular apoptosis primarily in the stem/progenitor cell zones. Actively dividing cells were proportionally increased, yet a significantly smaller proportion of cells was in the S phase of the cell cycle. Stem cell-derived organoids from PolgD257A mice failed to develop fully in culture and exhibited fewer crypt units, indicating an impact of the mutation on the intestinal epithelial stem/progenitor cell maintenance. In addition, epithelial cell migration along the crypt-villus axis was slowed and less organized, and the ATP content in the villi was significantly reduced. On a high-fat, high-carbohydrate diet, PolgD257A mice showed significantly restricted absorption of excess lipids accompanied by an increase in fecal steatocrits. We conclude that the PolgD257A mutation causes cell cycle dysregulation in the crypts leading to the age-associated changes in the morphology of the small intestine and contributes to the restricted absorption of dietary lipids.
Fox, Raymond; Kim, Hyung-Suk; Reddick, Robert L; Kujoth, Gregory C; Prolla, Tomas A; Tsutsumi, Shuichi; Wada, Youichiro; Smithies, Oliver; Maeda, Nobuyo
2011-05-24
Diabetes and the development of its complications have been associated with mitochondrial DNA (mtDNA) dysfunction, but causal relationships remain undetermined. With the objective of testing whether increased mtDNA mutations exacerbate the diabetic phenotype, we have compared mice heterozygous for the Akita diabetogenic mutation (Akita) with mice homozygous for the D257A mutation in mitochondrial DNA polymerase gamma (Polg) or with mice having both mutations (Polg-Akita). The Polg-D257A protein is defective in proofreading and increases mtDNA mutations. At 3 mo of age, the Polg-Akita and Akita male mice were equally hyperglycemic. Unexpectedly, as the Polg-Akita males aged to 9 mo, their diabetic symptoms decreased. Thus, their hyperglycemia, hyperphagia and urine output declined significantly. The decrease in their food intake was accompanied by increased plasma leptin and decreased plasma ghrelin, while hypothalamic expression of the orexic gene, neuropeptide Y, was lower and expression of the anorexic gene, proopiomelanocortin, was higher. Testis function progressively worsened with age in the double mutants, and plasma testosterone levels in 9-mo-old Polg-Akita males were significantly reduced compared with Akita males. The hyperglycemia and hyperphagia returned in aged Polg-Akita males after testosterone administration. Hyperglycemia-associated distal tubular damage in the kidney also returned, and Polg-D257A-associated proximal tubular damage was enhanced. The mild diabetes of female Akita mice was not affected by the Polg-D257A mutation. We conclude that reduced diabetic symptoms of aging Polg-Akita males results from appetite suppression triggered by decreased testosterone associated with damage to the Leydig cells of the testis.
Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies
Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.
1984-01-01
The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle
Shirey, Carolyn; Badieyan, Somayesadat; Sobrado, Pablo
2013-11-08
SidA (siderophore A) is a flavin-dependent N-hydroxylating monooxygenase that is essential for virulence in Aspergillus fumigatus. SidA catalyzes the NADPH- and oxygen-dependent formation of N(5)-hydroxyornithine. In this reaction, NADPH reduces the flavin, and the resulting NADP(+) is the last product to be released. The presence of NADP(+) is essential for activity, as it is required for stabilization of the C4a-hydroperoxyflavin, which is the hydroxylating species. As part of our efforts to determine the molecular details of the role of NADP(H) in catalysis, we targeted Ser-257 for site-directed mutagenesis and performed extensive characterization of the S257A enzyme. Using a combination of steady-state and stopped-flow kinetic experiments, substrate analogs, and primary kinetic isotope effects, we show that the interaction between Ser-257 and NADP(H) is essential for stabilization of the C4a-hydroperoxyflavin. Molecular dynamics simulation results suggest that Ser-257 functions as a pivot point, allowing the nicotinamide of NADP(+) to slide into position for stabilization of the C4a-hydroperoxyflavin.
Energy Technology Data Exchange (ETDEWEB)
Despotopulos, J D; Sudowe, R
2012-02-21
Studies of the chemical properties of superheavy elements (SHE) pose interesting challenges due to their short half-lives and low production rates. Chemical systems must have extremely fast kinetics, fast enough kinetics to be able to examine the chemical properties of interest before the SHE decays to another nuclide. To achieve chemistry on such time scales, the chemical system must also be easily automated. Most importantly however, a chemical system must be developed which provides suitable separation and kinetics before an on-line study of a SHE can be performed. Relativistic effects make studying the chemical properties of SHEs interesting due to the impact these effects could have on the SHEs chemical properties. Relativistic effects arise when the velocity of the s orbital electrons approach the speed of light. As this velocity increases, the Bohr radius of the inner electron orbitals decreases and there is an increase in the particles mass. This contraction results in a destabilization of the energy of the outer d and f electron orbitals (5f and 6d in the case of SHE), which can cause these to expand due to their increased shielding from the nuclear charge. Another relativistic effect is the spin-orbit splitting for p, d, and f orbitals into j = 1 {+-} 1/2 states. This can lead most interestingly to a possible increased stability of element 114, which due to large spin-orbit splitting of the 7p orbital and the relativistically stabilized 7p{sub 1/2} and 7s orbital gives rise to a closed shell ground state of 7s{sup 2}7p{sub 1/2}{sup 2}. The homologs of element 105, dubnium (Db), Ta and Nb and the pseudo-homolog Pa, are well known to hydrolyze and form both neutral and non-neutral monoatomic and polyatomic species that may cause issues with extraction from a given chemical system. Early ion-exchange and solvent-extraction studies show mixed results for the behavior of Db. Some studies show Db behaving most similar to Ta, while others show it behaving
Half-lives of long-lived isotopes of transactinium elements from 228Th to 257Fm
International Nuclear Information System (INIS)
Surin, V.M.; Fomushkin, Eh.F.
1983-09-01
The experimental measurements and critical evaluation results of the long-lived isotope half-decay periods of transactinium elements (from 228 Th to 257 Fm) are given on July 1981 to be published in open literature and related to the natural radioactive decay. From the massif of the known half-decay periods the most reliable data were selected, received or evaluated and recommended for practical use; the calculations of isotope specific activities were performed on this data. (author)
Directory of Open Access Journals (Sweden)
Mauricio Galvis-Patiño
2017-01-01
Full Text Available En el presente trabajo se reporta el estudio de las propiedades estructurales y magnéticas de la composición en forma de polvo de Gd0.257-xTbxFe0.743 con x=0, 0.1285, 0.257,preparados por Aleamiento Mecánico (AM en atmosfera de argón durante 72 horas mediante un molino planetario de alta energía ;la caracterización estructural se realizó por medio de Difractometría de rayos X(DRX, para la caracterización magnética se utilizó la espectroscopía Mössbauer, los ciclos de histéresis se llevaron a cabo a través de PPMS (Physical Property Measurement System, Sistema de Medidas de Propiedades Físicas. La fase de α-Fe se presenta en los tres difractogramas mediante un pico característico cuya intensidad disminuye al reemplazar el Tb por el Gd, presentándose la menor en x= 0 así mismo se observa un aumento de su ancho atribuible a la presencia de átomos de Gd en lugares propios del Fe. Los espectros Mössbauer (EM fueron ajustados con sextetos, dobletes, singletes y distribuciones de campo hiperfino lo que señala que el orden magnético se ve alterado al sustituir el Tb por el Gd en la composición. Las propiedades magnéticas extrínsecas de la composición en estudio, la caracterizan como materiales magnéticamente semiduros.
Kidney transplant graft outcomes in 379 257 recipients on 3 continents.
Merion, Robert M; Goodrich, Nathan P; Johnson, Rachel J; McDonald, Stephen P; Russ, Graeme R; Gillespie, Brenda W; Collett, David
2018-03-24
Kidney transplant outcomes that vary by program or geopolitical unit may result from variability in practice patterns or health care delivery systems. In this collaborative study, we compared kidney graft outcomes among 4 countries (United States, United Kingdom, Australia, and New Zealand) on 3 continents. We analyzed transplant and follow-up registry data from 1988-2014 for 379 257 recipients of first kidney-only transplants using Cox regression. Compared to the United States, 1-year adjusted graft failure risk was significantly higher in the United Kingdom (hazard ratio [HR] 1.22, 95% confidence interval [CI] 1.18-1.26, P < .001) and New Zealand (hazard ratio [HR] 1.29, 95% confidence interval [CI] 1.14-1.46, P < .001), but lower in Australia (HR 0.90, 95% CI 0.84-0.96, P = .001). In contrast, long-term adjusted graft failure risk (conditional on 1-year function) was significantly higher in the United States compared to Australia, New Zealand, and the United Kingdom (HR 0.74, 0.75, and 0.74, respectively; each P < .001). Thus long-term kidney graft outcomes are approximately 25% worse in the United States than in 3 other countries with well-developed kidney transplant systems. Case mix differences and residual confounding from unmeasured factors were found to be unlikely explanations. These findings suggest that identification of potentially modifiable country-specific differences in care delivery and/or practice patterns should be sought. © 2018 The American Society of Transplantation and the American Society of Transplant Surgeons.
Energy Technology Data Exchange (ETDEWEB)
Regnier, Cindy [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Harding, Ari [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Robinson, Alastair [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-07-01
The University of Hawai’i at M257noa (UHM) partnered with the US Department of Energy (DOE) and the Hawai`i Clean Energy Initiative to develop and implement solutions to retrofit exiting buildings to reduce energy consumption by at least 30% as part of DOE’s Commercial Building Partnerships (CBP) Program1. Kuykendall Hall, located on the UHM campus in Honolulu, was the focus of a CBP analysis and design collaboration among the University of Hawai’i, their consultants, and Lawrence Berkeley National Laboratory (LBNL). Kuykendall Hall consists of two 1960s-era wings – a four-story wing containing classrooms, and a seven-story tower containing offices – with a total floor area of approximately 76,000 square feet (ft²).
Tesco, G; Tanzi, R E
2000-01-01
We have previously shown that the endogenous C-terminal fragment of presenilin 1 co-immunoprecipitates with endogenous beta-catenin. Since PS1 has been suggested to be involved in beta-catenin stabilization, we further investigated whether GSK3 beta, responsible for beta-catenin phosphorylation and degradation, is part of the PS1/beta-catenin complex. In naïve H4 and CHO cells, PS1 co-immunoprecipitated with both endogenous beta-catenin and GSK3 beta. In addition, GSK3 beta endogenously binds to the PS1-CTF/NTF complex and beta-catenin in naïve CHO cells. GSK3 beta also co-immunoprecipitated with PS1 full length in CHO cell lines overexpressing PS1 wild type. Given that it has been recently shown that PS1 mutations of aspartate 257 or 385 result in prevention of PS1 endoproteolysis and inhibition of gamma-secretase activity, we also tested whether PS1 endoproteolysis is required for beta-catenin/GSK3 beta/PS1 binding and whether PS1 FAD-linked mutations affect GSK3 beta recruitment in the PS1/beta-catenin complex. GSK3 beta was detected in PS1 immunoprecipitates from H4 cell lines overexpressing PS1 wild type, delta E10, A286E, L246V and in CHO cell lines overexpressing aspartate or M146L mutations. The latter data show that the absence of PS1 endoproteolysis (D257A/D385A and delta E10) or the presence of PS1-FAD mutations does not interfere with beta-catenin/GSK3 beta/PS1 complex formation.
Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S Chen; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; He, X Q; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, J J; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H
2015-11-27
A neutral structure in the DD[over ¯]^{*} system around the DD[over ¯]^{*} mass threshold is observed with a statistical significance greater than 10σ in the processes e^{+}e^{-}→D^{+}D^{*-}π^{0}+c.c. and e^{+}e^{-}→D^{0}D[over ¯]^{*0}π^{0}+c.c. at sqrt[s]=4.226 and 4.257 GeV in the BESIII experiment. The structure is denoted as Z_{c}(3885)^{0}. Assuming the presence of a resonance, its pole mass and width are determined to be [3885.7_{-5.7}^{+4.3}(stat)±8.4(syst)] MeV/c^{2} and [35_{-12}^{+11}(stat)±15(syst)] MeV, respectively. The Born cross sections are measured to be σ[e^{+}e^{-}→Z_{c}(3885)^{0}π^{0},Z_{c}(3885)^{0}→DD[over ¯]^{*}]=[77±13(stat)±17(syst)] pb at 4.226 GeV and [47±9(stat)±10(syst)] pb at 4.257 GeV. The ratio of decay rates B[Z_{c}(3885)^{0}→D^{+}D^{*-}+c.c.]/B[Z_{c}(3885)^{0}→D^{0}D[over ¯]^{*0}+c.c.] is determined to be 0.96±0.18(stat)±0.12(syst), consistent with no isospin violation in the process, Z_{c}(3885)^{0}→DD[over ¯]^{*}.
Directory of Open Access Journals (Sweden)
Marziyeh Alamatsaz
2018-02-01
Full Text Available Background Rhizomelic chondrodysplasia punctata (RCDP type 1 is among of the rare autosomal recessive peroxisome biogenesis disorders caused by mutations in the PEX7 gene. RCDP patients with the classic form of RCDP1 do not live more than 10- year. Materials and Methods In the present study, a two-year-old girl with skeletal abnormalities and dysmorphic facial appearance is reported to be suffered from RCDP. The patient's parents were second cousins and healthy and there was no similar case in the parents’ family. PEX7 gene was sequenced in the patient and her parents. Results A homozygous mutation, G257A, was identified PEX7 in the genome of patient while the parents were compound heterozygous. Conclusion Taken together, clinical presentation and peroxisome profile of the patient suggested a missense mutation led to formation of a pathogenic PEX7, responsible for incidence of RCDP.
African Journals Online (AJOL)
User
IRRIGATED FLUVISOLS ALONG RIVER TATSEWARKI, KANO, NIGERIA ... concentrations of heavy metals in wastewater irrigated Fluvisols and in the ..... Effects of. Wastewater Discharge on Heavy Metals. Pollution in Fadama Soils in Kano ...
Directory of Open Access Journals (Sweden)
Christine S. M. Lau
2015-01-01
Full Text Available Introduction. Hepatocellular carcinoma (HCC is a rare pediatric cancer accounting for 0.5% of all pediatric malignancies. This study examines a large cohort of HCC patients in an effort to define the factors impacting clinical outcomes in pediatric HCC patients compared to adults. Methods. Demographic and clinical data on 63,771 HCC patients (257 pediatric patients ≤ 19 and 63,514 adult patients age ≥ 20 were abstracted from the SEER database (1973–2011. Results. HCC was more common among males (59.5% pediatric and 75.1% adults and Caucasians (50.4% and 50.5%, p 4 cm in size (79.6% versus 62.0%, p=0.02. Pediatric HCC patients undergoing surgery (13.107 versus 8.324 years, p4 cm in Caucasian males. Children with HCC achieve significantly longer mean overall survival compared to adults with HCC, primarily attributable to the more favorable fibrolamellar histologic variant, and more aggressive surgical intervention, which significantly improves survival.
Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu
2017-01-18
Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.
40 CFR Appendix II to Part 257 - Appendix II to Part 257
2010-07-01
... will be a minimum of five turnings of the windrow. Heat drying: Dewatered sludge cake is dried by... are only add-on in nature. Beta ray irradiation: Sludge is irradiated with beta rays from an...
International Nuclear Information System (INIS)
Gates, J.M.; California Univ., Berkeley, CA; Sudowe, R.; Stavsetra, L.
2009-01-01
The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments is to find a system that demonstrates selectivity between the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z=105). Experiments were performed at the trace level (10 -16 M Nb or Ta) using hydrochloric acid with concentrations ranging from 1-11 M and short-lived isotopes of Nb and Ta produced in nuclear reactions. When HDEHP was used as the extractant, the Nb extraction yield decreased with increasing acid concentrations above 6 M, while the amount of Ta extracted remained over 75% for all acid concentrations studied. Tantalum was found to be extracted by BEHP at acid concentrations above 6 M, while niobium was not significantly extracted. The data obtained are used as the basis to discuss the speciation of Nb and Ta under the conditions studied and to evaluate possible extraction mechanisms. (orig.)
Chemistry of superheavy elements
International Nuclear Information System (INIS)
Schaedel, M.
2012-01-01
The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)
2010-07-01
... not locate such units in wetlands, unless the owner or operator can make the following demonstrations... actions (e.g., restoration of existing degraded wetlands or creation of man-made wetlands); and (5) Sufficient information is available to make a reasonable determination with respect to these demonstrations...
2010-04-01
... records (See Item 18). 4. Organization Documents: (a) Title, franchises, and licenses: (1) Certificates of... (prepared for internal administrative or operating purposes) of estimated future income, receipts and...
2010-04-01
....C. 552a. (b) Individual. As used in this subpart, “individual” means a citizen of the United States... the Commission including, but not limited to, education, financial transactions, medical history, and... photograph. (e) System of records. As used in this subpart, “System of records” means a group of any records...
40 CFR 257.21 - Applicability.
2010-07-01
...) Site-specific field collected measurements, sampling, and analysis of physical, chemical, and... there is no potential for migration of hazardous constituents from that unit to the uppermost aquifer...; and (5) Resource value of the underlying aquifer, including: (i) Current and future uses; (ii...
2010-07-01
... grease removed from a grease trap at a restaurant. Facility means all contiguous land and structures... manure spreading operations) for agricultural purposes or for treatment and disposal. Landfill means an... industrial, commercial, mining, and agricultural operations, and from community activities, but does not...
Aqueous chemistry of transactinides
International Nuclear Information System (INIS)
Schaedel, M.
2001-01-01
The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)
The Use of the Delphi and Other Consensus Group Methods in Medical Education Research: A Review.
Humphrey-Murto, Susan; Varpio, Lara; Wood, Timothy J; Gonsalves, Carol; Ufholz, Lee-Anne; Mascioli, Kelly; Wang, Carol; Foth, Thomas
2017-10-01
Consensus group methods, such as the Delphi method and nominal group technique (NGT), are used to synthesize expert opinions when evidence is lacking. Despite their extensive use, these methods are inconsistently applied. Their use in medical education research has not been well studied. The authors set out to describe the use of consensus methods in medical education research and to assess the reporting quality of these methods and results. Using scoping review methods, the authors searched the Medline, Embase, PsycInfo, PubMed, Scopus, and ERIC databases for 2009-2016. Full-text articles that focused on medical education and the keywords Delphi, RAND, NGT, or other consensus group methods were included. A standardized extraction form was used to collect article demographic data and features reflecting methodological rigor. Of the articles reviewed, 257 met the inclusion criteria. The Modified Delphi (105/257; 40.8%), Delphi (91/257; 35.4%), and NGT (23/257; 8.9%) methods were most often used. The most common study purpose was curriculum development or reform (68/257; 26.5%), assessment tool development (55/257; 21.4%), and defining competencies (43/257; 16.7%). The reporting quality varied, with 70.0% (180/257) of articles reporting a literature review, 27.2% (70/257) reporting what background information was provided to participants, 66.1% (170/257) describing the number of participants, 40.1% (103/257) reporting if private decisions were collected, 37.7% (97/257) reporting if formal feedback of group ratings was shared, and 43.2% (111/257) defining consensus a priori. Consensus methods are poorly standardized and inconsistently used in medical education research. Improved criteria for reporting are needed.
Publications | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
A public talk with Globe and Mail journalist Doug Saunders. A third of humanity is on the move—usually from farms ... This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development. The study employs a sub-sectoral approach rather ...
7 CFR 1944.257 - Service coordinator.
2010-01-01
... professional relationships with all agencies and service providers in the community, and develop a directory of...) Maintain necessary case files on each program participant, containing such information and kept in such...) Assist the grant recipient in building informal support networks with neighbors, friends and family; and...
2010-07-01
... septic tank pumpings (Interim Final). A facility or practice involving disposal of sewage sludge or septic tank pumpings shall not exist or occur unless in compliance with paragraphs (b) (1), (2) or (3) of... trenching or burial operation.) (2) Septic tank pumpings that are applied to the land surface or...
Publications | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Any -, Central Asia, Europe, Far East Asia, Middle East, North and Central America ... Utilization of trade agreements in Sri Lanka : perceptions of exporters vs. statistical ... in diverse cropping patterns, lifestyles and social and cultural relations. ... Research assessed the level of access to sexual and reproductive health ...
Publications | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
TTI reports on its first two years of programming. During its first two years, the Think Tank Initiative has supported 52 institutions in ... the way we acquire, disseminate, and transform knowledge. And, as a result, knowledge production is becoming closer and more directly linked to economic competitiveness. This evolution.
17 CFR 257.1 - General instructions.
2010-04-01
... conflict with other legal retention requirements. Optional destruction of records relevant to pending or... statements including the transactions to which such records relate. (j) Use of technical accounting terms. For purposes of the schedules, traditional accounting terms such as ledgers, journals, registers and...
38 CFR 21.257 - Self-employment.
2010-07-01
.... (Authority: 38 U.S.C. 3104, 3116, 3117) (f) Feasibility analysis of a proposed self-employment business plan. VA will conduct a comprehensive review and analysis of the feasibility of a proposed business plan... amended; (6) The location of the site for the proposed business and the cost of the site, if any; and (7...
40 CFR 25.7 - Advisory groups.
2010-07-01
... agencies involved in activities supported by EPA financial assistance under any of the three Acts. (b) Role... should monitor the progress of the project and become familiar with issues relevant to project...
14 CFR 257.5 - Notice requirement.
2010-01-01
... that the corporate name of the transporting carrier and any other name under which that service is held... communication in the United States with a prospective consumer and in any telephone calls placed from the United... and shall identify the transporting carrier by its corporate name and any other name under which that...
2010-07-01
... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR CLASSIFICATION OF SOLID WASTE DISPOSAL FACILITIES AND PRACTICES Classification of Solid Waste Disposal Facilities... residential, commercial, institutional or industrial solid waste. This requirement does not apply to...
42 CFR 441.257 - Informed consent.
2010-10-01
... otherwise entitled. (ii) A description of available alternative methods of family planning and birth control... section was effectively communicated to any individual who is blind, deaf, or otherwise handicapped; (3...
International Nuclear Information System (INIS)
Bilewicz, A.; Siekierski, S.
1999-01-01
New evidence for the influence of relativistic effect on coordination number, (CN), and hydrolysis of Rf 4+ and Db 5+ aqua ions has been presented. It has been argued that very strong hydrolysis of the heaviest members of Groups 12, 13 is caused by the low CN of Hg 2+ and Tl 3+ in their aqua ions. Low CN is the result of relativistic effects which stabilize the 6s orbital, increasing thereby the respective promotion energy. That supports our previous view that strong hydrolysis of Rf aq 4+ much greater than that of Hf aq 4+ and Zr aq 4+ , is also a result of lower CN. Since the promotion energy for sp 3 d 4 hybridization (CN 8) seems to be close to that od sp 3 d 2 hybridization (CN 6), and since hybridization energies of Zr 4+ , Hf 4+ and Rf 4+ do not differ very much for hexa- and octahydrates the two aqua ions i.e., M(H 2 O) 6 4+ and M(H 2 O) 8 4+ may coexist in aqueous acid solutions. However, due to relativistic stabilization of 7s and destabilization of 6s orbitals, which increases promotion energy, the Rf 4+ aqua cation should show coordination number 6 rather than 8. A shift of equilibrium toward a lower hydrate increases the tendency to hydrolyse. (author)
Chemistry of the superheavy elements.
Schädel, Matthias
2015-03-13
The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
262 257 Profitability Analysis of Three Met
African Journals Online (AJOL)
2008-12-02
Dec 2, 2008 ... marketing in Maiduguri Metropolitan Area in Borno State of Nigeria. ... emphasis on “convenience” foods such as Suya. (Igene ... of the businesses of the people of the State. .... are old in the business and, therefore, managed.
27 CFR 24.257 - Labeling wine containers.
2010-04-01
... container of beverage wine prior to removal for consumption or sale. The minimum type size for information... wines under 7 percent alcohol is under the jurisdiction of the Food and Drug Administration. (iv) The..., 5662) (Approved by the Office of Management and Budget under control number 1512-0503) [T.D. ATF-299...
24 CFR 92.257 - Faith-based activities.
2010-04-01
... organization retains its authority over its internal governance, and it may retain religious terms in its..., practice, and expression of its religious beliefs, provided that it does not use direct HOME funds to...
40 CFR 257.27 - Selection of remedy.
2010-07-01
... currently available, but which may offer significant advantages over already available technologies in terms...; (6) Resource value of the aquifer including: (i) Current and future uses; (ii) Proximity and... and those substances are present in concentrations such that cleanup of the release from the unit...
40 CFR 257.1 - Scope and purpose.
2010-07-01
... disposal of solid waste by underground well injection subject to the regulations (40 CFR part 146) for the Underground Injection Control Program (UICP) under the Safe Drinking Water Act, as amended, 42 U.S.C. 3007 et... intended for return to the mine site. (3) The criteria do not apply to the land application of domestic...
Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.
Directory of Open Access Journals (Sweden)
Jun-Hui Zhang
Full Text Available To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML in the production of human milk fat substitute (HMFS, we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease and tripalmitin (7.55 KJ/mol decrease were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type. The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.
Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.
Zhang, Jun-Hui; Jiang, Yu-Yan; Lin, Ying; Sun, Yu-Fei; Zheng, Sui-Ping; Han, Shuang-Yan
2013-01-01
To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML) in the production of human milk fat substitute (HMFS), we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease) and tripalmitin (7.55 KJ/mol decrease) were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type). The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.
14 CFR 257.4 - Unfair and deceptive practice.
2010-01-01
... violation of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket... Unfair and deceptive practice. The holding out or sale of scheduled passenger air transportation...
40 CFR 180.257 - Chloroneb; tolerances for residues.
2010-07-01
..., sugar, tops 0.2 Cowpea, forage 2.0 Cowpea, hay 2.0 Cattle, fat 0.2 Cattle, meat 0.2 Cattle, meat byproducts 0.2 Cotton, gin byproducts 1.0 Cotton, undelinted seed 0.2 Goat, fat 0.2 Goat, meat 0.2 Goat, meat byproducts 0.2 Hog, fat 0.2 Hog, meat 0.2 Hog, meat byproducts 0.2 Horse, fat 0.2 Horse, meat 0.2 Horse, meat...
Lifescience Database Archive (English)
Full Text Available h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanxcknldw*nyhlgsrrf*qh*kc*sqnpgqrrxxxxspx infrw*tirr...rystrstkinlcw*tirrwsxsf*lqhskgihspfssxik rxyanxcknxhw*nhhlxg*r*x*h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanx
14 CFR 257.6 - Effective and compliance dates.
2010-01-01
... the selling carrier is not the transporting carrier and (ii) Of the transporting carrier's identity... transportation involving a code-share arrangement of the transporting carrier's corporate name and any other name...
24 CFR 203.257 - Creation of the contract.
2010-04-01
... issuance of a Mortgage Insurance Certificate, from the date of the endorsement of the credit instrument, or... SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Endorsement and Contract of Insurance...
Lifescience Database Archive (English)
Full Text Available vp*thvqiqpvv*tlqsmlmiiihvl*mlvpnqqvshipq*m*mittnvqlmhvpkkvv* lilqstlmitmpvqlilvhhqxvfptpqsivmikxpvqlihvqiqlv...v*ilqxxvtiiih vlxilamt*lvvxilqsmlmiixhvpsmpvlnqqvxlipqsmxmiitnvqlixvpkkvv* lilhsilmitm
International Nuclear Information System (INIS)
Trubert, D.; Hussonnois, M.; Le Naour, C.; Brillard, L.; Monroy Guzman, F.; Le Du, J.F.; Servajean, V.
1998-01-01
The isotopes 261 Rf and 262 Db were produced by irradiation of a 248 Cm target with respectively 18 O and 19 F ions, at the MP Tandem accelerator of Orsay (France). These isotopes were isolated in HF medium, using he RACHEL setup. Moreover, the radioisotope 262 DB was produced by a nuclear reaction. (authors)
Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F
2004-01-01
The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...
Age and growth of Labeo gonius (Cyprinidae) in Kali river, Uttar Pradesh, India
Digital Repository Service at National Institute of Oceanography (India)
Chatterji, A.
stream_size 4 stream_content_type text/plain stream_name Asian_Fish_Sci_5_257.pdf.txt stream_source_info Asian_Fish_Sci_5_257.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
African Journals Online (AJOL)
Items 251 - 257 of 257 ... ... technology in accessing maternal and child health information in Nigeria, Abstract. Oluwaseun I. Obasola, Iyabo M. Mabawonku. Vol 17, No 1 (2007), Workplace, Biographical and Motivation Factors Affecting Organisational Commitment of Records Officers in Nigerian Federal Universities, Abstract.
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2015-04-07
Results 251 - 257 of 257 ... Putting open data into policy : lessons from leaders around the world. Open data as a policy area is not more than five years old. Published date. April 7, 2015. Journal articles. DEVELOPMENT AID CULTURAL CHANGE SOCIAL MOVEMENTS DEVELOPMENT STRATEGY ORGANIZATIONAL ...
The Eating Disorders Inventory among Asian American College Women.
Tsai, Grace; Gray, James
2000-01-01
Assesses the prevalence rate of bulimic disorders among 257 female Asian Americans from 18 to 30 years old. Finds that only two of the 257 women met the classification for bulimia nervosa. Contends that the findings illustrate the need for future research among culturally different populations. (CMK)
Virgilio, Alex; Raposo, Jorge L; Cardoso, Arnaldo A; Nóbrega, Joaquim A; Gomes Neto, José A
2011-03-23
The usefulness of molecular absorption was investigated for the determination of total sulfur (S) in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry. The lines for CS at 257.595, 257.958, and 258.056 nm and for SH at 323.658, 324.064, and 327.990 nm were evaluated. Figures of merit, such as linear dynamic range, sensitivity, linear correlation, characteristic concentration, limit of detection, and precision, were established. For selected CS lines, wavelength-integrated absorbance equivalent to 3 pixels, analytical curves in the 100-2500 mg L(-1) (257.595 nm), 250-2000 mg L(-1) (257.958 nm), and 250-5000 mg L(-1) (258.056 nm) ranges with a linear correlation coefficient better than 0.9980 were obtained. Results were in agreement at a 95% confidence level (paired t test) with those obtained by gravimetry. Recoveries of S in fungicide and fertilizer samples were within the 84-109% range, and the relative standard deviation (n=12) was typically <5%.
Nuclear structure investigations of neutron deficient nuclei in the region Z=103 to 105
International Nuclear Information System (INIS)
Hessberger, F. P.; Hofmann, S.; Armbruster, P.; Muenzenberg, G.; Stodel, Ch.; Ackermann, D.; Lavrentev, A. Yu.; Popeko, A. G.; Yeremin, A. V.; Saro, S.; Leino, M.
1999-01-01
The isotopes 257,255 Rf, 257,256 Db, 253,252 Lr have been produced in bombardments of 207,208 Pb and 209 Bi target nuclei with 50 Ti and identified by their α-decay. New or improved decay data could be obtained. Analysis of the fine structure of the α-decay pattern of 257 Rf allowed the construction of a first tentative level scheme for the daughter nucleus 253 No and also the identification of a low lying high spin isomeric state, while from α-γ- coincidence measurements for 255 Rf a first tentative level scheme of the daughter nucleus 251 No was derived. For 257 Db we found that two nuclear levels decay by α-emission and populate also different levels in the daughter nucleus 253 Lr. The levels are produced by the reaction process. In bombardments of 209 Bi with 50 Ti at E CN *=26.4 MeV and 30.8 MeV the previously unknown isotopes 256 Db and 252 Lr were identified
Radionuclides for nuclear medicine: a nuclear physicists' view
Czech Academy of Sciences Publication Activity Database
Cantone, M.; Haddad, F.; Harissopoulos, S.; Jensen, M.; Jokinen, A.; Koster, U.; Lebeda, Ondřej; Ponsard, B.; Ratzinger, U.; Stora, T.; Tarkanyi, F.; Van Duppen, P.
2013-01-01
Roč. 40, 2 Supplement (2013), S257-S257 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] Institutional support: RVO:61389005 Keywords : nuclear physics for medicine * EANM * medical radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders
Ren, Y.; Yang, P.; Li, B.; Gao, Y.; Zhou, H.; Huang, X.; Zhu, L.; Kijlstra, A.
2006-01-01
To examine antigen (Ag)-specific CTL response during anterior chamber associated immune deviation (ACAID). Methods OVA or OVA257-264 peptide was injected into the anterior chamber (AC) of C57BL/6 mice. There were 16 mice in each ACAID group induced with OVA or OVA257-264 peptide. The mice were
DEFF Research Database (Denmark)
Lundquist, Rasmus; Nielsen, Leif Kofoed; Jafarshad, Ali
2006-01-01
against MSP-3 residues 194 to 257 (MSP-3(194-257)) on the molecular level. mRNA from peripheral blood leukocytes from clinically immune individuals was used as a source of Fab (fragment antibody) genes. A Fab-phage display library was made, and three distinct antibodies designated RAM1, RAM2, and RAM3...
3-(2-Fluorophenylsulfinyl-2,5,7-trimethyl-1-benzofuran
Directory of Open Access Journals (Sweden)
Hong Dae Choi
2013-06-01
Full Text Available In the title compound, C17H15FO2S, the benzofuran ring system, being essentially planar, with an r.m.s. deviation from the least-squares plane of 0.009 (2 Å, makes a dihedral angle of 79.02 (5° with the plane of the 2-fluorophenyl group. In the crystal, molecules are linked by pairs of weak C—H...O hydrogen bonds into centrosymmetric dimers.
All projects related to | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Research on the links between tobacco farming and health problems among men, women, and children in Bangladesh will examine the health and ... was a London-based news agency that bought news features from developing world correspondents and distributed them to news media organizations around the world.
Muradov, Khakim G; Granovsky, Alexey E; Artemyev, Nikolai O
2003-03-25
Photoreceptor cGMP phosphodiesterase (PDE6) is the effector enzyme in the vertebrate visual transduction cascade. The activity of rod PDE6 catalytic alpha- and beta-subunits is blocked in the dark by two inhibitory Pgamma-subunits. The inhibition is released upon light-stimulation of photoreceptor cells. Mutation H258N in PDE6beta has been linked to congenital stationary night blindness (CSNB) in a large Danish family (Rambusch pedigree) (Gal, A., Orth, U., Baehr, W., Schwinger, E., and Rosenberg, T. (1994) Nat. Genet. 7, 64-67.) We have analyzed the consequences of this mutation for PDE6 function using a Pgamma-sensitive PDE6alpha'/PDE5 chimera, Chi16. Biochemical analysis of the H257N mutant, an equivalent of PDE6betaH258N, demonstrates that this substitution does not alter the ability of chimeric PDE to dimerize or the enzyme's catalytic properties. The sensitivity of H257N to a competitive inhibitor zaprinast was also unaffected. However, the mutant displayed a significant impairment in the inhibitory interaction with Pgamma, which was apparent from a approximately 20-fold increase in the K(i) value (46 nM) and incomplete maximal inhibition. The inhibitory defect of H257N is not due to perturbation of noncatalytic cGMP binding to the PDE6alpha' GAF domains. The noncatalytic cGMP-binding characteristics of the H257N mutant were similar to those of the parent PDE6alpha'/PDE5 chimera. Since rod PDE6 in the Rambusch CSNB is a catalytic heterodimer of the wild-type PDE6alpha and mutant PDE6beta, Chi16 and H257N were coexpressed, and a heterodimeric PDE, Chi16/H257N, was isolated. It displayed two Pgamma inhibitory sites with the K(i) values of 5 and 57 nM. Our results support the hypothesis that mutation H258N in PDE6beta causes CSNB through incomplete inhibition of PDE6 activity by Pgamma, which leads to desensitization of rod photoreceptors.
Energy Technology Data Exchange (ETDEWEB)
Wibmer, Constantinos Kurt; Gorman, Jason; Anthony, Colin S.; Mkhize, Nonhlanhla N.; Druz, Aliaksandr; York, Talita; Schmidt, Stephen D.; Labuschagne, Phillip; Louder, Mark K.; Bailer, Robert T.; Karim, Salim S. Abdool; Mascola, John R.; Williamson, Carolyn; Moore, Penny L.; Kwong, Peter D.; Morris, Lynn (NHLS-South Africa); (NIH); (Witwatersrand); (KwaZulu-Natal)
2016-08-31
All HIV-1-infected individuals develop strain-specific neutralizing antibodies to their infecting virus, which in some cases mature into broadly neutralizing antibodies. Defining the epitopes of strain-specific antibodies that overlap conserved sites of vulnerability might provide mechanistic insights into how broadly neutralizing antibodies arise. We previously described an HIV-1 clade C-infected donor, CAP257, who developed broadly neutralizing plasma antibodies targeting an N276 glycan-dependent epitope in the CD4 binding site. The initial CD4 binding site response potently neutralized the heterologous tier 2 clade B viral strain RHPA, which was used to design resurfaced gp120 antigens for single-B-cell sorting. Here we report the isolation and structural characterization of CAP257-RH1, an N276 glycan-dependent CD4 binding site antibody representative of the early CD4 binding site plasma response in donor CAP257. The cocrystal structure of CAP257-RH1 bound to RHPA gp120 revealed critical interactions with the N276 glycan, loop D, and V5, but not with aspartic acid 368, similarly to HJ16 and 179NC75. The CAP257-RH1 monoclonal antibody was derived from the immunoglobulin-variable IGHV3-33 and IGLV3-10 genes and neutralized RHPA but not the transmitted/founder virus from donor CAP257. Its narrow neutralization breadth was attributed to a binding angle that was incompatible with glycosylated V5 loops present in almost all HIV-1 strains, including the CAP257 transmitted/founder virus. Deep sequencing of autologous CAP257 viruses, however, revealed minority variants early in infection that lacked V5 glycans. These glycan-free V5 loops are unusual holes in the glycan shield that may have been necessary for initiating this N276 glycan-dependent CD4 binding site B-cell lineage.
Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016
U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...
24 CFR 257.120 - Appreciation sharing or up-front payment
2010-04-01
... the Act, the amount of the appreciation in value of a property securing an H4H program mortgage that... appreciation may be established to the satisfaction of FHA: (1) In the case of— (i) A sale of the property to...'s interest in appreciation. Upon sale or disposition of a property securing an H4H program mortgage...
Nigeria: Power and Democracy in Africa. Headline Series No. 257.
Herskovits, Jean
This booklet traces the emergence of a democratic government in Nigeria through military dictatorship to the writing of a constitution fashioned on the American model. Chapters include: (1) "Prologue"; (2) "Nigeria Defined"; (3) "Tragedy and Recovery: The First Republic and the Federal Military Government"; (4)…
40 CFR 257.23 - Ground-water sampling and analysis requirements.
2010-07-01
...: (1) Sample collection; (2) Sample preservation and shipment; (3) Analytical procedures; (4) Chain of... theory test, then the data should be transformed or a distribution-free theory test should be used. If... chart and its associated parameter values shall be protective of human health and the environment. The...
40 CFR 257.28 - Implementation of the corrective action program.
2010-07-01
... constituents as a result of an accident or failure of a container or handling system; and (vii) Other situations that may pose threats to human health and the environment. (b) An owner or operator may determine... alternative measures prior to implementing the alternative measures has been placed in the operating record...
The impact of mechanism on the management and outcome of penetrating colonic trauma.
Oosthuizen, G V; Kong, V Y; Estherhuizen, T; Bruce, J L; Laing, G L; Odendaal, J J; Clarke, D L
2018-02-01
Introduction In light of continuing controversy surrounding the management of penetrating colonic injuries, we set out to compare the outcome of penetrating colonic trauma according to whether the mechanism of injury was a stab wound or a gunshot wound. Methods Our trauma registry was interrogated for the 5-year period from January 2012 to December 2016. All patients over the age of 18 years with penetrating trauma (stab or gunshot) and with intraoperatively proven colonic injury were reviewed. Details of the colonic and concurrent abdominal injuries were recorded, together with the operative management strategy. In-hospital morbidities were divided into colon-related and non-colon related morbidities. The length of hospital stay and mortality were recorded. Direct comparison was made between patients with stab wounds and gunshot wounds to the colon. Results During the 5-year study period, 257 patients sustained a colonic injury secondary to penetrating trauma; 95% (244/257) were male and the mean age was 30 years. A total of 113 (44%) sustained a gunshot wound and the remaining 56% (144/257) sustained a stab wound. Some 88% (226/257) of all patients sustained a single colonic injury, while 12% (31/257) sustained more than one colonic injury. A total of 294 colonic injuries were found at laparotomy. Multiple colonic injuries were less commonly encountered in stab wounds (6%, 9/144 vs. 19%, 22/113, P colonic stab wounds and colonic gunshot wounds are different in terms of severity of the injury and in terms of outcome. While primary repair is almost always applicable to the management of colonic stab wounds, the same cannot be said for colonic gunshot wounds. The management of colonic gunshot wounds should be examined separately from that of stab wounds.
Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser
DEFF Research Database (Denmark)
Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm
2003-01-01
Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....
Statistical Inference on Memory Structure of Processes and Its Applications to Information Theory
2016-05-12
8217x’!will!correspond!with!the!stringoid! matrices! ! E4=C4*log(P4)! Ea4=matrix(E4[1:256])! Es4=matrix(E4[257:496])! ! EL4 =matrix(cbind(A4,E4),length...E4))! ELa4=matrix( EL4 [1:256,1:5],length(Ea4))! ELs4=matrix( EL4 [257:496,1:5],length(Es4))! ! Ea4a=matrix(rep(0,60))! for(i!in!1:256)! for(j!in!1:60
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 231 ... Query: 198 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 257 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 257 ... Query: 9 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRD...TTLSITLD 68 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGVDMLLVGDSAANVVLGRDTTLSITLD Sbjct: 1 ... IRTRHFREAKVNGQKVSVLTSYDALSARIFD
Outcome, Cost, and Oversight of Iraq Reconstruction Contract W914NS-04-D-0006
2008-01-28
Minerals HQs Building $7,928,993 2% 03 Modernize Maternity & Pediatric Hospital – Ibn Al Baladi $8,814,353 3% 04 Ministry of Health – Healthcare...Ministerial buildings 8,257,981 8,258,377 Completed Terminated for Convenience 3 Renovate Ibn Al Baladi Hospital 9,585,023 9,365,516 4 Design and...7,331,585 237,490 688,906 8,257,981 8,258,377 8,258,377 3 Renovate Ibn Al Baladi Hospital 8,251,610 320,820 1,012,593 9,585,023 9,585,023
: tous les projets | Page 257 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: URBAN AREAS, DRUG TRAFFIC, CONFLICTS, VIOLENCE, EMERGENCY RELIEF. Région: Brazil, South America, Colombia, Haiti, North and Central America, Mexico. Programme: Gouvernance et justice. Financement total : CA$ 505,000.00. Action humanitaire dans les autres situations de violence. Projet.
40 CFR Appendix I to Part 257 - Maximum Contaminant Levels (MCLs)
2010-07-01
... Drinking Water Act Chemical CAS No. MCL -(mg/l) Arsenic 7440-38-2 0.05 Barium 7440-39-3 1.0 Benzene 71-343... 0.004 Lead 7439-92-1 0.05 Mercury 7439-97-6 0.002 Methoxychlor 72-43-5 0.1 Nitrate 10.0 Selenium...
Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 257
National Research Council Canada - National Science Library
Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina
2005-01-01
...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...
TASK 2.5.7 FIELD EXPERIMENTS TO EVALUATE COOL-COLORED ROOFING
Energy Technology Data Exchange (ETDEWEB)
Miller, William A [ORNL; Cherry, Nigel J [ORNL; Allen, Richard Lowell [ORNL; Childs, Phillip W [ORNL; Atchley, Jerald Allen [ORNL; Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL); Akbari, Hashem [Lawrence Berkeley National Laboratory (LBNL); Berhahl, Paul [Lawrence Berkeley National Laboratory (LBNL)
2010-03-01
Aesthetically pleasing dark roofs can be formulated to reflect like a highly reflective white roof in the near infrared portion of the solar spectrum. New paint pigments increase the near infrared reflectance of exterior finishes by minimizing the absorption of near-infrared radiation (NIR). The boost in the NIR reflectance drops the surface temperatures of roofs and walls, which in turn reduces cooling-energy use and provides savings for the homeowner and relief for the utilities. In moderate and hot climates, a roof surface with high solar reflectance and high thermal emittance was shown by Akbari et al. (2004) and by Parker and Sherwin (1998) to reduce the exterior temperature and produce savings in comfort cooling. The new cool color pigments can potentially reduce emissions of carbon dioxide, which in turn reduces metropolitan heat buildup and urban smog. The pigments can also help conserve water resources otherwise used to clean and process fuel consumed by fossil-fuel driven power plants. Cool roofs also result in a lower ambient temperature that further decreases the need for air conditioning, retards smog formation, and improves thermal comfort. Parker, Sonne and Sherwin (2002) demonstrated that white barrel and white flat tiles reduced cooling energy consumption by 22% of the base load used by an adjacent and identical home having direct nailed dark shingles. Part of the savings was due to the reflectance of the white tiles; however, another part was due to the mass of the tile and to the venting occurring within the double batten installation. With, Cherry and Haig (2009) have studied the influence of the thermal mass and batten space ventilation and have found that, referenced to an asphalt shingle system, it can be equivalent to an additional 28 points of solar reflectivity. The double batten arrangement has wooden counter battens laid vertically (soffit-to-ridge) against the roof deck, and then the conventional battens are laid horizontally across the counter battens, providing a nailing surface for the concrete tile. This double batten construction forms an inclined air channel running from the soffit to the ridge. The bottom surface of the channel is formed by the roof decking and is relatively flat and smooth. The top surface is created by the underside of the roofing tiles, and is designed to be an air permeable covering to alleviate the underside air pressure and minimize wind uplift on the tiles. The resulting air flows also have a cooling influence which further complicates prediction of the heat penetrating through the deck because an accurate measure of the airflow is required to predict the heat transfer. Measured temperatures and heat flows at the roof surface, within the attic and at the ceiling of the houses are discussed as well as the power usage to help gauge the benefit of cool-pigmented reflective roof products fitted with and without ventilation above the roof deck. Ventilation occurring above the deck is an inherent feature for tile roof assemblies, and is formed by an air space between the exterior face of the roof sheathing and the underside of the tile. The greater the tile s profile the greater is the effect of the ventilation which herein is termed above-sheathing ventilation (ASV). However, because of the complexity of the thermally induced flow, little credit is allowed by state and federal building codes. ASHRAE (2005) provides empirical data for the effective thermal resistance of plane air spaces. A -in. (0.0191-m) plane air space inclined at 45 with the horizontal has an RUS-0.85 (RSI-0.15) . Our intent is to help further deploy cool color pigments in roofs by conducting field experiments to evaluate the new cool-colored roofing materials in the hot climate of Southern California. The collected data will be used to showcase and market the performance of new cool-roof products and also to help formulate and validate computer codes capable of calculating the heat transfer occurring within the attic and the whole building. Field measures and computer predictions showed that the demonstration home without a NIR-reflective tile coating and without above-sheathing ventilation had the greatest roof deck heat flow and subsequently the highest electrical usage. The house with both NIR paint pigments on the tile and with ASV had the least deck heat flows and therefore caused the home to consume the least amount of energy. The relative performance of the reflective coating and the ventilation individually is less obvious, but it is clear that the combination of a reflective tile with ASV is the preferred solution for the best energy saving.
47 CFR 15.257 - Operation within the band 92-95 GHz.
2010-10-01
... bandwidth of at least 10 MHz, or uses an equivalent measurement method. (3) The average emission limits... section are subject to the radiofrequency radiation exposure requirements specified in 47 CFR 1.1307(b), 2...
ORF Alignment: NC_004668 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available s V583] ... Length = 72 ... Query: 257 AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL 316 ... ... AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL Sbjct: 1 ... AEREKYEANRKELIANISHDLKTPITSIIGYVEGLMDGVANTEEKKQRYLTVIHEKSLGL 60 ...
Value of repeat brain MRI in children with focal epilepsy and negative findings on initial MRI
Energy Technology Data Exchange (ETDEWEB)
Jeon, Tae Yeon; Kim, Ji Hye; Lee, Jee Hun; Yoo, So Young; Hwang, Sook Min; Lee, Mun Hyang [Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of)
2017-08-01
To evaluate the value of repeat brain magnetic resonance imaging (MRI) in identifying potential epileptogenic lesions in children with initial MRI-negative focal epilepsy. Our Institutional Review Board approved this retrospective study and waived the requirement for informed consent. During a 15-year period, 257 children (148 boys and 109 girls) with initial MRI-negative focal epilepsy were included. After re-evaluating both initial and repeat MRIs, positive results at repeat MRI were classified into potential epileptogenic lesions (malformation of cortical development and hippocampal sclerosis) and other abnormalities. Contributing factors for improved lesion conspicuity of the initially overlooked potential epileptogenic lesions were analyzed and classified into lesion factors and imaging factors. Repeat MRI was positive in 21% (55/257) and negative in 79% cases (202/257). Of the positive results, potential epileptogenic lesions comprised 49% (27/55) and other abnormalities comprised 11% of the cases (28/257). Potential epileptogenic lesions included focal cortical dysplasia (n = 11), hippocampal sclerosis (n = 10), polymicrogyria (n = 2), heterotopic gray matter (n = 2), microlissencephaly (n = 1), and cortical tumor (n = 1). Of these, seven patients underwent surgical resection. Contributing factors for new diagnoses were classified as imaging factors alone (n = 6), lesion factors alone (n = 2), both (n = 18), and neither (n = 1). Repeat MRI revealed positive results in 21% of the children with initial MRI-negative focal epilepsy, with 50% of the positive results considered as potential epileptogenic lesions. Enhanced MRI techniques or considering the chronological changes of lesions on MRI may improve the diagnostic yield for identification of potential epileptogenic lesions on repeat MRI.
Value of repeat brain MRI in children with focal epilepsy and negative findings on initial MRI
International Nuclear Information System (INIS)
Jeon, Tae Yeon; Kim, Ji Hye; Lee, Jee Hun; Yoo, So Young; Hwang, Sook Min; Lee, Mun Hyang
2017-01-01
To evaluate the value of repeat brain magnetic resonance imaging (MRI) in identifying potential epileptogenic lesions in children with initial MRI-negative focal epilepsy. Our Institutional Review Board approved this retrospective study and waived the requirement for informed consent. During a 15-year period, 257 children (148 boys and 109 girls) with initial MRI-negative focal epilepsy were included. After re-evaluating both initial and repeat MRIs, positive results at repeat MRI were classified into potential epileptogenic lesions (malformation of cortical development and hippocampal sclerosis) and other abnormalities. Contributing factors for improved lesion conspicuity of the initially overlooked potential epileptogenic lesions were analyzed and classified into lesion factors and imaging factors. Repeat MRI was positive in 21% (55/257) and negative in 79% cases (202/257). Of the positive results, potential epileptogenic lesions comprised 49% (27/55) and other abnormalities comprised 11% of the cases (28/257). Potential epileptogenic lesions included focal cortical dysplasia (n = 11), hippocampal sclerosis (n = 10), polymicrogyria (n = 2), heterotopic gray matter (n = 2), microlissencephaly (n = 1), and cortical tumor (n = 1). Of these, seven patients underwent surgical resection. Contributing factors for new diagnoses were classified as imaging factors alone (n = 6), lesion factors alone (n = 2), both (n = 18), and neither (n = 1). Repeat MRI revealed positive results in 21% of the children with initial MRI-negative focal epilepsy, with 50% of the positive results considered as potential epileptogenic lesions. Enhanced MRI techniques or considering the chronological changes of lesions on MRI may improve the diagnostic yield for identification of potential epileptogenic lesions on repeat MRI
Physiotherapy for plantar fasciitis: a UK-wide survey of current practice.
Grieve, Rob; Palmer, Shea
2017-06-01
To identify how United Kingdom (UK) physiotherapists currently diagnose, assess and manage plantar fasciitis in routine practice. Online questionnaire survey. Practising physiotherapists across the UK who treat patients with plantar fasciitis. Physiotherapists were approached via 'interactive Chartered Society of Physiotherapy (CSP)' online networks and an email database of clinical educators in South West England. An online questionnaire was developed by reviewing similar existing physiotherapy surveys and consultation with experienced musculoskeletal researchers/clinicians. Descriptive statistics were used to analyse the data. 285 physiotherapists responded, with 257 complete survey responses. Pain on palpation and early morning pain were the most common diagnostic criteria, with some physiotherapists using no formal test criteria. Advice (237/257, 92%), plantar fasciitis pathology education (207/257, 81%) and general stretching exercises (189/257, 74%) were most routinely used. Prefabricated orthotics, custom made orthotics and night splints were seldom always used. For the manual therapy approach, the most frequently used modalities were massage, myofascial release, specific soft tissue mobilisations and myofascial trigger point therapy. Commonly used outcome measures were pain assessment, functional tests and range of movement. Physiotherapists appeared to follow most of the established diagnostic criteria for PF, but have not followed established outcome measure guidelines. Advice as well as education with an emphasis on self-management including calf/hamstring stretching was the most commonly reported treatment approach. There was uncertainty whether this approach accurately reflected clinical practice used throughout the UK, owing to potential response bias/unknown response rate and the low number of patients with PF treated by the respondents. Copyright © 2016 Chartered Society of Physiotherapy. Published by Elsevier Ltd. All rights reserved.
Within centre evaluation of hypercalcaemia discriminant
DEFF Research Database (Denmark)
Nielsen, Bo Friis; Conradsen, Knut
1996-01-01
Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients......). The discriminant functions correctly classified 81 and 80% of the women, respectively (NS) and respectively 75% and 64% of the men (NS) in the first and second recorded populations.......Diagnostic hypercalcaemia discriminant functions, discriminating between clinically significant and non-significant hypercalcaemia, were tested 5 years after their development in order to evaluate the impact of time on their diagnostic capacity. Two populations, consisting of 257 and 129 patients...
257 Etude du cycle sexuel et l'inversion sexuelle de Pagellus bellottii
African Journals Online (AJOL)
User
Résumé. Pagellus bellottii appartient à la famille des Sparidae. Il est hermaphrodite protérogyne et est fréquent dans les débarquements au Sénégal. Le but de ce travail est d'étudier la biologie de ce poisson qui présente un intérêt économique car il est consommé localement mais aussi exporté vers les pays de l'union.
Site specific modification of the human plasma proteome by methylglyoxal
International Nuclear Information System (INIS)
Kimzey, Michael J.; Kinsky, Owen R.; Yassine, Hussein N.; Tsaprailis, George; Stump, Craig S.; Monks, Terrence J.; Lau, Serrine S.
2015-01-01
Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may
Site specific modification of the human plasma proteome by methylglyoxal
Energy Technology Data Exchange (ETDEWEB)
Kimzey, Michael J.; Kinsky, Owen R. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Yassine, Hussein N. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Tsaprailis, George [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Stump, Craig S. [Department of Medicine, The University of Arizona, Tucson, AZ 85721 (United States); Southern Arizona VA Health Care System, Tucson, AZ 85723 (United States); Monks, Terrence J. [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States); Lau, Serrine S., E-mail: lau@pharmacy.arizona.edu [Southwest Environmental Health Sciences Center, Department of Pharmacology & Toxicology, College of Pharmacy, The University of Arizona, Tucson, AZ 85721 (United States)
2015-12-01
Increasing evidence identifies dicarbonyl stress from reactive glucose metabolites, such as methylglyoxal (MG), as a major pathogenic link between hyperglycemia and complications of diabetes. MG covalently modifies arginine residues, yet the site specificity of this modification has not been thoroughly investigated. Sites of MG adduction in the plasma proteome were identified using LC–MS/MS analysis in vitro following incubation of plasma proteins with MG. Treatment of plasma proteins with MG yielded 14 putative MG hotspots from five plasma proteins (albumin [nine hotspots], serotransferrin, haptoglobin [2 hotspots], hemopexin, and Ig lambda-2 chain C regions). The search results revealed two versions of MG-arginine modification, dihydroxyimidazolidine (R + 72) and hydroimidazolone (R + 54) adducts. One of the sites identified was R257 in human serum albumin, which is a critical residue located in drug binding site I. This site was validated as a target for MG modification by a fluorescent probe displacement assay, which revealed significant drug dissociation at 300 μM MG from a prodan–HSA complex (75 μM). Moreover, twelve human plasma samples (six male, six female, with two type 2 diabetic subjects from both genders) were analyzed using multiple reaction monitoring (MRM) tandem mass spectrometry and revealed the presence of the MG-modified albumin R257 peptide. These data provide insights into the nature of the site-specificity of MG modification of arginine, which may be useful for therapeutic treatments that aim to prevent MG-mediated adverse responses in patients. - Highlights: • Methylglyoxal (MG) selectively modifies arginine sites in human plasma proteome. • Dihydroxyimidazolidine and hydroimidazolone adducts on serum albumin identified • MG modification on albumin R257 associated with loss of drug site I binding capacity • MRM-tandem mass spectrometry enables sensitive detection of albumin MG-R257. • Site-specific MG modification may
The recovery and study of heavy nuclides produced in a nuclear explosion - the Hutch event
International Nuclear Information System (INIS)
Hoff, R.W.; Hulet, E.K.
1970-01-01
During the explosion of the Hutch device, the target ( 238 U and 232 Th) was subjected to a very high neutron exposure, 2.4 x 10 25 neutrons /cm 2 . Multiple neutron capture reactions resulted in the production of heavy nuclides, up to and including 257Fm. Results of the search for species with A > 257 were negative. The recovery and chemical processing of kilograms of Hutch debris has resulted in the isolation of 10 10 atoms of 257Fm, which is 10 2 times more material than has been available for experimentation in the past. Experimentally significant amounts of other rare nuclides, e.g., : 254 Cf, 251 Cf, 255 -Es, and 250 Cm, have also been separated from the Hutch debris. The production of these nuclides in thermonuclear explosions is shown to be a valuable supplement to the AEC program for reactor production of transplutonium elements. The neutron flux achieved in Hutch was insufficient to even approach production of nuclides in the region of 298 114. A much more intense neutron flux is required. In future experiments, considerable attention must be given to the problem of adequate sample recovery, in order to properly use the ability to subject targets to an exceedingly intense time-integrated neutron flux. (author)
The undefined function differs from the pointwise undefined function
Dosch, Walter (Prof.)
1993-01-01
The undefined function differs from the pointwise undefined function. - In: Joint Conference on Declarative Programming : Proceedings / Maria I. Sessa ... (eds.). - Salerno : Univ. degli Studi, 1995. - S. 257-268
Lifescience Database Archive (English)
Full Text Available NVISWNAMLAAYTYCGCNDGVLELFDQMLFQ 196 V TAL+ + +L +A VF+ ++V+SWNA++A C + V + +M + Sbjct: 192 VFMTALI----RSRKLAEALEVFEACRGKDVVSWNAVMAG...D S Sbjct: 199 RSRKLAEALEVFEACRGKDVVSWNAVMAGLVQFCCGEVPGF-WRRMCCEGVKPDNFAFSG 257 Q
Search Results | Page 5 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2013-04-01
Results 41 - 50 of 257 ... Innovation and productivity in services : an impact evaluation of Colciencias funding programs in Colombia. Published date. April 1, 2013. Papers. CHILE SERVICES Innovation ...
The Conference from the Prague Perspective
Czech Academy of Sciences Publication Activity Database
Hrubec, Marek
2017-01-01
Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion
Czech Academy of Sciences Publication Activity Database
Slavický, Tomáš
2013-01-01
Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage
Czech Academy of Sciences Publication Activity Database
Sláma, Karel
2013-01-01
Roč. 6, č. 4 (2013), s. 257-333 ISSN 1874-9828 Institutional support: RVO:60077344 Keywords : juvenile hormone (JH) * activation neurohormone (AH) pseudojuvenile effects * terpenoid juvenoids Subject RIV: ED - Physiology
Search Results | Page 11 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 101 - 110 of 257 ... This grant will help the Norman Paterson School of International ... Understanding Southern Influence in Cyberspace Security and ... Beyond Social Protection: Labour Markets, Entrepreneurship, and Gender Equality.
The recovery and study of heavy nuclides produced in a nuclear explosion - the Hutch event
Energy Technology Data Exchange (ETDEWEB)
Hoff, R W; Hulet, E K [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)
1970-05-15
During the explosion of the Hutch device, the target ({sup 238}U and {sup 232}Th) was subjected to a very high neutron exposure, 2.4 x 10{sup 25} neutrons /cm{sup 2}. Multiple neutron capture reactions resulted in the production of heavy nuclides, up to and including 257Fm. Results of the search for species with A > 257 were negative. The recovery and chemical processing of kilograms of Hutch debris has resulted in the isolation of 10{sup 10} atoms of 257Fm, which is 10{sup 2} times more material than has been available for experimentation in the past. Experimentally significant amounts of other rare nuclides, e.g., :{sup 254}Cf, {sup 251}Cf, {sup 255}-Es, and {sup 250}Cm, have also been separated from the Hutch debris. The production of these nuclides in thermonuclear explosions is shown to be a valuable supplement to the AEC program for reactor production of transplutonium elements. The neutron flux achieved in Hutch was insufficient to even approach production of nuclides in the region of {sup 298}114. A much more intense neutron flux is required. In future experiments, considerable attention must be given to the problem of adequate sample recovery, in order to properly use the ability to subject targets to an exceedingly intense time-integrated neutron flux. (author)
Nwidu et al., Afr J Tradit Complement Altern Med. (2014) 11(2):257 ...
African Journals Online (AJOL)
cadewumi
... semi-preparative HPLC, and the structures established by NMR (Nwidu et al., 2012b). ... fingerprint of the ESE, preliminary phyto-chemical screening, elemental and ..... Prostaglandins and serotonin: Non-peptide diarrheagenic hormones.
Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C
Indian Academy of Sciences (India)
Synthesis of spodumene and spodumene-zirconia composite ... were prepared using aqueous sol-gel method employing lithium formate, aluminium formate, ... synthesis and the processing of spodumene using different precursor compounds.
Formins: Linking Cytoskeleton and Endomembranes in Plant Cells
Czech Academy of Sciences Publication Activity Database
Cvrčková, F.; Oulehlová, Denisa; Žárský, Viktor
2015-01-01
Roč. 16, č. 1 (2015), s. 1-18 E-ISSN 1422-0067 Institutional support: RVO:61389030 Keywords : formin * actin * microtubules Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.257, year: 2015
A review of the peri-operative management of paediatric burns ...
African Journals Online (AJOL)
adversely affect surgical and anaesthetic outcomes were identified. Results. There were 257 males and .... morphine, this allowed for a higher turnover of patient numbers. Table 3 displays the total .... psychological effects. Premedication was.
Pregnancy Outcome among Patients with Sickle Cell Disease in Jos
African Journals Online (AJOL)
Zamzar
The antenatal complications included anaemia (62.9%), vaso-oclusive. (bone pain) ... Conclusion: Pregnancy in sickle cell disease patients is associated with high maternal and perinatal morbidity .... and malaria (25.7%) were other common.
Directory of Open Access Journals (Sweden)
Zhou Xiangdong
2008-05-01
Full Text Available Abstract Presenilin (PS1 or PS2 is an essential component of the active γ-secretase complex that liberates the Aβ peptides from amyloid precursor protein (APP. PS1 is regarded as an atypical aspartyl protease harboring two essential aspartic acids in the context of the sequence D257LV and D385FI, respectively, rather than the typical DTG...DTG catalytic motif of classical aspartyl proteases. In the present studies, we introduced the sequence DTG in PS1 at and around the catalytic D257 and D385 residues to generate three PS1 mutants: D257TG, D385TG, and the double-mutant D257TG/D385TG. The effects of these changes on the γ-secretase activity in the presence or absence of γ-secretase inhibitors and modulators were investigated. The results showed that PS1 mutants having D385TG robustly enhanced Aβ42 production compared to the wild type (wt, and were more sensitive than wt to inhibition by a classical aspartyl protease transition state mimic, and fenchylamine, a sulfonamide derivative. Unlike wt PS1 and some of its clinical mutants, all three PS1 artificial mutants decreased cleavage of Notch S3-site, suggesting that these artificial mutations may trigger conformational changes at the substrate docking and catalytic site that cause alteration of substrate specificity and inhibition pattern. Consistent with this notion, we have found that NSAID enzymatic inhibitors of COX, known modulators of the γ-secretase activity, cause PS1 mutants containing D385TG to produce higher levels of both Aβ38 and Aβ42, but to reduce levels of Aβ39, showing a pattern of Aβ formation different from that observed with wild type PS1 and its clinical mutants. This study provides an important structural clue for the rational design of drugs to inhibit processing of APP at the γ-site without interfering with Notch processing.
TAX REFORMS AND INVESTMENT IN NIGERIA: AN EMPIRICAL ...
African Journals Online (AJOL)
GRACE
Tax generated revenues are used to finance public utilities, perform social responsibilities and grease the ..... Capital Theory and Investment Behaviours, The American Review,. 53:247-257. ... ESUT Journal of Accounting, 5(2). December ...
Search Results | Page 13 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 121 - 130 of 257 ... The Caribbean is a diverse group of countries, both culturally and ... unemployment and an underdeveloped formal (private) sector. ... has reduced poverty and increased labour market opportunities in Latin America.
Search Results | Page 6 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 51 - 60 of 257 ... Linking communities of practice with value chain development in ... Recognizing that value chains involve complex social and economic relationships, there ... development dynamics that lead to economic growth, poverty ...
Histopathologic Patterns of Breast Lesions in Northern Saudi Arabia
Directory of Open Access Journals (Sweden)
Hussain Gadelkarim Ahmed
2017-10-01
Full Text Available Objective: The aim of this study was to find out the prevalence rates of common types of breast cancer in Northern Saudi Arabia. Methodology: A retrospective cohort study was carried out over a five-year period in two referral hospitals. In this study 257 files were retrieved from departments of Surgery from different hospitals in Hail region, Kingdom of Saudi Arabia (KSA. Results: Of the 257 samples diagnosed using Fine Needle Aspiration Cytology (FNAC, histopathological diagnosis was confirmed for 158 patients. Of the 158 diagnosed samples, 46/158 (23.2% were ductal carcinoma, 7/158 (4.4% were lobular carcinoma, 3/158 (1.9% were mixed tumours, and 102/158 (64.6 were fibroadenoma. Conclusion: Fibroadenoma and ductal carcinoma are the prevalent breast lesions in Hail Region of Saudi Arabia.
Raman Spectra and Bulk Modulus of Nanodiamond in a Size Interval of 2-5 nm
Popov, Mikhail; Churkin, Valentin; Kirichenko, Alexey; Denisov, Viktor; Ovsyannikov, Danila; Kulnitskiy, Boris; Perezhogin, Igor; Aksenenkov, Viktor; Blank, Vladimir
2017-10-01
Nanodiamond in a 2-5-nm size interval (which is typical for an appearance of quantum confinement effect) show Raman spectra composed of 3 bands at 1325, 1600, and 1500 cm-1 (at the 458-nm laser excitation) which shifts to 1630 cm-1 at the 257-nm laser excitation. Contrary to sp2-bonded carbon, relative intensities of the bands do not depend on the 458- and 257-nm excitation wavelengths, and a halfwidth and the intensity of the 1600 cm-1 band does not change visibly under pressure at least up to 50 GPa. Bulk modulus of the 2-5-nm nanodiamond determined from the high-pressure study is around 560 GPa. Studied 2-5-nm nanodiamond was purified from contamination layers and dispersed in Si or NaCl.
Search Results | Page 8 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 71 - 80 of 257 ... Integrated "farm to fork approach" to improving food and nutrition security in the Caribbean by linking agricultural ... Findings showed market-based barriers to technology adoption by farmers: ... Creating global citizens?
Search Results | Page 2 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 11 - 20 of 257 ... Harnessing big data to meet the Sustainable Development Goals ... official statistics, and facilitate development in sectors such as health, ... promoting gender equality is central to global development policy and practice.
Isolating dividing neural and brain tumour cells for gene expression profiling
Czech Academy of Sciences Publication Activity Database
Endaya, B.; Cavanagh, B.; Alowaidi, F.; Walker, T.; de Pennington, N.; Ng, J.-M.; Lam, P.Y.P.; Mackay-Sim, A.; Neužil, Jiří; Meedeniya, A.C.B.
2016-01-01
Roč. 257, JAN 15 2016 (2016), s. 121-133 ISSN 0165-0270 Institutional support: RVO:86652036 Keywords : Cell division * Click chemistry * FACS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.554, year: 2016
2010-05-10
... MNKD MannKind Corp... 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc.. 257 HK Petrohawk Energy Corp... Kinross Gold Corp. 213 MRVL Marvell 273 EP El Paso Corp. Technology Group Ltd. 215 XLP Consumer Staples...
2010-05-11
... MannKind Corp. 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc. 257 HK Petrohawk Energy Corp. 176... Gold Corp. 213 MRVL Marvell Technology 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274...
Czech Academy of Sciences Publication Activity Database
Řanda, Zdeněk; Kučera, Jan; Soukal, Ladislav
2003-01-01
Roč. 257, č. 2 (2003), s. 275-283 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z1048901 Keywords : Czech meteorite * photon activation analysis Subject RIV: DD - Geochemistry Impact factor: 0.472, year: 2003
a comparative study of student academic performance in on-campus
African Journals Online (AJOL)
User
demic performance (Cumulative Weighted Average Scores) between distance and on-campus students. ... one of the several programmes that is offered ... and women in the two courses in health care ..... cation for Business 77 (5):257-263.
Search Results | Page 16 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 151 - 160 of 257 ... Multi-donor Research Platform on Social Protection, Financial Inclusion and ... Child Support, Poverty and Gender Equality in the Caribbean - Phase II ... Sector within Urban Policies in Latin America and the Caribbean.
Use of the industrial yeast Candida utilis for cadmium sorption
Czech Academy of Sciences Publication Activity Database
Kujan, Petr; Prell, Aleš; Šafář, Hynek; Sobotka, Miroslav; Řezanka, Tomáš; Holler, Pavel
2006-01-01
Roč. 51, č. 4 (2006), s. 257-260 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : candida utilis * cadmium * yeast Subject RIV: EE - Microbiology, Virology Impact factor: 0.963, year: 2006
Search Results | Page 20 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 191 - 200 of 257 ... Involving urban communities in controlling dengue fever in Latin America ... For most countries, raising the minimum wage has long been considered a way ... Evaluating vocational training program for women in Brazil.
Search Results | Page 17 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 161 - 170 of 257 ... This project will focus on understanding governance issues related to ... adopting information and communication technologies (ICTs) in the process of ... Nurses are the largest single group of health professionals who ...
Komentované fytocenologické snímky z České republiky. 1.
Czech Academy of Sciences Publication Activity Database
Dřevojan, P.; Novák, P.; Sádlo, Jiří
2016-01-01
Roč. 52, č. 2 (2016), s. 257-267 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : plant communities * plant ecology * syntaxonomy Subject RIV: EF - Botanics
Search Results | Page 14 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 131 - 140 of 257 ... Filter by region .... Resilient Cities Initiative on Climate Change in Latin America and the Caribbean. This joint initiative between IDRC and the Climate and Development Knowledge Network will help strengthen ...
Agro-Science Journal of Tropical Agriculture, Food, Environment ...
African Journals Online (AJOL)
PC USER
Agro-Science Journal of Tropical Agriculture, Food, Environment and Extension. Volume 14 ... 3Department of Home Science, Nutrition and Dietetics, University of Nigeria, Nsukka,. Nigeria ..... work was found to be 25.7%. This value is higher.
Experimental in Situ Transformation of Pb Smelter Fly Ash in Acidic Soils
Czech Academy of Sciences Publication Activity Database
Ettler, V.; Mihaljevič, M.; Šebek, O.; Matys Grygar, Tomáš; Klementová, Mariana
2012-01-01
Roč. 46, č. 19 (2012), s. 10539-10548 ISSN 0013-936X Institutional research plan: CEZ:AV0Z40320502 Keywords : pollution -control residues Subject RIV: CA - Inorganic Chemistry Impact factor: 5.257, year: 2012
Lifescience Database Archive (English)
Full Text Available D04478 Drug Hydroxypropylcellulose (JP17); Hydroxypropyl cellulose (NF); Low substituted hydroxypropylcellu...lose (JP17); Lacrisert (TN) ... CAS: 9004-64-2 PubChem: 47206330 DrugBank: DB00840 NIKKAJI: J257.400D ...
2010-05-11
... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...
Application of polyaniline dispersions by means of screen printing
Czech Academy of Sciences Publication Activity Database
Držková, M.; Peřinka, N.; Hajná, Milena; Kaplanová, M.; Stejskal, Jaroslav
2013-01-01
Roč. 19, č. 2013 (2013), s. 257-268 ISSN 1211-5541 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * colloids * screen printing Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
African Journals Online (AJOL)
Uwaifoh
2012-04-30
Apr 30, 2012 ... ... by their reduced palatability, diet-induced anorexia, or systemic toxicity as reported by .... papaya (L.) in renal and DOCA-induced hypertension in the rat. ... International Journal of Crude Drug Research, 28(4): 257-266.
Czech Academy of Sciences Publication Activity Database
Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.
2001-01-01
Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001
Antiperspirants/Deodorants and Breast Cancer
... measurements and mechanisms of toxicological actions on breast biology. Journal of Inorganic Biochemistry 2013; 128:257-261. [PubMed Abstract] Willhite CC, Karyakina NA, Yokel RA, et al. Systematic review of potential health risks posed by pharmaceutical, ...
ORF Alignment: NC_006395 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul
Czech Academy of Sciences Publication Activity Database
Knotková, E.; Veitl, S.; Šumbera, R.; Sedláček, František; Burda, H.
2009-01-01
Roč. 18, č. 3 (2009), s. 241-257 ISSN 0952-4622 Institutional research plan: CEZ:AV0Z60870520 Keywords : silvery mole-rat * bathyergidae * vocal communication Subject RIV: EG - Zoology Impact factor: 1.050, year: 2009
Full Text Available ... Gorin 243,451 views 2:57 Hand Hygiene Dance - Duration: 3:15. mohd hafiz 34,146 views ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...
Polyethylene flame retarded with expandable graphite and a novel intumescent additive
CSIR Research Space (South Africa)
Focke, WW
2014-07-01
Full Text Available A novel intumescent additive was synthesized by neutralizing 3,5-diaminobenzoic acid hydrochloride salt with ammonium dihydrogen phosphate. This compound, which melts at 257 C, decomposes concurrently to release carbon dioxide gas. The flame...
CYP/PON genetic variations as determinant of organophosphate ...
Indian Academy of Sciences (India)
GURPREET KAUR
ticular disease and others do not (Rose et al. 2005). ..... Polycystic ovary syndrome,. Dadachanji et al. ..... early microvascular complications in type 1 diabetes. Diabetic ..... 257–261. Shenhar-Tsarfaty S., Waiskopf N., Ofek K., Shopin L., Usher.
Saariaho, Anna-Maija; Jääskeläinen, Anna-Stiina; Nuopponen, Mari; Vuorinen, Tapani
2003-01-01
Raman spectroscopy of wood and lignin samples is preferably carried out in the near-infrared region because lignin produces an intense laser-induced fluorescence background at visible excitation wavelengths. However, excitation of aromatic and conjugated lignin structures with deep ultra violet (UV) light gives resonance-enhanced Raman signals while the overlapping fluorescence is eliminated. In this study, ultra violet resonance Raman (UVRR) spectroscopy was used to define characteristic vibration bands of model compounds of p-hydroxyphenyl, guaiacyl, and syringyl lignin structures at three excitation wavelengths (229, 244, and 257 nm). The intensities of each band, relative to the intensity of the aromatic vibration band at 1600 cm-1, were defined and the most suitable excitation wavelength was suggested for each structure. p-Hydroxyphenyl structures showed intensive characteristic bands at 1217-1214 and 1179-1167 cm-1 with excitation at 244 nm, whereas the bands of guaiacyl structures were more intensive with 257 nm excitation. Most intensive characteristic bands of guaiacyl structures were found at 1289-1279, 1187-1185, 1158-1155, and 791-704 cm-1. Syringyl structures had almost identical spectra with 244 and 257 nm excitations with characteristic bands at 1514-1506, 1333-1330, and 981-962 cm-1. The characteristic bands of the three structural units were also found from the compression wood, softwood, and hardwood samples, indicating that UVRR spectroscopy can be applied for the determination of chemical structures of lignin.
Biohydrology research after Landau 2013 conference
Czech Academy of Sciences Publication Activity Database
Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav
2014-01-01
Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014
Radioactive waste management and advanced nuclear fuel cycle technologies
International Nuclear Information System (INIS)
2007-01-01
In 2007 ENEA's Department of Nuclear Fusion and Fission, and Related Technologies acted according to national policy and the role assigned to ENEA FPN by Law 257/2003 regarding radioactive waste management and advanced nuclear fuel cycle technologies
Search Results | Page 25 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 241 - 250 of 257 ... ... poor, combined with less education and limited access to healthcare services. ... Overall maternal and child health indicators are among the worst in ... Influencing eating behaviors in early childhood can have a huge ...
African Journals Online (AJOL)
Items 151 - 200 of 257 ... ... of extension advisors on privatization and outsourcing as an option for ... Vol 28 (1999), Small-scale farming and extension in South Africa's ... Vol 37 (2008), Socio-economic determinants of farmers\\' adoption of ...
Raman Spectra and Bulk Modulus of Nanodiamond in a Size Interval of 2-5 nm.
Popov, Mikhail; Churkin, Valentin; Kirichenko, Alexey; Denisov, Viktor; Ovsyannikov, Danila; Kulnitskiy, Boris; Perezhogin, Igor; Aksenenkov, Viktor; Blank, Vladimir
2017-10-10
Nanodiamond in a 2-5-nm size interval (which is typical for an appearance of quantum confinement effect) show Raman spectra composed of 3 bands at 1325, 1600, and 1500 cm -1 (at the 458-nm laser excitation) which shifts to 1630 cm -1 at the 257-nm laser excitation. Contrary to sp 2 -bonded carbon, relative intensities of the bands do not depend on the 458- and 257-nm excitation wavelengths, and a halfwidth and the intensity of the 1600 cm -1 band does not change visibly under pressure at least up to 50 GPa. Bulk modulus of the 2-5-nm nanodiamond determined from the high-pressure study is around 560 GPa. Studied 2-5-nm nanodiamond was purified from contamination layers and dispersed in Si or NaCl.
Czech Academy of Sciences Publication Activity Database
Shafter, A.W.; Henze, M.; Rector, T. A.; Schweizer, F.; Hornoch, Kamil; Orio, M.; Pietsch, W.; Darnley, M.J.; Williams, S.C.; Bode, M.F.; Bryan, J.
2015-01-01
Roč. 216, č. 2 (2015), 34/1-34/35 ISSN 0067-0049 Institutional support: RVO:67985815 Keywords : individual (M31) galaxies * stellar content * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
From P T -symmetric quantum mechanics to conformal field theory · Patrick Dorey Clare Dunning ... pp 251-257. Statistical features of quantum evolution · Sudhir R ... Sturm–Schrödinger equations: Formula for metric · Miloslav Znojil Hendrik B ...
This study examined the aggregate exposures of 257 preschool children to pollutants commonly found in their everyday environments. A primary objective was to identify important sources and routes that contribute to the children's exposures in these environments. Participants w...
Determining the Relationship between the Use of Fixed Appliances ...
African Journals Online (AJOL)
Mike Saghiri
2011-10-07
Oct 7, 2011 ... Periodontal disease is one of the major problem and concern ... Gingival bleeding. Gingival recession. Gingival hyperplasia. No. Yes. No ... had no history of smoking. .... 15.3 years (minimum 11.6 and maximum 25.7). In all.
Muzejní zlomek s opisem Evangelia sv. Matouše s homiliemi
Czech Academy of Sciences Publication Activity Database
Voleková, Kateřina
2017-01-01
Roč. 140, 1/2 (2017), s. 247-257 ISSN 0024-4457 R&D Projects: GA ČR GA15-06405S Institutional support: RVO:68378092 Keywords : Old Czech * Bible * translation * manuscript Subject RIV: AI - Linguistics OBOR OECD: Linguistics
Advantages of breath testing for the early diagnosis of lung cancer
Czech Academy of Sciences Publication Activity Database
Smith, D.; Španěl, Patrik; Sule-Suso, J.
2010-01-01
Roč. 10, č. 3 (2010), s. 255-257 ISSN 1473-7159 Institutional research plan: CEZ:AV0Z40400503 Keywords : mass spectrometry * breath analysis * lung cancer Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.652, year: 2010
Indian Academy of Sciences (India)
Administrator
41, Fatty acid degradation, KEGG PATHWAY, oas00071, 13, 43, 0.10466, 0.90655 ...... 257, Hepatitis C, KEGG PATHWAY, oas05160, 20, 132, 0.86387, 0.96769 ... 264, Vitamin digestion and absorption, KEGG PATHWAY, oas04977, 2, 22 ...
Search Results | Page 3 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 21 - 30 of 257 ... Scaling open data for development in Latin America. Latin America is the most unequal region in the world and faces complex development challenges. ... Digital marketplace platforms like AirBnB and Uber, sometimes ...
Morphology of the Local Supercluster
International Nuclear Information System (INIS)
Tully, R.B.
1983-01-01
The intent of this brief note is to summarize some of the fundamental properties of the region, rich in galaxies, in which we live. A more complete account can be found in Astrophys. J., 257, p. 389, 1982. (Auth.)
Prevalence and immediate outcomes of hypoxic Ischaemic ...
African Journals Online (AJOL)
research and Publications via the Office of the Head,. Department Of Paediatrics and ... thank the nurses of neonatal ward for their assistance during data collection. ... Birth asphyxia: A review. East Asian Medical Journal 1985; 72:252 – 257. 2.
Effects of an inorganic insecticide (boric acid) against Blattella ...
African Journals Online (AJOL)
ufuoma
2013-05-01
May 1, 2013 ... Data on ovarian .... The overall data suggested an interference of boric acid with the ... solutions as baits for management of German cockroaches .... Comp. Biochem. Physiol. 135C:257-267. Tine S, Aribi N, Soltani N (2011).
Effects of Boreal Timber Rafting on the Composition of Arctic Driftwood
Czech Academy of Sciences Publication Activity Database
Hellmann, L.; Kirdyanov, A. V.; Büntgen, Ulf
2016-01-01
Roč. 7, č. 11 (2016), č. článku 257. ISSN 1999-4907 Institutional support: RVO:67179843 Keywords : boreal rivers * Arctic driftwood * timber logging * industrial floating * Siberia Subject RIV: GK - Forestry Impact factor: 1.951, year: 2016
Czech Academy of Sciences Publication Activity Database
Rulíšek, Lubomír; Ryde, U.
2013-01-01
Roč. 257, č. 2 (2013), s. 445-458 ISSN 0010-8545 Institutional support: RVO:61388963 Keywords : multi-copper oxidases * QM/MM calculations * multireference calculations * the oretical spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 12.098, year: 2013
Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století
Czech Academy of Sciences Publication Activity Database
Brankatschk, Katja; Martínek, František; Futtera, Ladislav
2017-01-01
Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages
Gebed en die vorming van Christelike identiteit in Openbaring
African Journals Online (AJOL)
31 Jul 2015 ... 111.3 – Johns 2003). Deur die ... David Aune (2006:107) merk tereg op dat ... Stevenson 1995:257–272). ... sien Stevenson (2001:234). 6. ...... McKinnon, J., 1987, Music in early chrisfian worship, Cambridge University Press,.
EST Table: AV403752 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging
Directory of Open Access Journals (Sweden)
Laure-Anne Van Bellinghen
2018-01-01
Conclusion: All three models predicted a cost per quality-adjusted life year gained for quadrivalent versus trivalent influenza vaccine in the range of R$19,257 (FLORENCE to R$22,768 (FLORA with the best available data in Brazil (Appendix A.
Towards a genetic architecture of cryptic genetic variation and ...
Indian Academy of Sciences (India)
Unknown
reprinted in this issue as a J. Genet. classic, pages 227–257). IAN DWORKIN* ... In this commentary, I will discuss the context of this work examining the genetic ... mental buffering where development was channelled in one of several ...
Complexity in behavioural organization and strongylid infection among wild chimpanzees
Czech Academy of Sciences Publication Activity Database
Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, David; Hashimoto, C.; MacIntosh, A. J. J.
2017-01-01
Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:60077344 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016
Complexity in behavioural organization and strongylid infection among wild chimpanzees
Czech Academy of Sciences Publication Activity Database
Burgunder, J.; Pafčo, B.; Petrželková, Klára Judita; Modrý, D.; Hashimoto, C.; MacIntosh, A. J. J.
2017-01-01
Roč. 129, July (2017), s. 257-268 ISSN 0003-3472 Institutional support: RVO:68081766 Keywords : behavioural complexity * chimpanzees * fractal analysis * health monitoring * Pan troglodytes schweinfurthii * strongylid infection Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.869, year: 2016
On the Eulerian formulation of a stress induced platelet activation function
Czech Academy of Sciences Publication Activity Database
Bodnár, Tomáš
2014-01-01
Roč. 257, November (2014), s. 91-95 ISSN 0025-5564 Institutional support: RVO:61388998 Keywords : blood flow * platelet * stress * activation Subject RIV: BK - Fluid Dynamics Impact factor: 1.303, year: 2014 http://www.sciencedirect.com/science/article/pii/S0025556414001163
Czech Academy of Sciences Publication Activity Database
Pokorný, Radek; Tomášková, Ivana; Drápelová, I.; Kulhavý, J.; Marek, Michal V.
2010-01-01
Roč. 56, č. 6 (2010), s. 251-257 ISSN 1212-4834 R&D Projects: GA AV ČR IAA600870701 Institutional research plan: CEZ:AV0Z60870520 Keywords : bud * elevated CO2 * Norway spruce Subject RIV: EH - Ecology, Behaviour
International Journal of Natural and Applied Sciences - Vol 7, No 3 ...
African Journals Online (AJOL)
Effects of spent engine oil pollution on arable soil of Nekede Mechanic Village Owerri, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AC Udebuani, CI Okoli, H Nwigwe, PTE Ozoh, 257 – 260 ...
Czech Academy of Sciences Publication Activity Database
Kubatík, Tomáš František
2016-01-01
Roč. 50, č. 2 (2016), s. 257-261 ISSN 1580-2949 Institutional support: RVO:61389021 Keywords : TiAl6V4 * silicides * high-temperature oxidation * liquid-phase silicon izing Subject RIV: JG - Metallurgy Impact factor: 0.436, year: 2016
Search Results | Page 12 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 111 - 120 of 257 ... The human ecological footprint exceeds what the planet can ... people in Latin America (28% of its population) live in poverty. ... This project seeks to empower women as social scientists to increase their visibility and ...
Simulation of Seed Digestion by Birds: How Does It Reflect the Real Passage Through a Pigeon's Gut?
Czech Academy of Sciences Publication Activity Database
Vazačová, Kristýna; Münzbergová, Zuzana
2013-01-01
Roč. 48, č. 2 (2013), s. 257-269 ISSN 1211-9520 R&D Projects: GA ČR GAP505/10/0593 Institutional support: RVO:67985939 Keywords : Canary Islands * endozoochory * scarification Subject RIV: EF - Botanics Impact factor: 1.612, year: 2013
Is PT -symmetric quantum theory false as a fundamental theory?
Czech Academy of Sciences Publication Activity Database
Znojil, Miloslav
2016-01-01
Roč. 56, č. 3 (2016), s. 254-257 ISSN 1210-2709 R&D Projects: GA ČR GA16-22945S Institutional support: RVO:61389005 Keywords : quantum mechanics * PT-symmetric representations of observables * masurement outcomes Subject RIV: BE - Theoretical Physics
Lifescience Database Archive (English)
Full Text Available QT64344 Cucumis sativus Cucurbitaceae ldr1.3 Mean length:diameter ratio over three... harvests little-leaf (ll) trait (ldr1.3) 1,6 ... LG_01 ... 25.7 4.6 ... 10.1007/s00122-003-1277-1 12827247
Ruth Benedictová v Československu (léto 1948)
Czech Academy of Sciences Publication Activity Database
Kubáčková, Patricie
2015-01-01
Roč. 102, č. 3 (2015), s. 257-279 ISSN 0009-0794 Institutional support: RVO:68378092 Keywords : Ruth Benedict * UNESCO seminary in Poděbrady in 1948 * method of the research of national character at a distance Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Carrasco, I.; Bartosiewicz, Karol; Nikl, Martin; Piccinelli, F.; Bettinelli, M.
2015-01-01
Roč. 48, Oct (2015), s. 252-257 ISSN 0925-3467 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : phosphors * silico-carnotite * luminescence * energy transfer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.183, year: 2015
Disorder-induced broadening of transverse acoustic phonons in SixGe1-x mixed crystals
Czech Academy of Sciences Publication Activity Database
Beraud, A.; Kulda, Jiří; Yonenaga, I.; Foret, M.; Salce, B.; Courtens, E.
2004-01-01
Roč. 350, č. 1 (2004), s. 254-257 ISSN 0921-4526 R&D Projects: GA AV ČR KSK1010104 Keywords : disordered crystals * acoustic branches Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.679, year: 2004
Search Results | Page 913 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 9121 - 9130 of 9601 ... ... RESEARCH NETWORKS (257) Apply RESEARCH NETWORKS filter .... Intellectual property rights in regional trade agreements of ... Research findings and recommendations emanating from the case study of ... Regional cooperation for improvement of trade procedures : the case of Japan.
Apoteóza Sokola, armády a nového člověka: rané recepce Janáčkovy Sinfonietty
Czech Academy of Sciences Publication Activity Database
Zapletal, Miloš
2016-01-01
Roč. 53, 2/3 (2016), s. 257-287 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Leoš Janáček * Sinfonietta * reception of music * Janáček reception * reception studies Subject RIV: AL - Art, Architecture, Cultural Heritage
Gastrointestinal helminths of resident wildlife at the Federal ...
African Journals Online (AJOL)
ADEYEYE
2014-08-12
Aug 12, 2014 ... 2012) In Nigeria there is still a lacuna of data on the diseases and parasites ... management of zoological exhibits (Hotez et al.,. 2008; Thompson et al., ..... Coimbatore, Zoo's Print Journal, 15(5): 257-. 258. Wenz A, Heymenn ...
Czech Academy of Sciences Publication Activity Database
Franc, Martin
2002-01-01
Roč. 52, č. 1 (2002), s. 257-277 ISSN 0036-5246 R&D Projects: GA MŠk LN00A041 Institutional research plan: CEZ:AV0Z8063914 Keywords : Sternberg-Manderscheid Archive * court management Subject RIV: AB - History
SU-E-J-257: Image Artifacts Caused by Implanted Calypso Beacons in MRI Studies
Energy Technology Data Exchange (ETDEWEB)
Amro, H; Chetty, I; Gordon, J; Wen, N [Henry Ford Health System, Detroit, MI (United States)
2014-06-01
Purpose: The presence of Calypso Beacon-transponders in patients can cause artifacts during MRI imaging studies. This could be a problem for post-treatment follow up of cancer patients using MRI studies to evaluate metastasis and for functional imaging studies.This work assesses (1) the volume immediately surrounding the transponders that will not be visualized by the MRI due to the beacons, and (2) the dependence of the non-visualized volume on beacon orientation, and scanning techniques. Methods: Two phantoms were used in this study (1) water filled box, (2) and a 2300 cc block of pork meat. Calypso beacons were implanted in the phantoms both in parallel and perpendicular orientations with respect to the MR scanner magnetic field. MR image series of the phantom were obtained with on a 1.0T high field open MR-SIM with multiple pulse sequences, for example, T1-weighted fast field echo and T2-weighted turbo spin echo. Results: On average, a no-signal region with 2 cm radius and 3 cm length was measured. Image artifacts are more significant when beacons are placed parallel to scanner magnetic field; the no-signal area around the beacon was about 0.5 cm larger in orthogonal orientation. The no-signal region surrounding the beacons slightly varies in dimension for the different pulse sequences. Conclusion: The use of Calypso beacons can prohibit the use of MRI studies in post-treatment assessments, especially in the immediate region surrounding the implanted beacon. A characterization of the MR scanner by identifying the no-signal regions due to implanted beacons is essential. This may render the use of Calypso beacons useful for some cases and give the treating physician a chance to identify those patients prior to beacon implantation.
Magnetic properties of PrMn2-xFexGe2-57Fe Moessbauer spectroscopy
International Nuclear Information System (INIS)
Wang, J L; Campbell, S J; Cadogan, J M; Tegus, O; Studer, A J; Hofmann, M
2006-01-01
We have investigated the magnetic behaviour of PrMn 2-x Fe x Ge 2 compounds with x = 0.4, 0.6 and 0.8 over the temperature range 4.2-350 K using ac magnetic susceptibility, dc magnetization and 57 Fe Moessbauer effect spectroscopy, as well as neutron diffraction for the PrMn 1.2 Fe 0.8 Ge 2 compound. Replacement of Mn with Fe leads to contraction of the unit cell and a shortening of the Mn-Mn spacing, resulting in modification of the magnetic structure. PrMn 1.6 Fe 0.4 Ge 2 is an intralayer antiferromagnet at room temperature and ferromagnetic below T C inter ∼230 K with additional ferromagnetic ordering of the Pr sublattice detected below T C Pr ∼30 K. Re-entrant ferromagnetism has been observed in PrMn 1.4 Fe 0.6 Ge 2 with four magnetic transitions (T N intra ∼333 K, T C inter ∼168 K, T N inter ∼152 K and T C Pr ∼40 K). Moreover, it was found that T C inter and T C Pr increase with applied field while T N inter decreases. PrMn 1.2 Fe 0.8 Ge 2 is antiferromagnetic with T N intra ∼242 K and T N inter ∼154 K. The magnetic transition temperatures for all compounds are also marked by changes in the 57 Fe magnetic hyperfine field and the electric quadrupole interaction parameters. The 57 Fe transferred hyperfine field at 4.5 K in PrMn 1.6 Fe 0.4 Ge 2 and PrMn 1.4 Fe 0.6 Ge 2 is reduced (below the ordering temperature of the Pr sublattice) compared with that at 80 K (above T C Pr ), indicating that the transferred hyperfine field from Pr acts in the opposite direction to that from the Mn atoms. The neutron data for PrMn 1.2 Fe 0.8 Ge 2 demonstrate that an anisotropic thermal expansion occurs within the interplanar antiferromagnetic range
SU-E-J-257: Image Artifacts Caused by Implanted Calypso Beacons in MRI Studies
International Nuclear Information System (INIS)
Amro, H; Chetty, I; Gordon, J; Wen, N
2014-01-01
Purpose: The presence of Calypso Beacon-transponders in patients can cause artifacts during MRI imaging studies. This could be a problem for post-treatment follow up of cancer patients using MRI studies to evaluate metastasis and for functional imaging studies.This work assesses (1) the volume immediately surrounding the transponders that will not be visualized by the MRI due to the beacons, and (2) the dependence of the non-visualized volume on beacon orientation, and scanning techniques. Methods: Two phantoms were used in this study (1) water filled box, (2) and a 2300 cc block of pork meat. Calypso beacons were implanted in the phantoms both in parallel and perpendicular orientations with respect to the MR scanner magnetic field. MR image series of the phantom were obtained with on a 1.0T high field open MR-SIM with multiple pulse sequences, for example, T1-weighted fast field echo and T2-weighted turbo spin echo. Results: On average, a no-signal region with 2 cm radius and 3 cm length was measured. Image artifacts are more significant when beacons are placed parallel to scanner magnetic field; the no-signal area around the beacon was about 0.5 cm larger in orthogonal orientation. The no-signal region surrounding the beacons slightly varies in dimension for the different pulse sequences. Conclusion: The use of Calypso beacons can prohibit the use of MRI studies in post-treatment assessments, especially in the immediate region surrounding the implanted beacon. A characterization of the MR scanner by identifying the no-signal regions due to implanted beacons is essential. This may render the use of Calypso beacons useful for some cases and give the treating physician a chance to identify those patients prior to beacon implantation
Outwards pointing hysteresis operators and asymptotic behaviour of evolution equations
Czech Academy of Sciences Publication Activity Database
Klein, O.; Krejčí, Pavel
2003-01-01
Roč. 4, č. 5 (2003), s. 755-785 ISSN 1468-1218 Keywords : hysteresis operators * Prandtl-Ishlinskii operator * asymptotic behaviour Subject RIV: BA - General Mathematics Impact factor: 0.257, year: 2003 http://www.wias-berlin.de/preprint/748/wias_preprints_748.pdf
Reliability and Validity of a Prototype Fluid Intake Monitor
National Research Council Canada - National Science Library
Tharion, William J; Karis, Anthony J; Hoyt, Reed W
2009-01-01
.... There was no difference in mean sip volume measured using the FIM vs. the scale (25.7 + 10.7 ml vs. 25.6 + 8.7 ml, respectively). Field Test Results: of 31 trials, 4 trials under-measured water consumption in excess of 15...
Jiří George Kukla a velká klimatologie globálních změn
Czech Academy of Sciences Publication Activity Database
Cílek, Václav
2003-01-01
Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf
Unit Ministry Team Religious Support to Casualties on the Airland Battlefield
1987-10-28
Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart
Ontological Proofs of Existence and Non-Existence
Czech Academy of Sciences Publication Activity Database
Hájek, Petr
2008-01-01
Roč. 90, č. 2 (2008), s. 257-262 ISSN 0039-3215 R&D Projects: GA AV ČR IAA100300503 Institutional research plan: CEZ:AV0Z10300504 Keywords : ontological proofs * existence * non-existence * Gödel * Caramuel Subject RIV: BA - General Mathematics
Lifescience Database Archive (English)
Full Text Available QT64750 Cucumis sativus Cucurbitaceae sex1.2 Number of female nodes on mainstem gynoecious (F) trait (sex...1.1), determinate (de) trait (sex1.2) ... LG_01 ... 25.7 7.3 ... 10.1007/s00122-003-1277-1 12827247
Nutritive evaluation of Telfairia occidentalis leaf protein concentrate ...
African Journals Online (AJOL)
STORAGESEVER
2008-08-04
Aug 4, 2008 ... The details determination of amino acids is as described elsewhere ... photometry (Jenway Ltd, Dunmond, Essex, UK) while phosphorus .... Zinc. 79.6. 21.5. 25.7. Magnesium. 18.1. 2.33. 0.8. Anti-nutrients (mg 100mg-1 DM).
Czech Academy of Sciences Publication Activity Database
Staněk, Vladimír; Hanika, Jiří; Jiřičný, Vladimír; Stavárek, Petr; Tukač, V.; Lederer, J.
2009-01-01
Roč. 23, č. 3 (2009), s. 251-257 ISSN 1451-9372 R&D Projects: GA MPO FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : trickle bed * feed modulation * catalytic reactor Subject RIV: CI - Industrial Chemistry, Chemical Engineering
Keaton, Shaughan A.; Keteyian, Robert V.; Bodie, Graham D.
2014-01-01
This article provides validity evidence for a measure of listening goals by showing theoretically consistent relationships with an existing communication preference questionnaire. Participants (N = 257) were administered trait measures for listening goals and communicator preferences. The four listening goals--relational, task-oriented,…
Czech Academy of Sciences Publication Activity Database
Ackerman, Lukáš; Magna, T.; Rapprich, V.; Upadhyay, D.; Krátký, O.; Čejková, B.; Erban, V.; Kochergina, Y. V.; Hrstka, Tomáš
284/285, 1 July (2017), s. 257-275 ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : carbonatite * geochemistry * Samalpatti * Sevattur * silicocarbonatite * Sr–Nd–Pb–C–O isotopic systematics Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016
Küter-Luks, Theresa; Heuvelman, A.; Peters, O.
2011-01-01
Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of
Berkel, J. van; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; Beek, A.J. van der
2014-01-01
Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two
van Berkel, J.; Boot, C.R.L.; Proper, K.I.; Bongers, P.M.; van der Beek, A.J.
2014-01-01
Objectives: The aim of the present study was to evaluate the effectiveness of a worksite mindfulness-related multicomponent health promotion intervention on work engagement, mental health, need for recovery and mindfulness. Methods: In a randomized controlled trial design, 257 workers of two
E-beam and UV induced fabrication of CeO2, Eu2O3 and their mixed oxides with UO2
Czech Academy of Sciences Publication Activity Database
Pavelková, T.; Vaněček, V.; Jakubec, Ivo; Čuba, V.
2016-01-01
Roč. 124, JUL (2016), s. 252-257 ISSN 0969-806X Institutional support: RVO:61388980 Keywords : E-beam * Nuclear fuels * Radiation synthesis * Cerium(IV) oxide * Europium(III) oxide * Uranium (IV) oxide Subject RIV: CA - Inorganic Chemistry Impact factor: 1.315, year: 2016
Search Results | Page 7 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 61 - 70 of 257 ... Extraterritorial investments, environmental crisis, and collective action in ... The second cohort of the Open Data Leaders Network convened at the ... This presentation defines open data, and shares examples of potential social and economic benefits. ... Capacity building Evaluation COMMUNICATION ...
Zmenšení dynamických účinků na předpjatých mostech
Czech Academy of Sciences Publication Activity Database
Frýba, Ladislav
2005-01-01
Roč. 14, č. 9 (2005), s. 257-260 ISSN 1210-4027 R&D Projects: GA MDS (CZ) 1F45D/013/120 Institutional research plan: CEZ:AV0Z20710524 Keywords : prestressed bridges * dynamics * prestressed strings Subject RIV: JM - Building Engineering
DEFF Research Database (Denmark)
Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia
The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of one flavouring substance, 2,6-dimethyl-2,5,7-octatriene-1-ol acetate [FL-no: 09.931], from subgroup 1.1.2 of FGE.19, which...... is considered to be representative for four substances, 12-beta-santalen-14-ol [FL-no: 02.216], 12-alpha-santalen-14-ol [FL-no: 02.217], santalyl acetate [FL-no: 09.034] and santalyl phenylacetate [FL-no: 09.712], from subgroup 2.1 of FGE.19. The Flavour Industry has provided genotoxicity studies......-no: 09.034] and santalyl phenylacetate [FL-no: 09.712] from FGE.19 subgroup 2.1 for which 2,6-dimethyl-2,5,7-octatriene-1-ol acetate [FL-no: 09.931] is representative. © European Food Safety Authority, 2013...
Data of evolutionary structure change: 1AJ8B-1IOMA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1AJ8B-1IOMA 1AJ8 1IOM B A LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELS...>GLY CA 362 ASP CA 307 LYS CA 257 1IOM... A 1IOMA EKLARLVAEKHGHS ARG CA 182 1IOM A 1IOM... 2.0784668922424316 2 1IOM
Posouzení vlivu simulovaného poškození listové plochy na výnos a kvalitu cukrovky
Czech Academy of Sciences Publication Activity Database
Cerkal, R.; Dvořák, J.; Kamler, Jiří; Hřivna, L.
2006-01-01
Roč. 122, 9-10 (2006), s. 257-261 ISSN 1210-3306 R&D Projects: GA MZe QF4192 Institutional research plan: CEZ:AV0Z60930519 Keywords : sugar beet Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.078, year: 2004
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences; Volume 115; Issue 3. Volume 115, Issue 3. August 2005, pages 241-369. pp 241-249. Some Properties of ... with some properties which are mathematically and statistically interesting. pp 251-257. Homeomorphisms and the Homology of Non-Orientable Surfaces.
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences. Basudeb Datta. Articles written in Proceedings – Mathematical Sciences. Volume 112 Issue 2 May 2002 pp 257-281. Two-Dimensional Weak Pseudomanifolds on Eight Vertices · Basudeb Datta Nandini Nilakantan · More Details Abstract Fulltext PDF. We explicitly ...
Microbial colonization of silicone voice prostheses used in laryngectomized patients
Eerenstein, S. E.; Grolman, W.; Schouwenburg, P. F.
1999-01-01
The aim of this study was to identify the microbial colonization of dysfunctioning voice prostheses in laryngectomized patients and determine the influence of patient radiation therapy on prosthesis life span. In a 40-month period, 257 outpatient voice prosthesis replacements were carried out in a
2012-04-27
...: Gregory Intoccia, Special Counsel, Cybersecurity and Communications Reliability Division, Public Safety... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC 20554, or online at http://transition.fcc.gov/Daily_Releases/Daily_Business...
2013-02-15
... 11, 2011. 82,239 Hewlett Packard Santa Monica, CA....... December 10, 2011. Enterprise Services, LLC, Technical/ Enterprise Services Division, SAIT Services. 82,250 YP Western Directory Anaheim, CA December 12, 2011. LLC, Anaheim California Div., Publishing Operation, YP Western Holding YP Advertising. 82,257...
Iranian Sanctions: An Actor-Centric Analysis
2012-03-01
cultivated to counterbalance other actors in the system who opposed Khamenei’s ascension, based on his weak religious credentials.42 These security...trumped up religious infraction.256 The bonyads are the Iranian economy’s dominating revenue generating entity outside the oil sector,257 mushrooming in
Czech Academy of Sciences Publication Activity Database
Šlouf, V.; Fuciman, M.; Johanning, S.; Hofmann, E.; Frank, H.A.; Polívka, Tomáš
2013-01-01
Roč. 117, 1-3 (2013), s. 257-265 ISSN 0166-8595 R&D Projects: GA ČR(CZ) GAP205/11/1164 Institutional support: RVO:60077344 Keywords : Dinoflagellates * Energy transfer * Light- harvesting * Carotenoid Subject RIV: BO - Biophysics Impact factor: 3.185, year: 2013
Predictors of Secondary Traumatic Stress among Children's Advocacy Center Forensic Interviewers
Bonach, Kathryn; Heckert, Alex
2012-01-01
This study examined various predictor variables that were hypothesized to impact secondary traumatic stress in forensic interviewers (n = 257) from children's advocacy centers across the United States. Data were examined to investigate the relationship between organizational satisfaction, organizational buffers, and job support with secondary…
The politics of fiscal federalism in Nigeria | Duru | Lwati: A Journal of ...
African Journals Online (AJOL)
257. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/lwati.v4i1.36834 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...
Leenstra, F.R.; Maurer, V.; Bestman, M.W.P.; Sambeek van, F.; Zeltner, E.; Reuvekamp, B.F.J.; Galea, F.; Niekerk, van T.G.C.M.
2012-01-01
1. A total of 257 farmers with free ranging laying hens (organic and conventional) in Switzerland, France and The Netherlands with 273 flocks were interviewed to determine the relationships between the genotype of the hens, management conditions and performance. 2. Almost 20 different genotypes
Czech Academy of Sciences Publication Activity Database
Filipi, Karolína; Marková, Silvia; Searle, J. B.; Kotlík, Petr
2015-01-01
Roč. 82, PA (2015), s. 245-257 ISSN 1055-7903 R&D Projects: GA ČR GAP506/11/1872 Institutional support: RVO:67985904 Keywords : adaptation * glacial refugia * mitogenome * mtDNA * Myodes glareolus * Numt Subject RIV: EG - Zoology Impact factor: 3.792, year: 2015
Pukupuku arunachalensis sp. nov. (Coleoptera, Scarabaeidae, Rutelinae) from Arunachal Pradesh, India
Czech Academy of Sciences Publication Activity Database
Gupta, D.; Chandra, K.; Bezděk, Aleš
2017-01-01
Roč. 2017, č. 257 (2017), s. 1-11 ISSN 2118-9773 Institutional support: RVO:60077344 Keywords : new species * taxonomy * Northeast India Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.649, year: 2016 http://www.europeanjournaloftaxonomy.eu/index.php/ejt/issue/view/264
Czech Academy of Sciences Publication Activity Database
Musil, Jindřich; Blažek, J.; Zeman, P.; Prokšová, Š.; Šašek, M.; Čerstvý, R.
2010-01-01
Roč. 257, č. 3 (2010), s. 1058-1062 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z10100520 Keywords : Al 2 O 3 (alumina) * annealing * thermal stability * nanocrystalline material * sputtering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.795, year: 2010
Differences in students' school motivation : A latent class modelling approach
Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje
In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct
Limited published information exists on young children’s exposures to bisphenol A (BPA) in the United States using urinary biomonitoring. In a previous project, we quantified the aggregate exposures of 257 preschool children to BPA in environmental and personal media over 48-h pe...
Social Support from Parents and Friends for Chinese Adolescents in Singapore
Cheung, Hoi Shan; Sim, Tick Ngee
2017-01-01
This study tested the situational hypothesis, by examining the perceived availability of three types of social support (emotional, informational, and instrumental) from parents and friends, with respect to occupational and interpersonal relationships issues. Participants were 257 Chinese Singaporean adolescents (120 males, 137 females) between…
Geomorphological research of large-scale slope instability at Machu Picchu, Peru
Czech Academy of Sciences Publication Activity Database
Vilímek, V.; Zvelebil, J.; Klimeš, Jan; Patzelt, Z.; Astete, F.V.; Kachlík, F.; Hartvich, Filip
2007-01-01
Roč. 89, č. 3-4 (2007), s. 241-257 ISSN 0169-555X Institutional research plan: CEZ:AV0Z30460519 Keywords : natural hazard * Machu Picchu * landslides Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.854, year: 2007 www.elsevier.com/locate/geomorphology
Das Luthertum in Böhmen und seine (Nicht)Reflexion bei den Nuntien am Kaiserhof
Czech Academy of Sciences Publication Activity Database
Černušák, Tomáš
2018-01-01
Roč. 18, č. 2 (2018), s. 257-267 ISSN 1805-790X Keywords : Nuncius * Papacy * Bohemian lands * Lutheranism Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)
Two-year oscillation cycle in abundance of soybean aphid in Indiana
Czech Academy of Sciences Publication Activity Database
Rhainds, M.; Yoo, H. J. S.; Kindlmann, Pavel; Voegtlin, D.; Castillo, D.; Rutledge, C.; Sadof, C.; Yaninek, S.; O'Neil, R. J.
2010-01-01
Roč. 12, č. 3 (2010), s. 251-257 ISSN 1461-9555 Institutional research plan: CEZ:AV0Z60870520 Keywords : Aphididae * Aphis glycines * autumn migration * Hemiptera * heteroecy * Rhamnus * seesaw effect * soybean aphid Subject RIV: EH - Ecology, Behaviour Impact factor: 1.484, year: 2010
Predicting Alcohol, Cigarette, and Marijuana Use from Preferential Music Consumption
Oberle, Crystal D.; Garcia, Javier A.
2015-01-01
This study investigated whether use of alcohol, cigarettes, and marijuana may be predicted from preferential consumption of particular music genres. Undergraduates (257 women and 78 men) completed a questionnaire assessing these variables. Partial correlation analyses, controlling for sensation-seeking tendencies and behaviors, revealed that…
Plasmid-encoded diacetyl (acetoin) reductase in Leuconostoc pseudomesenteroides
DEFF Research Database (Denmark)
Rattray, Fergal P; Myling-Petersen, Dorte; Larsen, Dianna
2003-01-01
A plasmid-borne diacetyl (acetoin) reductase (butA) from Leuconostoc pseudomesenteroides CHCC2114 was sequenced and cloned. Nucleotide sequence analysis revealed an open reading frame encoding a protein of 257 amino acids which had high identity at the amino acid level to diacetyl (acetoin...
Adsorption of copper, cadmium and silver from aqueous solutions onto natural carbonaceous materials
Czech Academy of Sciences Publication Activity Database
Hanzlík, P.; Jehlička, J.; Weishauptová, Zuzana; Šebek, O.
2004-01-01
Roč. 50, č. 6 (2004), s. 257-264 ISSN 1214-1178 R&D Projects: GA AV ČR IAA3111306 Institutional research plan: CEZ:AV0Z3046908 Keywords : activated carbon * metal-cations * removal Subject RIV: DD - Geochemistry Impact factor: 0.170, year: 2004
Search Results | Page 15 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 141 - 150 of 257 ... In the Caribbean islands, climate change is affecting freshwater availability and other ecosystem services in complex ways. ... IDRC's Democratic Governance, Women's Rights and Gender Equality initiative is supporting a body of comparative research on whether and how democratic processes ...
DEFF Research Database (Denmark)
Fossi, M.; Ahlsten, K.; Pohjanvirta, T.
2005-01-01
Fossi M, Ahlsten K, Pohjanvirta T, Anttila M, Kokkonen T, Jensen TK, Boye M, Sukura A, Pelkola K, Pelkonen S: Neither hippurate-negative Brachyspira pilosicoli nor Brachyspira pilosicoli type strain caused diarrhoea in early-weaned pigs by experimental infection. Acta vet. scand. 2005, 46, 257...
2010-07-01
... Carolina, Ohio, Pennsylvania, Rhode Island, South Carolina, Tennessee, Virginia, West Virginia, and the...,406 New Jersey 96,876 New York 240,322 North Carolina 165,306 Ohio 249,541 Pennsylvania 257,928 Rhode..., Russell, St. Clair, Shelby, Sumter, Talladega, Tallapoosa, Tuscaloosa, Walker, and Winston. (C) [Reserved...
African Journals Online (AJOL)
GEORGE
Department of Urban and Regional Planning, Abia State Polytechnic Aba, Nigeria. Received 16 ... Squatter development in Southern Aba Region of Nigeria ... respondents was determined from the study population of 125,257 using the Taro Yamane model for .... networks or near industrial areas and market places, and.
Czech Academy of Sciences Publication Activity Database
Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena
2015-01-01
Roč. 217, č. 1 (2015), 14/1-14/14 ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.257, year: 2015
Hickman, Gregory P.; Andrews, David W.
2003-01-01
A self-report questionnaire on academic achievement, birth order, and family structure; the Student Adaptation to College Questionnaire; the Parental Authority Questionnaire; and the Coping Humor Scale were administered to 257 first-year college students. Researchers examined the relationships among (a) authoritative parenting style, (b) family…
Czech Academy of Sciences Publication Activity Database
Aaboud, M.; Aad, G.; Abbott, B.; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Hladík, Ondřej; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Penc, Ondřej; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav
2017-01-01
Roč. 918, May (2017), s. 257-316 ISSN 0550-3213 Institutional support: RVO:68378271 Keywords : ATLAS * CERN LHC Coll * experimental results * 8000 GeV-cms Subject RIV: BF - Elementary Particles and High Energy Physics OBOR OECD: Particles and field physics Impact factor: 3.678, year: 2016
Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..
Czech Academy of Sciences Publication Activity Database
Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.
259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999
10 CFR 25.27 - Reopening of cases in which requests for access authorizations are canceled.
2010-01-01
... authorizations are canceled. 25.27 Section 25.27 Energy NUCLEAR REGULATORY COMMISSION ACCESS AUTHORIZATION Access Authorizations § 25.27 Reopening of cases in which requests for access authorizations are canceled. (a) In... cases were previously canceled, new fingerprint cards (FD-257) in duplicate and a new Security...
Czech Academy of Sciences Publication Activity Database
Hofmanová, Jiřina; Vaculová, Alena; Lojek, Antonín; Kozubík, Alois
2005-01-01
Roč. 44, č. 1 (2005), s. 40-51 ISSN 1436-6207 R&D Projects: GA ČR(CZ) GA525/01/0419 Institutional research plan: CEZ:AV0Z50040507 Keywords : colon cancer * diet * butyrate Subject RIV: BO - Biophysics Impact factor: 2.257, year: 2005
An annotated checklist of the vascular flora of Washington County Mississippi
Field explorations have yielded 257 species new to Washington County, Mississippi and Calandrinia ciliata (Ruiz & Pav.) DC. and Ruellia nudiflora (Engelm. & Gray) Urban new to the state. An annotated list of 796 taxa for Washington County is provided and excludes 62 species that were reported from ...
EST Table: FS871051 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available aa ref|NP_001139536.1| mortality factor 4-like [Bombyx mori] gb|ABJ99463.1| mrg15-like protein [Bombyx mori...FS871051 E_FL_fner_44F14_R_0 11/12/09 GO hit GO:0005634(nucleus) 10/09/28 100 %/257
Skill/Knowledge Commonalities in Selected Electronics Specialties.
1986-10-01
Maintenance Specialist 241 19 30750 Telecomunications Systems Control Specialist 498 35 30950A Missile Det and Warning Radar Specialistc 18 30 309506... Telecomunications Systems Control Specialist 59 ( 5) 125 (10) 259 (21) :. aNumbers in parenthesis are percentage of total possible (1,257). bBased on principles
The financial feasibility of producing fish and vegetables through aquaponics
Bosma, Roel H.; Lacambra, Lysette; Landstra, Ynze; Perini, Chiara; Poulie, Joline; Schwaner, Marie J.; Yin, Yi
2017-01-01
Aquaponics, producing fish and vegetables in a closed-loop water system, reduces fertilizer use and water discharge, and is therefore promoted as a sustainable venture. A recent global study found that the majority of 257 surveyed aquaponics farms made losses, but the reasons have been poorly
Influence of Teachers' Teaching Experience on Students' Learning ...
African Journals Online (AJOL)
This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools that presented students for the year 2003 senior secondary certificate (SSC) examinations in the ...
Differences in pathogenicity among strains of the same or different avian leukosis virus subgroups
Czech Academy of Sciences Publication Activity Database
Průková, Dana; Vernerová, Z.; Pilčík, Tomáš; Stepanets, Volodymyr; Indrová, Marie; Geryk, Josef; Plachý, Jiří; Hejnar, Jiří; Svoboda, Jan
2007-01-01
Roč. 36, č. 1 (2007), s. 15-27 ISSN 0307-9457 R&D Projects: GA ČR GA523/04/0489 Institutional research plan: CEZ:AV0Z50520514 Keywords : chicken * wasting disease * ALV Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007
Czech Academy of Sciences Publication Activity Database
Tavşanoglu, Ü.N.; Šorf, Michal; Stefanidis, K.; Brucet, S.; Turkan, S.; Agasild, H.; Baho, D.L.; Scharfenberger, U.; Hejzlar, Josef; Papastergiadou, E.; Adrian, R.; Angeler, D.G.; Zingel, P.; Çakiroglu, A.I.; Ozen, A.; Drakare, S.; Sondergaard, M.; Jeppesen, E.; Beklioglu, M.
2017-01-01
Roč. 51, č. 2 (2017), s. 257-273 ISSN 1386-2588 EU Projects: European Commission(XE) 244121 - REFRESH Institutional support: RVO:60077344 Keywords : climate change * water level change * zooplankton * size structure * mesocosms Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.500, year: 2016
Czech Academy of Sciences Publication Activity Database
Hejda, Martin; Pyšek, Petr
2008-01-01
Roč. 7, - (2008), s. 250-257 ISSN 1619-0033 R&D Projects: GA ČR(CZ) GA206/05/0323 Grant - others:ALARM(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * impact * species diversity Subject RIV: EF - Botanics
Prevalence and drug resistance in bacteria of the urinary tract ...
African Journals Online (AJOL)
Objective: To obtain data on the prevalence of antibiotic resistance in bacteria isolated from patients with suspected urinary tract infection in Bulawayo province, Zimbabwe. Method: Over a period of one year, 257 urine samples were analyzed for bacteria by standard procedures. Antimicrobial susceptibility testing of isolated ...
Czech Academy of Sciences Publication Activity Database
Malá, Zdeňka; Gebauer, Petr; Boček, Petr
2016-01-01
Roč. 935, SEP (2016), s. 249-257 ISSN 0003-2670 R&D Projects: GA ČR(CZ) GA16-09135S Institutional support: RVO:68081715 Keywords : electrophoretic focusing * CE-ESI-MS * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.950, year: 2016
Search Results | Page 23 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 221 - 230 of 257 ... ... Economic and social development filter · RESEARCH NETWORKS 9 Apply ... Impact of maternal and child health private expenditure on ... Food security radio programme and videos : overview (annex 32 of final technical report) ... of growth media, and adoption of water management strategies, ...
DEFF Research Database (Denmark)
Amris, Kirstine; Wæhrens, Eva Ejlersen; Stockmarr, Anders
2014-01-01
-sectional with systematic data collection in a clinical setting. Subjects: A total of 257 consecutively enrolled women with chronic widespread pain. Methods: Multidimensional assessment using self-report and observation-based assessment tools identified to cover ICF categories included in the brief ICF Core Set for chronic...
24 CFR 4001.403 - Prohibitions on interested parties in insured mortgage transaction.
2010-04-01
... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Prohibitions on interested parties... under section 257 of the Act shall not improperly influence or attempt to improperly influence through..., inducement, intimidation, nonpayment for services rendered, or bribery, the development, reporting, result or...
Exploring exercise behavior, intention and habit strength relationships
de Bruijn, G.J.; Rhodes, R.E.
2011-01-01
The purpose of this study was to explore the relevance of integrating exercise habit strength within the framework of the theory of planned behavior. Data were obtained from 538 undergraduate students [mean age=21.19 (SD=2.57); 28.4% males] using validated questionnaires and analyzed using
Strong overtones and combination bands in ultraviolet resonance Raman spectroscopy
Efremov, E.V.; Ariese, F.; Mank, A.J.G.; Gooijer, C.
2006-01-01
Ultraviolet resonance Raman spectroscopy is carried out using a continuous wave frequency-doubled argon ion laser operated at 229, 244, and 257 nm in order to characterize the overtones and combination bands for several classes of organic compounds in liquid solutions. Contrary to what is generally
Different responses of soybean cyst nematode resistance between ...
Indian Academy of Sciences (India)
2016-12-02
Dec 2, 2016 ... 3Crop Research Institute, Shandong Academy of Agricultural Sciences, Jinan, Shandong 250100, People's Republic of ... SCN race 1 (HG types 2.5.7), while 7605 is highly susceptible. ... nomical and environmental friendly method to control ..... analysis and qualitative mapping of a major partial-resistance.
Digital Repository Service at National Institute of Oceanography (India)
Devi, K.S.
Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...
Czech Academy of Sciences Publication Activity Database
Amemori, Takashi; Růžička, Jiří; Romanyuk, Nataliya; Jhanwar-Uniyal, M.; Syková, Eva; Jendelová, Pavla
2015-01-01
Roč. 6, Dec (2015), s. 257 ISSN 1757-6512 R&D Projects: GA MŠk(CZ) LH12024 Institutional support: RVO:68378041 Keywords : spinal cord injury * human induced pluripotent stem cells * cell therapy * cell application route Subject RIV: FH - Neurology Impact factor: 4.504, year: 2015
ESR and TSL study of hole and electron traps in LuAG:Ce,Mg ceramic scintillator
Czech Academy of Sciences Publication Activity Database
Hu, C.; Liu, S.-P.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.
2015-01-01
Roč. 45, Jul (2015), s. 252-257 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : LuAG * scintillator * codoping * Ce3+ * O- center Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015
Vervoort, W.
1964-01-01
INTRODUCTION In 1956 Kinne (1956, p. 257) published the description of a new athecate hydroid, Perigonimus megas, discovered by him in the Nordostseekanal, a canal connecting the North Sea with the Baltic. Kinne's new species resembles a well known and widely distributed fresh- and brackish-water
Search Results | Page 4 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 31 - 40 of 257 ... ... and social development filter · RESEARCH NETWORKS 9 Apply ... While many private companies have made strides in building ... This presentation defines open data, and shares examples of potential social and economic benefits. ... and diversity on small holder farms to school feeding programs.
Temporal and spatial variations in hydrographic conditions of Mandovi estuary
Digital Repository Service at National Institute of Oceanography (India)
Varma, K.K.; Rao, L.V.G.; Cherian, T.
Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...
Uniformed Services Worldwide Legal Assistance & Reserve Components Office Directory. Revised.
1999-11-01
257-1829 Commander (dl) 14th Coast Guard District Prince Kalanianaole Federal Building 300 Ala Moana Blvd, 9th Floor Honolulu, Hawaii 96850-4982...a),aarons.org Practice Area: 351 - Criminal Law - Defense, 400 - General Practice Bars Admitted: NM County of Practice: Santa Fe, Rio Arriba , Los
2011-09-19
...://edis.usitc.gov . Hearing-impaired persons are advised that information on this matter can be obtained... Industry, Co., Ltd. and Gem Electronics, Inc. (``the active respondents''), remained active. On October 13... found infringement of the `257 patent by the defaulting respondents and no infringement by the active...
Photoacoustic Detection of Terahertz Radiation for Chemical Sensing and Imaging Applications
2013-03-01
ISSN 2229-5518 [39] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic emission through terahertz-field driven electron...materials,” Journal of Electroceramics, vol. 2: p. 257-272, 2009. [47] Jingle Liu, Benjamin Clough, and X. C. Zhang, “Enhancement of photoacoustic
Electrospinning of reactive mesogens
Yao, J.; Picot, O.T.; Hughes-Brittain, N.F.; Bastiaansen, C.W.M.; Peijs, T.
2016-01-01
The reinforcement potential of reactive liquid crystals or reactive mesogens (RMs) in electrospun fibers was investigated through the blending of two types of RMs (RM257 and RM82) with two types of thermoplastics; polyamide 6 (PA6) and poly(methyl methacrylate) (PMMA). Polymer/RM blends were
2011-12-27
... DEPARTMENT OF STATE [Public Notice: 7739] Culturally Significant Objects Imported for Exhibition Determinations: ``Woman in Blue, Against Blue Water'' by Edvard Munch SUMMARY: Notice is hereby given of the..., Delegation of Authority No. 257 of April 15, 2003), I hereby determine that the object ``Woman in Blue...
I psychologové mají svou olympiádu. Úspěch české psychologie na mezinárodním fóru
Czech Academy of Sciences Publication Activity Database
Klicperová-Baker, Martina
(2016) ISSN 2336-257X R&D Projects: GA MŠk LG15038 Institutional support: RVO:68081740 Keywords : psychologists * Czech psychology * international forum Subject RIV: AN - Psychology http://veda-a-technika.eurozpravy.cz/veda/165538-i-psychologove-maji-svou-olympiadu-uspech-ceske-psychologie-na-mezinarodnim-foru/
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...
Angle dependent laser nanopatterning of poly(ethylene terephthalate) surfaces
Czech Academy of Sciences Publication Activity Database
Slepička, P.; Chaloupka, A.; Sajdl, P.; Heitz, J.; Hnatowicz, Vladimír; Svorcik, V.
2011-01-01
Roč. 257, č. 14 (2011), s. 6021-6025 ISSN 0169-4332 R&D Projects: GA ČR GA106/09/0125 Institutional research plan: CEZ:AV0Z10480505 Keywords : POLYMER SURFACES * THIN-FILM * RADIATION Subject RIV: BO - Biophysics Impact factor: 2.103, year: 2011
Directory of Open Access Journals (Sweden)
Gurmukh Singh
2015-04-01
Full Text Available Objective: Assess the need for folate testing, frequency of corrective action, and determine reference level for serum folate. Methods: Serum folate levels in 5313 samples from 4448 patients, and clinical data were reviewed for patient characteristics and for (a evidence of corrective action in patients with serum folate values 25.7 ng/mL. Results: The prevalence of serum folate levels, in patients, 25.7 ng/mL the sample was collected after supplementation with folic acid. Of the 128 patients with serum folate 60% of the patients. Since serum folate levels â¥13.0 ng/mL are needed for optimal prevention of neural tube defects in the embryo/fetus, we propose that normal serum folate level should be designated to be â¥13.0 ng/mL. Keywords: Serum folate, Prevalence of folate deficiency, Neural tube defects, Optimum serum folate level, Utility of folate testing
Charge distributions of fission fragments of low- and high-energy fission of Fm, No, and Rf isotopes
Paşca, H.; Andreev, A. V.; Adamian, G. G.; Antonenko, N. V.
2018-03-01
The charge (mass) distributions of fission fragments resulting from low- and high-energy fission of the even-even nuclei 254 -260 ,264Fm , 258 -264No , and 262 -266Rf are studied with the statistical scission-point model. The calculated results are compared with the available experimental data. In contrast to the experimental data, the calculated mass distribution for 258Fm (s.f.) is strikingly similar to the experimental one for 257Fm (s.f.). The transformation of the shape of charge distribution with increasing isospin and excitation energy occurs gradually and in a similar fashion like that of the mass distribution, but slower. For 254Fm(i.f.), 257Fm(nt h,f), and 260Fm (s.f.), the unexpected difference (symmetric or asymmetric) between the shapes of charge and mass distributions is predicted for the first time. At some critical excitation energy, the saturation of the symmetric component of charge (mass) yields is demonstrated.
Irradiation of sewage sludge using cesium-137: a comparative assessment
International Nuclear Information System (INIS)
1980-06-01
Irradiation using 137 CS is a recently developed process for disinfecting sewage sludge before applying it to the land. Irradiation, composting, and heat drying are Processes to Further Reduce Pathogens (PFRP) when operated to meet the guidelines set forth under Title 40, Code of the Federal Register, Part 257 (40 CFR 257). This report identifies and develops technical, operational, and environmental considerations for sludge handling systems incorporating these PFRP to determine the economic advantages of each process. The results indicate that sludge irradiation systems are cost-competitive with composting and heat drying systems for wastewater treatment plants with or without existing anaerobic digesters. Irradiation can thus be considered for new as well as upgrading existing facilities for sludge disinfection. An attractive aspect of the irradiation process is that significantly less conventional energy is used for operation when compared to composting and heat drying. In the final analysis, however, the applicability and desirability of any process is best determined by more evaluations specific to a given community
The target theory applied to the analysis of irradiation damages in organic detectors
International Nuclear Information System (INIS)
Mesquita, Carlos Henrique de
2005-01-01
The Target Theory was used to explain the radiation damage in samples containing 1% (g//L) of 2,5-diphenyl-oxazolyl (PPO) diluted in toluene and irradiated with 60 Co (1.8 Gy/s). The survival molecules of irradiated PPO obeys the bi-exponential mathematical model [74.3 x exp(-D/104.3) + 25.7 x exp(-D/800,0)]. It indicates that 74.3% of the molecules decay with D37=104.3 kGy and 25.7% decay with D37=800 kGy. From the Target Theory it was inferred the energies involved in the irradiation damages which were 0.239 ± 0.031 eV (G=418.4 ± 54.1. damages/100 eV) and 1.83 ± 0.30 eV (54.5 ± 8.9 damages/100 eV). The diameter of PPO molecule estimated from the Target Theory is in the interval of 45.5 to 64.9 angstrom. (author)
Moisture dependence of positron lifetime in Kevlar-49
Singh, Jag J.; Holt, William H.; Mock, Willis, Jr.
1984-01-01
Because of filamentary character of Kevlar-49 aramid fibers, there is some concern about the moisture uptake and its effect on plastic composites reinforced with Kevlar-49 fibers. As part of continuing studies of positron lifetime in polymers, we have measured positron lifetime spectra in Kevlar-49 fibers as a function of their moisture content. The long lifetime component intensities are rather low, being only of the order of 2-3 percent. The measured values of long component lifetimes at various moisture levels in the specimens are as follows: 2072 +/- 173 ps (dry); 2013 +/- 193 ps (20.7 percent saturation); 1665 +/- 85 ps (25.7 percent saturation); 1745 +/- 257 ps (32.1 percent saturation); and 1772 +/- 217 ps (100 percent saturation). It is apparent that the long component lifetime at first decreases and then increases as the specimen moisture content increases. These results have been compared with those inferred from Epon-815 and Epon-815/K-49 composite data.
Formal and Informal Employment Growth in Manufacturing (India ...
International Development Research Centre (IDRC) Digital Library (Canada)
Agent(e) responsable du CRDI. Rodriguez, Mr. Edgard. Financement total. CAD$ 257,300. Pays. Asie du sud, Asie centrale, Extrême-Orient, Bangladesh, Inde. Chargé(e) de projet. Dr. Sandip Sarkar. Institution. Institute for Human Development. Pays d' institution. India. Extrants. Documents. Employment problem in India ...
Synthesis of Highly Symmetrical Triptycene Tetra- and Hexacarboxylates
Czech Academy of Sciences Publication Activity Database
Rybáčková, Markéta; Bělohradský, Martin; Holý, Petr; Pohl, Radek; Dekoj, Václav; Závada, Jiří
-, č. 10 (2007), s. 1554-1558 ISSN 0039-7881 R&D Projects: GA ČR GA203/03/0087 Institutional research plan: CEZ:AV0Z40550506 Keywords : carboxylic acids * Diels - Alder reaction s * oxidations * triptycenes * arynes Subject RIV: CC - Organic Chemistry Impact factor: 2.257, year: 2007
African Journals Online (AJOL)
Administrator
2 Department of Population Studies, University of Botswana, Private Bag 00705, Gaborone, Botswana ... Methods: The study used cross-sectional data from the Botswana AIDS Impact Survey III on 1,257 men aged 15 years ... is unknown and are having sex with circumcised men. ...... Global HIV prevention working group.
2014-12-31
4, 257–271. Albertsen, K., Rafnsdóttir, G. L., Grimsmo, A., Tómasson, K., & Kauppinen, K. (2008). Workhours and worklife balance . Scandinavian...consequences on balancing work and home life. Scientific evidence suggests that shift work has a negative influence on children’s well-being and on
Czech Academy of Sciences Publication Activity Database
Kasatkin, A.V.; Plášil, Jakub; Pekov, V.I.; Belakovskiy, D. I.; Nestola, F.; Čejka, J.; Vigasina, M.F.; Zorzi, F.; Thorne, B.
2015-01-01
Roč. 60, č. 4 (2015), s. 251-257 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : karpenkoite * new mineral * cobalt divanadate * powder diffraction * Little Eva mine * Utah Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015
Gabonese French Dictionaries: Survey and Perspectives*
African Journals Online (AJOL)
Gabonese French Dictionaries: Survey and Perspectives. 257 ... be regarded, according to Gouws (2007: 314), as externally motivated products. .... Fair attention is given to different style or normative levels, i.e. .... differs enough from standard French to be regarded as a new emerging lan- ..... Tous les leaders des par-.
GMES Sentinel-1 Analysis of Marine Applications Potential (AMAP)
2008-10-01
Synthetic Aperture Radar (EUSAR 2008), 2 to 5 June 2008, Friedrichshafen, Germany. Vol. 1, 179-182. VDE Verlag, Berlin, ISBN 978-3-8007-3084-1...European Conference on Synthetic Aperture Radar (EUSAR 2008), on CD-ROM. 2 to 5 June 2008, Friedrichshafen, Germany. Vol. 2, 257-260. VDE Verlag
Fives, Helenrose; Hamman, Doug; Olivarez, Arturo
2007-01-01
The burnout process may begin as early as the student-teaching experience [Gold, Y., 1985. Does teacher burnout begin with student teaching? "Education", 105, 254-257]. Data from 49 student-teachers in the southwest United States were gathered twice during their student-teaching practicum. Data assessing teacher efficacy, teacher…
Czech Academy of Sciences Publication Activity Database
Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.
2015-01-01
Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015
Hickman, Gregory P.; Crossland, Garnet L.
2004-01-01
Through the administration of self-report surveys, this study examined the relationships among a) parenting styles, b) family structure, c) academic achievement, d) birth order, e) gender, and f) humor on the initial personal-emotional, social, academic, and commitment to college adjustment among 257 first-quarter college freshmen. Multiple…
Czech Academy of Sciences Publication Activity Database
Siokou, A.; Ravani, F.; Karakalos, S.; Frank, Otakar; Kalbáč, Martin; Galiotis, C.
2011-01-01
Roč. 257, č. 23 (2011), s. 9785-9790 ISSN 0169-4332 R&D Projects: GA MŠk LC510; GA AV ČR IAA400400911 Institutional research plan: CEZ:AV0Z40400503 Keywords : graphene * XPS * EELS Subject RIV: CG - Electrochemistry Impact factor: 2.103, year: 2011
Czech Academy of Sciences Publication Activity Database
Martín-Sánchez, P.M.; Nováková, Alena; Bastian, F.; Alabouvette, C.; Saiz-Jimenez, C.
2012-01-01
Roč. 46, č. 7 (2012), s. 3762-3770 ISSN 0013-936X Grant - others:Spanish Ministry of Science and Innovation (ES) TCP CSD2007-00058 Institutional support: RVO:60077344 Keywords : fungal outbreaks * subterranean environments * Lascaux Cave Subject RIV: EH - Ecology, Behaviour Impact factor: 5.257, year: 2012
Radiation stability tests of the SMELS materials in the LVR-15 experimental reactor at Řež
Czech Academy of Sciences Publication Activity Database
Kučera, Jan; Eguskiza, M.; De Corte, F.; Rabouch, P.
2003-01-01
Roč. 257, č. 3 (2003), s. 677-682 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z1048901 Keywords : standardization * neutron activation analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.472, year: 2003
Czech Academy of Sciences Publication Activity Database
Vaňura, P.; Makrlík, E.; Vobecký, Miloslav
2003-01-01
Roč. 257, č. 2 (2003), s. 437-440 ISSN 0236-5731 R&D Projects: GA MŠk LN00B084 Institutional research plan: CEZ:AV0Z4031919; CEZ:MSM 230000009 Keywords : strontium * extraction Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.472, year: 2003
Empathy without borders? Cross-cultural heart and mind-reading in ...
African Journals Online (AJOL)
Background: This cross-cultural study was designed to examine cultural differences in empathy levels of first-year medical students. Methods: A total of 257 students from the academic year 2010/11, 131 at Jimma University, Ethiopia, and 126 at the Ludwig Maximilian University, Munich, Germany, completed the Balanced ...
1990-01-01
enhanced by using variable length, width and color. " Contour maps, color or grayscale maps, and hedgehog charts for scalar quantities on any surface. All...a com- munications guardian transputer, and a communications spine . Users currently have a choice of Occam, C, or Fortran. 257 3.2 Five Processor
DEFF Research Database (Denmark)
Lohse, Brian; Vestberg, Robert; Ivanov, Mario T.
2008-01-01
A second-generation (acridizinium)12-dendrimer based on a poly(2,2-bis(hydroxymethylpropionic acid)) [bis-MPA] scaffold which can undergo photoinduced (4n + 4n) cycloaddition reactions on exposure to blue-violet light at 405 nm, and be reversed upon irradiation at 257 nm, has been synthesized...
Molecular Studies of HTLV-1 Infection in Newly Recognized High Risk Population
1993-07-10
members. Members of this community continued to marry close relatives for over the next 150 years. Markers of consanguinity are high among Mashadi...Caribbean region, and relationship to adult T cell leukemia/lymphoma. Int J Cancer 1982;30:257-264. 51. Hattori T, Uchiyama T, Topibana K, Takatsuki K
78 FR 29063 - Survey of Urban Rates for Fixed Voice and Fixed Broadband Residential Services
2013-05-17
... the USF/ICC Transformation Order. DATES: Effective May 17, 2013. This Order contains information... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th... released the USF/ICC Transformation Order and FNPRM, 76 FR 73830, November 29, 2011, which comprehensively...
78 FR 33654 - Reassessment of Exposure to Radiofrequency Electromagnetic Fields Limits and Policies
2013-06-04
... available for inspection and copying during normal business hours in the FCC Reference Center (Room CY-A257... and supported statements. I. Notice of Proposed Rulemaking (Further NPRM) A. Definition of Terms... definitions for ``power'' in its RF-exposure related rules, it is proposing explicit and consistent power...
77 FR 468 - Revision of the Commission's Program Carriage Rules
2012-01-05
... the following methods: Federal eRulemaking Portal: http://www.regulations.gov . Follow the... business hours in the FCC Reference Center, Portals II, 445 12th Street SW., Room CY-A257, Washington, DC... (``NCTA''), Media Access Project, and Public Knowledge filed a joint request to extend the reply comment...
African Journals Online (AJOL)
dell
little or no significant behavioral change. This research is further aimed to bridge this gap. Concerning .... Posters. No. 63. 10. 4. 5. 82. 53.9. As it can be seen in table 4, the most widely used .... words only 25.7% of the respondents take in to ...
Tosten, Rasim; Avci, Yunus Emre; Sahin, Erhan
2018-01-01
The main purpose of this research is to examine the relationship between levels of organizational happiness and organizational socialization of physical education and sport teachers. The research is quantitative and correlational model. The population of the research is composed of 257 physical education and sports teachers working in Siirt…
78 FR 38227 - Connect America Fund
2013-06-26
... and reviewed publicly available data sources to ensure that the particular locations it plans to serve... for public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445... make broadband-capable networks available to as many unserved locations as possible in those areas. In...
Prevalence of Sexual Activity and Outcome among Female ...
African Journals Online (AJOL)
Sexual activity among 534 Nigerian female secondary school students was studied using self-administered questionnaire. Prevalence of sexual intercourse was 25.7%. There was no significant difference between the junior (48.2%) and senior (51.8%) students (p > 0.05). Seventeen (12.4%) students had initiated sexual ...
New Fellows and Honorary Fellow
Indian Academy of Sciences (India)
Fellow Profile. Elected: 1975 Section: General Biology. Maitra, Prof. Pabitra Kumar D.Phil. (Calcutta), FNA. Date of birth: 1 November 1932. Date of death: 4 September 2007. Specialization: Biochemistry, Molecular Biology and Genetics Last known address: CJ-257, Salt Lake, Kolkata 700 091. YouTube; Twitter; Facebook ...
Transvesical prostatectomy in the management of benign prostatic ...
African Journals Online (AJOL)
2014-06-02
Jun 2, 2014 ... only occurred in 76 patients (25.7%); acute urinary retention was seen in 106 patients (35.7%). Chronic ... prostatic hyperplasia (BPH) is a common problem in the ... of the drugs, open prostatectomy or transurethral resection .... Storage LUTS. 37 ... there was paucity of data about prostatectomy specimen.
The religious lives of students at a South African university
African Journals Online (AJOL)
2016-04-08
Apr 8, 2016 ... homosexual people (Altemeyer & Hunsberger 1992). Other .... Furthermore, results show that this scale represents a reliable measure ... services on the radio or television, taking part in religious or rituals and fasting ...... African Americans', Journal of Psychology and Theology 33(4), 251–257. Van Breda ...
Czech Academy of Sciences Publication Activity Database
Sozer, O.; Komenda, Josef; Ughy, B.; Domonkos, I.; Laczkó-Dobos, H.; Malec, P.; Gombos, Z.; Kis, M.
2010-01-01
Roč. 51, č. 5 (2010), s. 823-835 ISSN 0032-0781 R&D Projects: GA AV ČR IAA400200801 Institutional research plan: CEZ:AV0Z50200510 Keywords : Carotenoidless mutant * crtB * Membrane protein synthesis Subject RIV: EE - Microbiology, Virology Impact factor: 4.257, year: 2010
2011-11-22
... be convenient--during regular business hours. Making the information available online will provide 24... in an online public file to be hosted on the Commission's Web site. DATES: Comments for this... business hours in the FCC Reference Center, Federal Communications Commission, 445 12th Street SW., CY-A257...
African Journals Online (AJOL)
Items 201 - 250 of 257 ... Vol 30 (2001), The effects of unavailability of technical storage facilities to the marketing of fruits and vegetables for economic development in Morogoro .... Vol 42, No 2 (2014), Towards assessing managerial competencies and leadership styles required for successful game ranch management in the ...
Czech Academy of Sciences Publication Activity Database
Hlobil, Ivo
2013-01-01
Roč. 61, č. 3 (2013), s. 257-267 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.umeni-art.cz/cz/default.aspx
Social Appraisal of Adult ADHD: Stigma and Influences of the Beholder's Big Five Personality Traits
Canu, Will H.; Newman, Matthew L.; Morrow, Tara L.; Pope, Daniel L. W.
2008-01-01
Objective: This study investigates social stigma associated with a diagnosis of ADHD in adulthood and whether Big Five personality traits predict appraisals of affected individuals. Method: A sample of 257 undergraduates rate the desirability of targets with ADHD, minor medical problems, and with no appreciable weakness, across several social…
Stevens, Gail Flint
1993-01-01
Assessed differences between inmates (n=381) diagnosed antisocial personality and inmates (n=257) with other diagnoses. Found that inmates diagnosed antisocial personality did not differ from other diagnosed inmates in terms of background characteristics, except race, but did differ in terms of criminal histories. Findings suggest that standards…
A radiographic study of nasopalatine duct cysts
Energy Technology Data Exchange (ETDEWEB)
Jun, Chan Duck; Hwang, Eui Hwan; Lee, Sang Rae [Dept. of Oral Radiology, College of Dentistry, Kyung Hee University, Seoul (Korea, Republic of)
1993-02-15
The purpose of this study was to evaluate the clinical and radiographic features of 35 cases of nasopalatine duct cyst by means of the analysis of periapical and/or occlusal radiograms in 35 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chonbuk National University. The obtained results were as follows: 1. The incidence of nasopalatine duct cysts was higher in males (74.3%) than in females (25.7%). 2. The nasopalatine duct cysts were the most frequently occurred in the 4th decades (34.3%). The 6th and 7th decades (17.1%, 17.1%) were next in order to frequency followed by the 5th decades (14.3%), the 3rd decades (8.6%), the 2nd decades (5.7%), and 8th decades (2.9%). 3. In the signs and symptoms of nasopalatine duct cysts, 25.7% were swelling, 17.1% were swelling and tenderness, 20.0% were swelling and pain, and 37.2% were a symptom. 4. In the shape of nasopalatine duct cysts, 40.0% were round type, 48.6% 11.8% were heart type. 5. In symmetry of the nasopalatine duct cysts, 11.4% were 6-10 mm, 48.6% were 11-20 mm, 25.7% were 21-30 mm, and 14.3% were 31-40 mm. 6. In the periphery of nasopalatine duct cysts, 82.9% were distinct, 17.1% were relatively distinct. 7. In the change of root, 51.5% were intact, 17.1% were root divergence, 20.0% were root resorption, and 11.4% were root divergence and resorption.
A radiographic study of nasopalatine duct cysts
International Nuclear Information System (INIS)
Jun, Chan Duck; Hwang, Eui Hwan; Lee, Sang Rae
1993-01-01
The purpose of this study was to evaluate the clinical and radiographic features of 35 cases of nasopalatine duct cyst by means of the analysis of periapical and/or occlusal radiograms in 35 persons visited the Department of Oral and Maxillofacial Radiology, School of Dentistry, Kyung Hee University and Chonbuk National University. The obtained results were as follows: 1. The incidence of nasopalatine duct cysts was higher in males (74.3%) than in females (25.7%). 2. The nasopalatine duct cysts were the most frequently occurred in the 4th decades (34.3%). The 6th and 7th decades (17.1%, 17.1%) were next in order to frequency followed by the 5th decades (14.3%), the 3rd decades (8.6%), the 2nd decades (5.7%), and 8th decades (2.9%). 3. In the signs and symptoms of nasopalatine duct cysts, 25.7% were swelling, 17.1% were swelling and tenderness, 20.0% were swelling and pain, and 37.2% were a symptom. 4. In the shape of nasopalatine duct cysts, 40.0% were round type, 48.6% 11.8% were heart type. 5. In symmetry of the nasopalatine duct cysts, 11.4% were 6-10 mm, 48.6% were 11-20 mm, 25.7% were 21-30 mm, and 14.3% were 31-40 mm. 6. In the periphery of nasopalatine duct cysts, 82.9% were distinct, 17.1% were relatively distinct. 7. In the change of root, 51.5% were intact, 17.1% were root divergence, 20.0% were root resorption, and 11.4% were root divergence and resorption.
The 257 MeV 19/2/sup -/ two-phonon octupole state in /sup 147/Gd
Kleinheinz, P; Kortelahti, M; Piiparinen, M; Styczen, J
1981-01-01
The half-life of the (vf/sub 7/2/*3/sup -/*3/sup -/)/sub 19/2-/ two- phonon octupole states at 2.572 MeV in /sup 147/Gd was measured as T /sub 1/2/=0.37(8) ns, which gives a transition strength of 52(15) WU for the 1525 keV E3 transition to the 0.997 MeV (vf/sub 7/2/*3/sup -/) /sub 13/2+/ one transition to the 0.997 MeV ( nu f/sub 7/2/*3/sup -/) /sub 13/2+/ one phonon excitation. The nu i/sub 13/2/ admixture in the 13/2/sup +/ one-phonon state, as well as the dominant pi h/sub 11/2/d /sub 5//sup -1/2/ component of the /sup 146/Gd 3/sup -/ state give rise to large anharmonicities for the two-phonon excitation. An estimate of the energy shifts based on empirical coupling matrix elements gives 2.66 MeV excitation for the 19/2/sup -/ two-phonon state, in good agreement with the observed energy of that state. (9 refs).
2010-12-14
... Pearson 1972, pp. 254-257). Litters are born from mid-February through March, containing one to five kits... several reasons. Wolverines tend to live in remote and inhospitable places away from human populations... human population density and the lack of suitable habitat suggests that wolverines did not exist in this...
Reconstruction of Acute Traumatic Tibial Fractures with the Ilizarov ...
African Journals Online (AJOL)
The average time for application of the apparatus to fracture healing was 4.3 months. One fracture required autogenous bone graft for union. One patient is undergoing callus transportation for bone replacement. The most common complication was pin tract infection seen in nine (25.7%) patients. Conclusion: We treated 35 ...
Czech Academy of Sciences Publication Activity Database
Řápková, R.; Holý, P.; Vyskočil, V.; Podešva, Jiří; Drašar, P.
2018-01-01
Roč. 112, č. 4 (2018), s. 257-261 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : chemical structures * recommendations, graphical Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/ojs3/index.php/chemicke-listy/article/ view /3071
Scoping Report: AI-Driven Wargame Replicator
2010-12-01
Connectionist Learning with Adaptive Rule Induction On-line (CLARION) CLARION, with its root in neural networks, is a hybrid architecture that incorporates...www.dsto.defence.gov.au/publications/2655/DSTO-TN-0534.pdf. [257] Stokes, A.E. and Kite, K. (2000). Op grasping a nettle and becoming emotional. In Peter A
African Journals Online (AJOL)
Items 1 - 50 of 257 ... Vol 42, No 2 (2014), A comparative analysis of two land reform models: The Mashishimale Farm Management Model and the Nkumbuleni Strategic ... Vol 43, No 2 (2015), Adapted SERVQUAL for evaluating the provision of information as an agricultural extension service in South Africa, Abstract PDF.
Issues of Anger in the Workplace: Do Gender and Gender Role Matter?
Gianakos, Irene
2002-01-01
To examine the influence of gender and gender role on anger experiences in the workplace, 257 adult students completed narratives describing their anger-provoking issues and anger expression. Analyses revealed that gender did not influence the types of issues cited or workers' anger expressions. (Contains 39 references and an appendix.) (GCP)
Search Results | Page 21 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 201 - 210 of 257 ... Farm to fork—improving eating habits and nutrition education in the Caribbean ... The high and growing incidence of obesity among young children and adolescents is ... Garbage separation: a livelihood option for poor men and women ... Improving food security in Latin America and the Caribbean ...
Search Results | Page 19 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 181 - 190 of 257 ... The IDRC-supported “Labour markets for inclusive growth” project, coordinated by the Centre for Distributive Labor and Social Studies (CEDLAS) at Universidad Nacional de La Plata in Argentina, is generating rigorous and policy-relevant evidence on how labour markets and social protection work ...
Czech Academy of Sciences Publication Activity Database
Sheshko, Valeria; Hejnová, Jana; Řeháková, Z.; Šinkora, J.; Faldyna, M.; Alexa, P.; Felsberg, Jürgen; Němcová, R.; Bomba, A.; Šebo, Peter
2006-01-01
Roč. 48, - (2006), s. 257-266 ISSN 0928-8244 R&D Projects: GA ČR GA523/03/0186 EU Projects: European Commission(XE) 503240 - MUVAPRED Institutional research plan: CEZ:AV0Z50200510 Keywords : escherichia coli * haemolysin * colonization Subject RIV: EE - Microbiology, Virology Impact factor: 2.281, year: 2006
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. G Anandalingam. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...
Frequency Rates and Correlates of Contrapower Harassment in Higher Education
DeSouza, Eros R.
2011-01-01
The current study investigated incivility, sexual harassment, and racial-ethnic harassment simultaneously when the targets were faculty members and the perpetrators were students (i.e., academic contrapower harassment; ACH). The sample constituted 257 faculty members (90% were White and 53% were women) from a medium-sized state university in the…
Effects of melatonin on ischemia and reperfusion injury of the rat heart
Czech Academy of Sciences Publication Activity Database
Szárszoi, Ondrej; Asemu, Girma; Vaněček, Jiří; Ošťádal, Bohuslav; Kolář, František
2001-01-01
Roč. 15, č. 3 (2001), s. 251-257 ISSN 0920-3206 R&D Projects: GA ČR GA306/98/0470; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : melatonin * heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.009, year: 2001
Kuter-Luks, Theresa; Heuvelman, Ard; Peters, Oscar
2011-01-01
Despite clear European and Dutch policies about media education, there is currently no media education curriculum in Dutch schools. A survey among preadolescents (n = 257) in six primary schools in the Netherlands included questions regarding media access, fears, risks, parental mediation of television and the internet, and the need for media…
Aksoy Nigar Yildirim Variational problem with complex co-efficient of ...
Indian Academy of Sciences (India)
user1
Abbaspour Mohammad Hassan see Ghaffarzadeh Ghodrat. 329. Abhyankar Shreeram S. Rees valuations. 525. Agarwal A K. seeAnand S. 23. Aithal A R. On the extrema of Dirichlet's first eigen- value of a family of punctured regular polygons in two dimensional space forms. 257. Aksoy Nigar Yildirim. Variational problem ...
78 FR 5750 - Data Specifications for Collecting Study Area Boundaries
2013-01-28
... regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC... reforms adopted as part of the USF/ICC Transformation Order, 76 FR 73830, November 29, 2011. In the USF/ICC Transformation Order, the Commission comprehensively reformed universal service funding for high...
2012-01-11
... public inspection during regular business hours in the FCC Reference Center, Room CY-A257, 445 12th... of the USF/ICC Transformation Order, 76 FR 73830, November 18, 2011. 2. In the USF/ICC Transformation... the USF/ICC Transformation Order, as well as such carriers that had previously obtained ETC...
Cryoseston of the Pirin Mountains, Bulgaria
Czech Academy of Sciences Publication Activity Database
Cepák, Vladislav; Lukavský, Jaromír
2013-01-01
Roč. 72, č. 2 (2013), s. 257-268 ISSN 0365-0588 R&D Projects: GA TA ČR TE01020080; GA TA ČR TA03011027 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlainomonas * Pirin * Bulgaria Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.449, year: 2013
75 FR 39940 - Notice of Debarment; Schools and Libraries Universal Service Support Mechanism
2010-07-13
... business hours at the FCC Reference Information Center, Portal II, 445 12th Street, SW., Room CY-A257... regular business hours at the contractor, Best Copy and Printing, Inc., Portal II, 445 12th Street, SW... civil judgment for attempt or commission of criminal fraud, theft, embezzlement, forgery, bribery...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
pp 257-266 Full Papers ... complexes of rhodium - Synthesis, structure and, spectral and electrochemical properties ... pp 267-273 Full Papers ... pp 275-281 Full Papers ... Yuliang Che Hua Yang Hongxiao Jin Chunxin Lu Ziyang Liu ... Excited state dynamics of 9,9'-bianthryl in room temperature ionic liquids as revealed by ...
Synthesis, crystal structure and DFT calculations of a new Hg (II) metal-organic polymer
Czech Academy of Sciences Publication Activity Database
Mirtamizdoust, B.; Roodsari, M.S.; Shaabani, B.; Dušek, Michal; Fejfarová, Karla
2016-01-01
Roč. 15, č. 3 (2016), s. 257-266 ISSN 1024-1221 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : mercury (II) iodide * coordination polymer * square planar * tetrahedral geometry * density functional calculation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.565, year: 2016
IL-1β level in Sudanese patients with atherosclerotic coronary heart ...
African Journals Online (AJOL)
McRoy
studies investigating inflammatory cytokines in atherosclerotic patients with coronary heart disease (CHD).[2,5-7]. However, systemic level of IL-1β may still be unreliable marker for atherosclerosis. This is because systemic level of IL-1β could not faithfully reflect the local inflammatory process near the atheromatous lesions.
Czech Academy of Sciences Publication Activity Database
Wahab, Abdul; Kvapilová, Hana; Klíma, Jiří; Michl, Josef; Ludvík, Jiří
2013-01-01
Roč. 689, JAN 2013 (2013), s. 257-261 ISSN 1572-6657 R&D Projects: GA MŠk ME09002; GA ČR GC203/09/J058 Institutional support: RVO:61388955 ; RVO:61388963 Keywords : isoflurane * relative permitivity * icosahedral carborane anions Subject RIV: CG - Electrochemistry Impact factor: 2.871, year: 2013
Detection of ultra-high energy cosmic ray showers with a single-pixel fluorescence telescope
Czech Academy of Sciences Publication Activity Database
Fujii, T.; Malacari, M.; Bertaina, M.; Casolino, E.; Dawson, B.; Horváth, P.; Hrabovský, M.; Jiang, J.; Mandát, Dušan; Matalon, A.; Matthews, J.N.; Motloch, P.; Palatka, Miroslav; Pech, Miroslav; Privitera, P.; Schovánek, Petr; Takizawa, Y.; Thomas, S.B.; Trávníček, Petr; Yamazaki, K.
2016-01-01
Roč. 74, Feb (2016), s. 64-72 ISSN 0927-6505 R&D Projects: GA MŠk(CZ) LG13007 Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * fluorescence detector * extensive air shower Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
pp 223-226 Commentary on J. Genet. Classic. Towards a genetic architecture of cryptic genetic variation and genetic assimilation: the contribution of K. G. Bateman · Ian Dworkin · More Details Fulltext PDF. pp 227-257 J. Genet. Classic. The Genetic Assimilation of Four Venation Phenocopies (Published on 1959 J. Genet.
7 CFR 1726.27 - Contractor's bonds.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Contractor's bonds. 1726.27 Section 1726.27... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES General § 1726.27 Contractor's bonds. (a) RUS Form 168b, Contractor's Bond, shall be used when a contractor's bond is required by RUS Forms 200, 257...
Search Results | Page 24 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 231 - 240 of 257 ... Even where quota systems are in place, there has been slow progress in increasing women''s leadership in formal politics, suggesting that a range of ... Results show the power of agroecological practices to improve livelihoods and food security, limited by situations where most agroecological ...
Czech Academy of Sciences Publication Activity Database
Šestáková, Ivana; Mader, P.
2000-01-01
Roč. 46, č. 2 (2000), s. 257-267 ISSN 0145-5680 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.449, year: 2000
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Surabhi Potnis. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 3 March 2017 pp 257-268 General Article. From Carbon to Buckypaper · Surabhi Potnis · More Details Abstract Fulltext PDF. This article aims to highlight the amazing ...
Wright, Caroline Vaile; Collinsworth, Linda L.; Fitzgerald, Louise F.
2010-01-01
Many trauma researchers have proposed cognitive schemas as a heuristic device to understand the elusive process of integrating traumatic events. We examined the schemas of a sample (N = 257) of female participants classified by exposure to sexual trauma, nonsexual trauma, and no trauma experience. Cognitive schema was assessed with the Traumatic…
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. P Chatterjee. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 251-257 Experimental Techniques. Voigt modelling of size–strain analysis: Application to -Al2O3 prepared by combustion technique · K Santra P Chatterjee S P Sen Gupta.
Search Results | Page 18 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 171 - 180 of 257 ... ... Safe and Inclusive Cities 1 Apply Safe and Inclusive Cities filter · Technology ... Regional Dialogue on the Information Society Network (Latin ... engaged in international cooperation for development but don't have ... The study's author, Stacie Travers, also carried out four case studies on Canadian ...
Effect of different treatments of copper surface on its total hemispherical absorptivity bellow 77 K
Czech Academy of Sciences Publication Activity Database
Musilová, Věra; Králík, Tomáš; Hanzelka, Pavel; Srnka, Aleš
2007-01-01
Roč. 47, č. 4 (2007), s. 257-261 ISSN 0011-2275 R&D Projects: GA AV ČR IBS2065109 Institutional research plan: CEZ:AV0Z20650511 Keywords : metals * structural materials * heat transfer * radiant properties * cryostats Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.981, year: 2007
1957-01-01
R. H. Morgan, "Screen Intensification Systems and Their Lirnita- tions," Amtvican J w n u l of Roenlgenology and Radizcm Therapy , Vol. LXII, No...443. (1 10) Kurt Matthaes, " Magneto -Inductive Testing of Stcel," Zeitschrgt filr Melnll- kunde, Vol. 39, September, 1948, p]). 257- 272. (1 11
Czech Academy of Sciences Publication Activity Database
Herrera-Alonso, J. M.; Sedláková, Zdeňka; Marand, E.
2010-01-01
Roč. 349, 1-2 (2010), s. 251-257 ISSN 0376-7388 R&D Projects: GA AV ČR KAN100500651; GA MŠk ME09058 Institutional research plan: CEZ:AV0Z40500505 Keywords : barrier membranes * nanocomposites * montmorillonite Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.673, year: 2010
Dynamický impaktní test – unikátní metoda analýzy ochranných vrstev
Czech Academy of Sciences Publication Activity Database
Fořt, Tomáš; Grossman, Jan; Sobota, Jaroslav; Daniel, Josef
2017-01-01
Roč. 62, č. 10 (2017), s. 257-260 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : dynamical impact test * thin films * protective coatings * wear-resistance * fatigue tests Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Audio engineering, reliability analysis
Trematode diversity in freshwater fishes of the Globe I: ‘Old World’
Czech Academy of Sciences Publication Activity Database
Scholz, Tomáš; Besprozvannykh, V. V.; Boutorina, T.E.; Choudhury, A.; Cribb, T.H.; Ermolenko, A. V.; Faltýnková, Anna; Shedko, M.B.; Shimazu, T.; Smit, N.J.
2016-01-01
Roč. 93, č. 3 (2016), s. 257-269 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR GA15-14198S Institutional support: RVO:60077344 Keywords : life cycle * Digenea * parasite communite Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016
Czech Academy of Sciences Publication Activity Database
Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk
2014-01-01
Roč. 65, č. 4 (2014), s. 257-271 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP -MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014
Victor, Akinfolarin Akinwale
2017-01-01
This study analyses principals' managerial competencies for effective management of school resources in secondary schools in Anambra State. The study was conducted in Anambra State. The study population comprised 257 principals in public secondary schools in the State. The study adopted a descriptive survey design. A 24 items researcher developed…
78 FR 64404 - Next Generation 911; Text-to-911; Next Generation 911 Applications
2013-10-29
... business hours in the FCC's Reference Information Center at Portals II, CY-A257, 445 12th Street SW... provider. CTIA claims that in current network architecture for Short Message Service (SMS) texting, only... consumer. Changes to this architecture, T-Mobile argues, are ``simply not feasible.'' T-Mobile opines that...
1988-10-12
Ver- teneuil, Brussels. 257 pp. + 5 pls. Forattini, 0. P. 1965. Entomologia Medica. 2” Vol- ume_ Editora da Universidade de Sao Paulo. 506 PP...Publica, Boletines T&r& cos, Serie A: Entomologia Medica y Parasitologia No. 1. 66 pp. Matheson, R. 1944. Handbook of the Mosquitoes of North America
Anxiety and Depression in Breast Cancer Survivors of Different Sexual Orientations
Boehmer, Ulrike; Glickman, Mark; Winter, Michael
2012-01-01
Objective: We conducted a study comparing anxiety and depression by sexual orientation in long-term breast cancer survivors, testing the hypothesis that sexual minority women (e.g., lesbian and bisexual women) have greater levels of anxiety and depression. Method: From a state cancer registry, we recruited 257 heterosexual and 69 sexual minority…
Differences in Students' School Motivation: A Latent Class Modelling Approach
Korpershoek, Hanke; Kuyper, Hans; van der Werf, Greetje
2015-01-01
In this study, we investigated the school motivation of 7,257 9th grade students in 80 secondary schools across the Netherlands. Using a multiple goal perspective, four motivation dimensions were included: performance, mastery, extrinsic, and social motivation. Our first aim was to identify distinct motivation profiles within our sample, using the…
Savi Cakar, Firdevs; Karatas, Zeynep
2012-01-01
In this study, a developed model to explain a causal relationship between adolescent's self-esteem, perceived social support and hopelessness is tested. The purpose of the study is to explore the relationship between self-esteem, perceived social support and hopelessness in adolescents. A total of 257 adolescents, including 143 female and 114…
47 CFR 90.238 - Telemetry operations.
2010-10-01
... MHz band (as available in the Public Safety Pool for bio-medical telemetry operations). (i) For... with § 90.257 and subject to the rules governing the use of that band). (b) 154.45625, 154.46375, 154...-470 MHz band, telemetry operations will be authorized on a secondary basis with a transmitter output...
Impact of Calcium and Two Doses of Vitamin D on Bone Metabolism in the Elderly
DEFF Research Database (Denmark)
Rahme, Maya; Sharara, Sima Lynn; Baddoura, Rafic
2017-01-01
The optimal dose of vitamin D to optimize bone metabolism in the elderly is unclear. We tested the hypothesis that vitamin D, at a dose higher than recommended by the Institute of Medicine (IOM), has a beneficial effect on bone remodeling and mass. In this double-blind trial we randomized 257 ove...
The pig as an experimental model for clinical craniofacial research
Czech Academy of Sciences Publication Activity Database
Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela
2012-01-01
Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012
Functioning Before and After Total Hip or Knee Arthroplasty
I.B. de Groot (Ingrid)
2009-01-01
textabstractOsteoarthritis (OA) of the hip or knee is a common locomotor disease characterized by degradation of articular cartilage. In the Netherlands, in the year 2000 about 257,400 persons above the age of 55 years had hip OA and about 335,700 persons had knee OA. Because the prevalence of OA
Search Results | Page 9 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 81 - 90 of 257 ... Home; West Indies ... Middle East 261 Apply Middle East filter · United Kingdom 108 Apply .... and monitors the progress made by different countries over time, as well as ... This supplement contains working papers distributed prior to the ... related to small-scale fisheries and coastal management in th.
Czech Academy of Sciences Publication Activity Database
Mikolajczyk, M.; Toman, Petr; Bartkowiak, W.
2010-01-01
Roč. 485, 1-3 (2010), s. 253-257 ISSN 0009-2614 R&D Projects: GA MŠk MEB050815; GA AV ČR IAA401770601 Institutional research plan: CEZ:AV0Z40500505 Keywords : triphenylene * charge carrier mobility * tight-binding approximation Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.282, year: 2010
Low temperature delayed recombination decay in complex oxide scintillating crystals
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Jarý, Vítězslav; Schulman, L. S.; Nikl, Martin
2014-01-01
Roč. 61, č. 1 (2014), 257-261 ISSN 0018-9499 R&D Projects: GA MŠk LH12150; GA MŠk LH12185 Grant - others:AVČR(CZ) M100101212 Institutional support: RVO:68378271 Keywords : luminescence * oxides * scintillator * tunneling Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.283, year: 2014
Czech Academy of Sciences Publication Activity Database
Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk
2006-01-01
Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006
Transfer to hospital in planned home births
DEFF Research Database (Denmark)
Blix, Ellen; Kumle, Merethe; Kjærgaard, Hanne
2014-01-01
was chosen. RESULTS: Fifteen studies were eligible for inclusion, containing data from 215,257 women. The total proportion of transfer from home to hospital varied from 9.9% to 31.9% across the studies. The most common indication for transfer was labour dystocia, occurring in 5.1% to 9.8% of all women...
Levels of Satisfaction with Leisure Time in Foreign Students
Akdeniz, Hakan; Simsek, Sinem Didem; Kavi, Onur; Uzuner, Muhammet Eyup; Sekban, Gulsah
2018-01-01
The aim of this study was to investigate levels of satisfaction with leisure time in foreign students of Kocaeli University. In the collection of the data, the Leisure Satisfaction Scale (LSS) and demographic status questionnaire were used; 257 male and 103 female students participated. In the LSS scores for the separate domains, participants…
Maximum entropy analysis of cosmic ray composition
Czech Academy of Sciences Publication Activity Database
Nosek, D.; Ebr, Jan; Vícha, Jakub; Trávníček, Petr; Nosková, J.
2016-01-01
Roč. 76, Mar (2016), s. 9-18 ISSN 0927-6505 R&D Projects: GA ČR(CZ) GA14-17501S Institutional support: RVO:68378271 Keywords : ultra-high energy cosmic rays * extensive air showers * cosmic ray composition Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.257, year: 2016
Histopathology of carp (Cyprinus carpio L.) larvae exposed to Cyanobacteria extract
Czech Academy of Sciences Publication Activity Database
Palíková, M.; Navrátil, S.; Tichý, F.; Štěrba, F.; Maršálek, Blahoslav; Bláha, L.
2004-01-01
Roč. 73, - (2004), s. 253-257 ISSN 0001-7213 R&D Projects: GA AV ČR KSK6005114; GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z6005908 Keywords : microcystins * embryo-larval test * liver damage Subject RIV: EF - Botanics Impact factor: 0.449, year: 2004
2010-08-04
... some point in the future and a prediction from the updated model indicates that the location can..., to ``develop and prescribe by rule a point-to-point predictive model for reliably and presumptively... business hours in the FCC Reference Center (Room CY-A257), 445 12th Street, SW., Washington, DC 20554. The...
Optimizing Cognitive Load for Learning from Computer-Based Science Simulations
Lee, Hyunjeong; Plass, Jan L.; Homer, Bruce D.
2006-01-01
How can cognitive load in visual displays of computer simulations be optimized? Middle-school chemistry students (N = 257) learned with a simulation of the ideal gas law. Visual complexity was manipulated by separating the display of the simulations in two screens (low complexity) or presenting all information on one screen (high complexity). The…
76 FR 30605 - Assessment and Collection of Regulatory Fees For Fiscal Year 2011
2011-05-26
..., 1999). The Small Business Act contains a definition of ``small-business concern,'' which the RFA incorporates into its own definition of ``small business.'' See 15 U.S.C. 632(a) (``Small Business Act''); 5 U... during normal business hours in the FCC Reference Center, 445 Twelfth Street, SW., Room CY-A257, Portals...
University Students' Views of a Public Service Graduation Requirement
Moely, Barbara E.; Ilustre, Vincent
2011-01-01
As New Orleans began to rebuild after Hurricane Katrina, Tulane University also began its recovery process. A new initiative in the recovery was the establishment of a public service graduation requirement for undergraduate students. Attitudes toward the requirement were assessed for 290 first-year and 257 advanced students in fall 2006. The…
Differences in the Morale of Older, Rural Widows and Widowers.
Scott, Jean Pearson; Kivett, Vira R.
1985-01-01
Examined effect of sex differences on morale of 257 older rural widows and widowers. Sex of respondent was not found to affect morale; however, perceived financial status and self-rated health had significant direct effects. Widows and widowers reporting higher morale had higher perceived financial status and rated their health as good.…
2015-07-13
dimensional simulations were performed using the unsteady ignition and combustion with reactions ( UNICORN ) model [28,33–36]. UNICORN only requires the inflow...Katta VR. 1998 Role of flow visualization in the development of UNICORN . J. Vis. 2, 257–272. (doi:10.1007/BF03181442) 34. Katta VR, Goss LP, Roquemore WM
Effect of nifedipine, imipramine and sertraline on the antidepressant ...
African Journals Online (AJOL)
DR ORIAFOH
2012-06-28
Jun 28, 2012 ... Ann. Nuclear Med. 11(3): 213-218. Kozisek ME, Middlemas D, Bylund DB (2008). The differential regulation of BDNF and TrkB levels in juvenile rats after four days of escitalopram and desipramine treatment. Neuropharmacol. 54(2):. 251-257. Kreydiyyeh SI (2000). Cyclic AMP and furosemide stimulate the ...
2013-01-11
...., observed sales and purchases). This allows for an analysis that controls for factors that may vary widely... those factors that affect providers' decisions to expand existing networks, e.g., the non-price factors... Street SW., Room CY-A257, Washington, DC 20554. The complete text may be purchased from Best Copy and...
2013-11-08
... characteristics of the purchased service; and (4) other factors that influence the pricing decisions of special..., 445 12th Street SW., Room CY-A257, Washington, DC 20554. The complete text may be purchased from Best... competition and pricing decisions. Under each category, most of which would be collected from Providers, the...
Comité Scientifique de la Revue des Sciences et de la Technologie ...
African Journals Online (AJOL)
MICROSIM
Ecological Indicators,1, 261 – 270. [11] Wekbeker G. & Cory G., 1988. Robo nucleotide reductase activity and growth of glutathione depleted mouse leukemia 1210 cells in vitro. Cancer letters, 40, 257 – 264. [12] Bradford M., 1976. A rapid and sensitive method for the quantification of microgram quantities of protein utilizing ...
Czech Academy of Sciences Publication Activity Database
Mushnikov, N. V.; Rozenfeld, E.V.; Gorbunov, Denis; Andreev, Alexander V.
2014-01-01
Roč. 115, č. 3 (2014), s. 257-267 ISSN 0031-918X R&D Projects: GA ČR GAP204/12/0150 Institutional support: RVO:68378271 Keywords : rare- earth intermetallic compounds * ferrimagnetism * compensation temperature * magnetic anisotropy * magnetic phase transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.761, year: 2014
Program DEIMOS32 for gamma-ray spectra evalution
Czech Academy of Sciences Publication Activity Database
Frána, Jaroslav
2003-01-01
Roč. 257, č. 3 (2003), s. 583-587 ISSN 0236-5731. [International Conference Ko-users Workshop /3./. Bruges, 23.09.2001-28.09.2001] Institutional research plan: CEZ:AV0Z1048901 Keywords : gamma-ray spectra * software Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.472, year: 2003
Mesoporous molecular sieves as advanced supports for olefin metathesis catalysts
Czech Academy of Sciences Publication Activity Database
Balcar, Hynek; Čejka, Jiří
2013-01-01
Roč. 257, 21-22 (2013), s. 3107-3124 ISSN 0010-8545 R&D Projects: GA AV ČR IAA400400805; GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : Olefin metathesis * mesoporous molecular sieves * Heterogeneous catalysts Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 12.098, year: 2013
Author Impact Metrics in Communication Sciences and Disorder Research
Stuart, Andrew; Faucette, Sarah P.; Thomas, William Joseph
2017-01-01
Purpose: The purpose was to examine author-level impact metrics for faculty in the communication sciences and disorder research field across a variety of databases. Method: Author-level impact metrics were collected for faculty from 257 accredited universities in the United States and Canada. Three databases (i.e., Google Scholar, ResearchGate,…
Hall, Katrina W.; Williams, Lunetta M.; Daniel, Larry G.
2010-01-01
The present study investigated perceived effects of an afterschool program located in 6 Title 1 schools on students' achievement, self-esteem, and attitudes. Data sources comprised surveys (n = 257), 5 focus groups (n= 23), and an individual interview with the program director (n = 1). Survey data indicated overall satisfaction with the program.…
Statistical analysis and optimization of copper biosorption capability ...
African Journals Online (AJOL)
These three variables were further adopted by the three-level Box– Behnken design to correlate between the three variables and to estimate the optimal conditions required for Cu2+ biosorption. Although the maximum value for Cu2+ biosorption was 85%, the calculated optimum percentage was 72%, which was a 2.57-fold ...
Search Results | Page 10 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 91 - 100 of 257 ... Enhanced Preservation of Fruits Using Nanotechnology (CIFSRF Phase 2). Poor handling of fruit results in post-harvest losses of nearly 40% in tropical ... New research aims to help control malaria in one watershed in northern Peru. Malaria is widespread in Peru's arid North Coast because of the ...
U-Pb and Rb-Sr geochronology of the Wedgeport granitoid pluton, southwestern Nova Scotia
International Nuclear Information System (INIS)
Cormier, R.F.; Keppie, J.D.; Odom, A.L.
1988-01-01
Zircons from biotite monzogranite of the Wedgeport Pluton, intrusive into deformed metasediments of the Cambrian(?) Goldenville formation in the southwestern Meguma Terrane of Nova Scotia, yield concordant U-Pb ages of 316 ± 5 Ma. This is interpreted as the time of intrusion and crystallization. Within the error limits, the 323 ± 0.0056 Rb-Sr analyses of mineral separates of biotite, potassium feldspar, and quartz-plagioclase from several samples yield subparallel, internal isochrons with an average age of 257 ± 8 Ma. Initial ratios of the internal isochrons range from 0.716 to 0.759. A slow-cooling model for the latter data is discarded because the mineral data fall on straight lines. Instead, a reheating event related to plutonism ca 257 Ma ago, which was sufficient to cause local grain-to-grain migration and reequilibration of strontium and rubidium but not large-scale redistribution, is invoked. This reheating is also inferred to be responsible for the hydrothermal alteration and Sn-U mineralization concentrated along the northwestern margin of the pluton. A dextral northeast-southeast shear zone cutting the pluton is also inferred to be ca. 257 Ma old. It may be related to the last stages of westward abduction of the Meguma Terrane. These results provide a clear example of Permo-Carboniferous plutonism in the southwestern Meguma Terrane and suggest a similar interpretation may apply to other anomalously young ages recorded in this area. In light of these results, the Permo-Carboniferous age of the large East Kemptville tin deposit and its location in a dextral shear zone suggest that the association of younger plutonism and shear zones may be a significant factor for economic mineralization. (22 refs., 4 tabs., 3 figs.)
Hydraulic performance of locally made LDPE-Pipes for drip irrigation systems
International Nuclear Information System (INIS)
Aslam, M.; Mangrio, A.G.; Ibrar, S.U.
2007-01-01
LDPE pipes give controlled and efficient irrigation practices for plant-water requirement. All five sizes of pipes i.e. 13.0, 25.7, 31.5, 38 and 50 mm with wall thicknesses of 1.4, 1.8, 2.0, 2.5 and 3.0 mm respectively in 100 and 200 m lengths were selected for determination of pressure-discharge relationships, manufacturing coefficient of variation and friction coefficient. The pipes were operated at pressure ranging from 10 to 50 psi (7.00 -35.00 meter head) with an increment of 5 psi. The discharge of different sizes of LDPE pipes was measured under various pressures. The average discharge of the pipes with 13.0, 25.7, 31.5, 38 and 50 mm pipe sizes between 10 to 50 psi pressure heads were 0.058, 0.301, 0.402, 0.909 and 2.076 lps respectively for 100 meter pipe length and 0.056, 0.10, 0.13, 0.45 and 1.993 lps respectively for 200 meter pipe length. The average friction head loss of the pipes with 13.0, 25.7, 31.5, 38 and 50 mm pipe sizes between 10 to 50 psi pressure heads were 3.21, 2.51, 1.66, 3.99 and 3.64 meter per 100 meter pipe length and 6.44, 5.03, 3.15, 6.79 and 6.85 meter per 200 meter pipe length respectively. The average C-value of all sizes of selected pipes for both lengths between 10-50 psi was indicated 18% less than the recommend value. Results indicated that the discharge, friction head losses and friction coefficient increased with the increase in pressure. This study helped describe the optimal pressure requirement to achieve the desirable discharge low friction head losses and minimum friction coefficients. (author)
Peng, Christine Y S; Zhou, Xinsheng; Kaya, Harry K
2002-11-01
The Varroa mite, Varroa destructor, is recognized as the most serious pest of both managed and feral Western honey bee (Apis mellifera) in the world. The mite has developed resistance to fluvalinate, an acaricide used to control it in beehives, and fluvalinate residues have been found in the beeswax, necessitating an urgent need to find alternative control measures to suppress this pest. Accordingly, we investigated the possibility of using the fungus, Hirsutella thompsonii, as a biocontrol agent of the Varroa mite. Among the 9 isolates of H. thompsonii obtained from the University of Florida and the USDA, only the 3 USDA isolates (ARSEF 257, 1947 and 3323) were infectious to the Varroa mite in laboratory tests. The mite became infected when it was allowed to walk on a sporulating H. thompsonii culture for 5 min. Scanning electron micrographs revealed that the membranous arolium of the mite leg sucker is the focus of infection where the fungal conidia adhered and germinated. The infected mites died from mycosis, with the lethal times to kill 50% (LT(50)s) dependent on the fungal isolates. Thus, the LT(50)s were 52.7, 77.2, and 96.7h for isolates 3323, 257, and 1947, respectively. Passage of H. thompsonii through Varroa mite three times significantly reduced the LT(50)s of isolates 257 and 1947 (P<0.05) but not the LT(50) of isolate 3323. The fungus did not infect the honey bee in larval, prepupal, pupal, and adult stages under our laboratory rearing conditions. Our encouraging results suggest that some isolates of H. thompsonii have the potential to be developed as a biocontrol agent for V. destructor. However, fungal infectivity against the mites under beehive conditions needs to be studied before any conclusion can be made.
Directory of Open Access Journals (Sweden)
Núñez-Torres Oscar Patricio
2017-04-01
Full Text Available The research was carried out in Ecuador, in the province of Tungurahua, Cevallos county. A comparison of reproductive parameters between the cervical self insemination method and the traditional one in multiparous sows was performed using 12 sows (hybrid females between the second and fourth calving, dividing In two groups of 6 sows respectively, using the insemination protocol 12h - 24h - 36h. Fresh semen was prepared with long-term diluent + bidistilled water, at a concentration of 3 x 109 spermatozoa/mL in total volume per 100 mL straw. At the time of insemination the amount of seminal reflux was determined and when the Student's T test was applied with paired observations in the results, they statistically reported a significant difference at 5% among the evaluated methods, the calculated T value was 9.50 Which is greater than the T of tables at 5% of 2.57. The duration of each method was determined, results that reported similarity between the two methods (15 min. At 21 days post insemination pregnancy was diagnosed by ultrasound and evaluation of no return of heat, results that reported in both methods 100% effectiveness. Subsequently, at the time of delivery, the number of total born piglets was evaluated, using the Student's T-test with paired observations that statistically there was no significant difference at 5% between the two methods, the calculated T value was 0, 14 which is less than the T of tables at 5% of 2.57. We also determined the weight of piglets at birth, reported by Student's t-test with paired observations that there is a statistically significant difference to 5% among the evaluated methods, the calculated T value was 5.17, which is higher than the T Of tables at 5% of 2.57. As for costs there is no considerable difference.
Genotyping-by-sequencing (GBS) was performed on 257 Phytophthora infestans isolates belonging to four clonal lineages to study within-lineage diversity. The four lineages used in the study included US-8 (n=28), US-11 (n=27), US-23 (n=166), and US-24 (n=36), with isolates originating from 23 of the U...
1998-04-25
1991;5:1-14. 85. Kinloch-de Loes S, de Saussure P, Saurat JH, Stalder H, Hirschel B, Perrin LH. Symptomatic primary infection due to human imm...epidemiologic features of primary HIV infection. Ann Intern Med 1996;125:257-64. 17. Kinloch-de Loes S, de Saussure P, Saurat J, Stalder H, Hirschel B, Perrin
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
These results suggest that sexual preference may be influenced in a significant proportion of homosexual men by a biological/genetic factor that also controls direction of hair-whorl rotation. pp 257-263 Research Article. Cloning of a novel gene, Cymg1, related to family 2 cystatins and expressed at specific stages of mouse ...
Czech Academy of Sciences Publication Activity Database
Křesinová, Zdena; Moeder, M.; Ezechiáš, Martin; Svobodová, Kateřina; Cajthaml, Tomáš
2012-01-01
Roč. 46, č. 24 (2012), s. 13377-13385 ISSN 0013-936X R&D Projects: GA TA ČR TA01020804; GA ČR GAP503/10/0408 Institutional support: RVO:61388971 Keywords : WHITE-ROT FUNGI * ENDOCRINE-DISRUPTING CHEMICALS * PERSONAL CARE PRODUCTS Subject RIV: EE - Microbiology, Virology Impact factor: 5.257, year: 2012
Czech Academy of Sciences Publication Activity Database
Kaman, Ondřej; Kuličková, Jarmila; Herynek, Vít; Koktan, Jakub; Maryško, Miroslav; Dědourková, T.; Knížek, Karel; Jirák, Zdeněk
2017-01-01
Roč. 427, Apr (2017), s. 251-257 ISSN 0304-8853 Institutional support: RVO:68378271 ; RVO:68378041 Keywords : magnetic nanoparticles * Mn-Zn ferrite * hydrothermal synthesis * magnetic resonance imaging * transverse relaxivity Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.630, year: 2016
A multiplex set of microsatellite markers for the scarlet rosefinch (Carpodacus erythrinus)
Czech Academy of Sciences Publication Activity Database
Poláková, Radka; Vyskočilová, Martina; Martin, J.-F.; Mays Jr., H. L.; Hill, G. E.; Bryja, Josef; Albrecht, Tomáš
2007-01-01
Roč. 7, č. 6 (2007), s. 1375-1378 ISSN 1471-8278 R&D Projects: GA ČR GA206/06/0851 Grant - others:NSF(US) DEB-0077804 Institutional research plan: CEZ:AV0Z60930519 Keywords : Carpodacus * cross-amplification * heterozygosity * microsatellites Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.257, year: 2007
To Ink or Not to Ink: The Meaning of Tattoos among College Students
Dickson, Lynda; Dukes, Richard L.; Smith, Hilary; Strapko, Noel
2015-01-01
We examine the process of getting a tattoo and its meaning among 195 tattooed and 257 non-tattooed undergraduates. Most tattooed respondents contemplate getting a tattoo for months, get a professional tattoo, can cover it easily, and like it. Respondents acquire first tattoos to represent important role transitions and as a form of identity and…
40 CFR 421.266 - Pretreatment standards for new sources.
2010-07-01
... Subcategory Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of... day Maximum for monthly average mg/troy ounce of precious metals, in the granulated raw material... average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide (total) 0.740 0.296...
2010-07-01
... for any 1 day Maximum for monthly average mg/troy ounce of precious metals, including silver.../troy ounce of precious metals in the granulated raw material Copper 0.819 0.390 Cyanide (total) 0.128 0... Maximum for monthly average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide...
Czech Academy of Sciences Publication Activity Database
Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří
2009-01-01
Roč. 237, č. 3 (2009), s. 249-257 ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009
Directory of Open Access Journals (Sweden)
Diego Símini
2015-01-01
Full Text Available Reseña de Nicola Michelassi y Salomé Vuelta García, Il teatro spagnolo a Firenze nel Seicento. Vol. I: Giacinto Andrea Cicognini, Giovan Battista Ricciardi, Pietro Susini, Mattias Maria Bartolommei, Alinea (Secoli d’Oro, 67; Commedia Aurea Spagnola e Pubblico Italiano, VIII, Florencia, 2013, 257 pp. ISBN: 9788860557865.
Occurrence of Exercise Dependence in a College-Aged Population
Garman, J. F.; Hayduk, D.M.; Crider, D. A.; Hodel, M. M.
2004-01-01
Students (n = 257) were evaluated for scope and commitment to physical activity by use of self-reported data that assessed amount of activity per week and the obligatory or pathological nature of their activity patterns. Exhibiting atypical activity patterns, 21.8% of the students in the sample exercised 360 or more minutes per week and…
Germination, growth and physiological responses of Senegalia ...
African Journals Online (AJOL)
For plants growth and physiological responses, seedlings were individually cultivated in plastic bags (25×12 cm) containing non-sterile soil and watered with four salt solutions (0, 86, 171 and 257 mM NaCl). Four months after the plants' cultivation, the results showed that for all species, the salinity reduced significantly the ...
Surgical decompression for traumatic spinal cord injury in a tertiary ...
African Journals Online (AJOL)
The spectrum of injuries included cervical 27 (77.1%), thoracic 7 (20.0%), and lumbar vertebrae 1 (2.9%). The outcome as measured by Frankel's grade at 6 months after surgery showed improvement in 9 (25.7%) patients following intervention. All patients who presented with Frankel's Grade C and D improved to Grade E ...
Reaching the superlinear convergence phase of the CG method
Czech Academy of Sciences Publication Activity Database
Axelsson, Owe; Karátson, J.
2014-01-01
Roč. 260, č. 260 (2014), s. 244-257 ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451
Hormonal regulation of response to oxidative stress in insects - an update
Czech Academy of Sciences Publication Activity Database
Kodrík, Dalibor; Bednářová, Andrea; Zemanová, Milada; Krishnan, N.
2015-01-01
Roč. 16, č. 10 (2015), s. 25788-25816 E-ISSN 1422-0067 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:60077344 Keywords : adipokinetic hormones (AKH) * AKH gene * anti-oxidative mechanisms Subject RIV: ED - Physiology Impact factor: 3.257, year: 2015 http://www.mdpi.com/1422-0067/16/10/25788
Counterinsurgency in the Philippines. Problems and Prospects
1989-10-01
funds and the farmer-producers in the rural areas are practically begging for start-up funds with which to finance a backyard poultry farm, a cottage...257-70. Burton, Sandra. "Aquino’s Philippines: The Center Holds." Foreign Affairs 65:3 (America and the World 1986): 524-37. Butcher , Scott. U.S
Regioselective alcoholysis of silychristin acetates catalyzed by lipases
Czech Academy of Sciences Publication Activity Database
Vavříková, Eva; Gavezzotti, P.; Purchartová, Kateřina; Fuksová, Kateřina; Biedermann, David; Kuzma, Marek; Riva, S.; Křen, Vladimír
2015-01-01
Roč. 16, č. 6 (2015), s. 11983-11995 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA15-03037S; GA MŠk(CZ) LD14096; GA MŠk LH13097 Institutional support: RVO:61388971 Keywords : acetylation * alcoholysis * lipase Subject RIV: CC - Organic Chemistry Impact factor: 3.257, year: 2015
Kok, S.J.; Isberg, I.C.K.; Gooijer, C.; Brinkman, U.A.T.; Velthorst, N.H.
1998-01-01
Various UV-laser-induced fluorescence detection strategies for capillary electrophoresis (CE) are compared, i.e. two UV-laser systems (a pulsed laser providing up to 25 mW of tunable emission, applied at 280, 290 and 325 nm, and a continuous wave (cw) laser providing up to 100 mW of 257 nm emission)
Maybe it's not Python that sucks, maybe it's my code
CERN. Geneva
2015-01-01
Did you know that in Python integers from -5 to 257 are preallocated? Reusing them 1000 times, instead of allocating memory for a bigger integer, saves a whopping 1 millisecond of code's execution time! Isn't that thrilling? Well, before you get that crazy, learn some basic performance tricks that you can start using today.
Czech Academy of Sciences Publication Activity Database
Sokol, Zbyněk; Mejsnar, Jan; Pop, Lukáš; Bližňák, Vojtěch
2017-01-01
Roč. 194, 15 September (2017), s. 245-257 ISSN 0169-8095 Institutional support: RVO:68378289 Keywords : scale-dependence * forecast * predictability * images * model * rainfall * weather * analogs * motion Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.778, year: 2016 http://www.sciencedirect.com/science/article/pii/S0169809516305142
African Journals Online (AJOL)
Items 51 - 100 of 257 ... Vol 22, No 1 (2012), Awareness and Incidence of Plagiarism among Undergraduates in a Nigerian Private University, Abstract. Y T Babalola. Vol 12, No 2 (2002), Book Publishing Patterns in Uganda: Challenges and Prospects, Abstract. Stephen M. Mutula, Mabel M.T. Nakitto. Vol 15, No 1 (2005), Book ...
2012-10-12
... stricken. Digestive System [ssquf] The ICD-9 heading code 154.8 should have been included for ``malignant... digestive system,'' and ``ill-defined sites within the digestive system'' should be 159.0, 159.8, and 159.9... DEPARTMENT OF HEALTH AND HUMAN SERVICES 42 CFR Part 88 [Docket No. CDC-2012-0007; NIOSH-257] RIN...
International Nuclear Information System (INIS)
Seely, John F.; Boehly, Thomas; Pien, Gregory; Bradley, David
1998-01-01
A two-mirror normal-incidence microscope with multilayer coatings was used to image the soft-x-ray emissions from planar foils irradiated by OMEGA laser beams. The bandpass of the multilayer coatings was centered at a wavelength of 48.3 Angstrom (257-eV energy) and was 0.5 Angstrom wide. Five overlapping OMEGA beams, without beam smoothing, were typically incident on the gold foils. The total energy was 1500 J, and the focused intensity was 6x10 13 Wcm -2 . The 5.8x magnified images were recorded by a gated framing camera at various times during the 3-ns laser pulse. A pinhole camera imaged the x-ray emission in the energy range of >2 keV. On a spatial scale of 10 μm, it was found that the soft-x-ray images at 257 eV were quite uniform and featureless. In contrast, the hard-x-ray images in the energy range of >2 kev were highly nonuniform with numerous features of size 150 μm. copyright 1998 Optical Society of America
Developments for transactinide chemistry experiments behind the gas-filled separator TASCA
Energy Technology Data Exchange (ETDEWEB)
Even, Julia
2011-12-13
synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements
Eating attitudes, body image satisfaction and self-esteem of South ...
African Journals Online (AJOL)
BMI was positively associated with self-esteem (p = 0.01, r = 0.134) and negatively with dieting behaviour in White boys (p = 0.004, r = −0.257), and with lower EAT-26 bulimic and oral control scores in Black boys. In conclusion, the findings highlight ethnic differences and a need to better understand cultural differences that ...
Adeyemi, T. O.
2008-01-01
This article examined teachers' teaching experience and students' learning outcomes in the secondary schools in Ondo State Nigeria. As a correlational survey, the study population comprised all the 257 secondary schools in the State. This population was made up of 147 rural schools and 110 urban schools. It was also made up of 12 single sex…
Candidate gene linkage approach to identify DNA variants that predispose to preterm birth
DEFF Research Database (Denmark)
Bream, Elise N A; Leppellere, Cara R; Cooper, Margaret E
2013-01-01
Background:The aim of this study was to identify genetic variants contributing to preterm birth (PTB) using a linkage candidate gene approach.Methods:We studied 99 single-nucleotide polymorphisms (SNPs) for 33 genes in 257 families with PTBs segregating. Nonparametric and parametric analyses were...... through the infant and/or the mother in the etiology of PTB....
Czech Academy of Sciences Publication Activity Database
D'Ulivo, A.; Dědina, Jiří; Lampugnani, L.; Matoušek, Tomáš
2002-01-01
Roč. 17, č. 3 (2002), s. 253-257 ISSN 0267-9477 R&D Projects: GA ČR GA203/01/0453; GA ČR GA203/98/0754 Institutional research plan: CEZ:AV0Z4031919 Keywords : hydride atomization * hydride generation * atomic absorption spectrometry Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.250, year: 2002
Financial Stress in the Czech Republic: Measurement and Effects on the Real Economy
Czech Academy of Sciences Publication Activity Database
Horváth, Roman; Malega, J.
2017-01-01
Roč. 2017, č. 3 (2017), s. 257-268 ISSN 1210-0455 R&D Projects: GA ČR GA15-10331S Institutional support: RVO:67985556 Keywords : financial stress indicator * vector autoregression * Czech Republic Subject RIV: AH - Economics OBOR OECD: Finance Impact factor: 0.710, year: 2016 http://library.utia.cas.cz/separaty/2017/E/horvath-0466511.pdf
Accommodation, Cafes and Restaurants. Industry Training Monograph No. 8.
Dumbrell, Tom
Australia's accommodation, cafes, and restaurants industry represents more than half of the nation's total tourism and hospitality employment. It accounts for roughly 4.5% of all jobs in Australia (400,000 workers). Since 1987, the number of jobs in the sector has risen from about 257,000 to about 372,000. Approximately 57% of employees are…
A Randomized Trial of a Multifaceted Intervention to Reduce Falls among Community-Dwelling Adults
Fox, Patrick J.; Vazquez, Laurie; Tonner, Chris; Stevens, Judy A.; Fineman, Norman; Ross, Leslie K.
2010-01-01
Using a randomized controlled trial, we tested the efficacy of a fall prevention intervention to reduce falls among adults in a community-based health promotion program. Adults aged 65 and older within two counties were recruited (control n = 257; intervention n = 286). After 12 months, there was a significant decrease in the number of falls in…
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš; Šimák, Vladislav
2006-01-01
Roč. 565, - (2006), s. 463-537 ISSN 0168-9002 R&D Projects: GA MŠk 1P04LA210; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : Fermilab * DZero * DØ * detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.185, year: 2006
DEFF Research Database (Denmark)
Christensen, Britt; Dyrberg, Eva; Aagaard, Per
2008-01-01
increased (PINP: 257 vs. 56 ng/ml; ICTP: 9.8 vs. 2.1 microg/l) in the immobilized leg compared with the control leg after the 7 wk of immobilization, and levels decreased again in the immobilized leg during the recovery period (PINP: 103 vs. 44 ng/ml; ICTP: 4.2 vs. 1.9 microg/l). A significant reduction...
Development of Creative Behavior Observation Form: A Study on Validity and Reliability
Dere, Zeynep; Ömeroglu, Esra
2018-01-01
This study, Creative Behavior Observation Form was developed to assess creativity of the children. While the study group on the reliability and validity of Creative Behavior Observation Form was being developed, 257 children in total who were at the ages of 5-6 were used as samples with stratified sampling method. Content Validity Index (CVI) and…
2011-11-25
... information (a total capital/startup costs and operations and maintenance costs). The comments that are... of total annual responses was lowered from 11,300,000 to 8,100,000. Vessel Stow Plan: the number of... 74 to 60, and the number of total responses was raised from 72,121,193 to 257,100,000. Type of Review...
Czech Academy of Sciences Publication Activity Database
Kvach, Yuriy; Ondračková, Markéta; Jurajda, Pavel
2016-01-01
Roč. 53, č. 3 (2016), s. 257-261 ISSN 0440-6605 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR(CZ) GAP505/12/2569 Institutional support: RVO:68081766 Keywords : Cyathocotyle prussica * Proterorhinus semilunaris * metacercariae * morphology * first finding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.472, year: 2016
21 CFR 184.1660 - Propyl gallate.
2010-04-01
... alcohol. (b) The ingredient meets the specifications of the “Food Chemicals Codex,” 3d Ed. (1981), pp. 257... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Propyl gallate. 184.1660 Section 184.1660 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
24 CFR 4001.102 - Cross-reference.
2010-04-01
... section 203 of the National Housing Act (12 U.S.C. 1709) apply to mortgages on one-family dwellings to be insured under section 257 of the National Housing Act (12 U.S.C. 1701z-22), except the following... contract regarding use of dwelling for transient or hotel purposes; 203.17(d) Maturity; 203.18 Maximum...
Cell Growth Arrest Mediated by STAT Proteins in Breast Cancer Cells
1998-07-01
Wei, S., Matsusaka, T., Yoshida, K., Sudo, T., Naruto , M., and Kishimoto, T. (1994) Cellll{\\), 63-71 34. David, M., and Larner, A. C. e. a. (1992...T., Naruto , M., and Kishimoto, T. (1994) Cell 77, 63-71 34. David, M., and Lamer, A. C. (1992) Science 257, 813-815 35. Sadowski, H. B., and Gilman
Czech Academy of Sciences Publication Activity Database
Tyrpekl, Václav; Vejpravová, J.P.; Roca, A.G.; Murafa, Nataliya; Szatmáry, Lórant; Nižňanský, D.
2011-01-01
Roč. 257, č. 11 (2011), s. 4844-4848 ISSN 0169-4332 R&D Projects: GA MŠk(CZ) LC06041; GA AV ČR KAN400100653 Institutional research plan: CEZ:AV0Z40320502 Keywords : nano composite * oxides * magnetic properties * transmission electron microscopy * X-ray powder diffraction Subject RIV: CA - Inorganic Chemistry Impact factor: 2.103, year: 2011
ORF Alignment: NC_000912 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518
78 FR 26269 - Connect America Fund; High-Cost Universal Service Support
2013-05-06
... regular business hours in the FCC Reference Center, Room CY-A257, 445 12th Street SW., Washington, DC...-807A1.pdf . I. Introduction 1. In the USF/ICC Transformation Order, 76 FR 73830, November 29, 2011, the... business, will be placed in individual census blocks, and a network topology will be constructed to serve...
Chronopotentiometric sensing of anterior gradient 2 protein
Czech Academy of Sciences Publication Activity Database
Vargová, Veronika; Hrstka, R.; Hernychová, L.; Coufalová, D.; Ostatná, Veronika
2017-01-01
Roč. 240, JUN2017 (2017), s. 250-257 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00956S Institutional support: RVO:68081707 Keywords : catalyzed hydrogen evolution * mercury -electrodes * affinity tags Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.798, year: 2016
The Impact of Stressors on Military Performance
2013-12-01
mechanical (vibration, eyewear , interface with other equipment); physiological (fatigue, sleep deprivation, hypoxia, medical condition...and vibration in Canadian forces armoured vehicles. Industrial Health, 45, 318-327. Nakishima, A., & Cheung, B. (2006). The effects of vibration...environments. International Journal of Industrial Ergonomics, 9, 245-257. Rash, C. E., Hiatt, K. L., Wildzunas, R., Caldwell, J. L., Caldwell, J. A
Davies, John J.; Gentile, Douglas A.
2012-01-01
Drawing on family development theory, this study provides insight into how family stages with and without siblings are related to media habits and effects. Two national samples (N = 527 and N = 1,257) present a cross-sectional snapshot of media uses in families across three stages of family life: families with preschoolers (2-6 years), with…
Relationship between the minimum and maximum temperature thresholds for development in insects
Czech Academy of Sciences Publication Activity Database
Dixon, Anthony F. G.; Honěk, A.; Keil, P.; Kotela, M.A.A.; Šizling, A. L.; Jarošík, Vojtěch
2009-01-01
Roč. 23, č. 2 (2009), s. 257-264 ISSN 0269-8463 R&D Projects: GA MŠk(CZ) LC06073 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z60050516 Keywords : distribution * insects * thermal requirements for development * thermal window * thermal tolerance range * ectotherms Subject RIV: EG - Zoology Impact factor: 4.546, year: 2009
Jiménez-Mejías, E.; Amezcua-Prieto, C.; Martínez-Ruiz, V.; Olvera-Porcel, M. C.; Jiménez-Moleón, J. J.; Lardelli Claret, P.
2015-01-01
The aim of this study was to evaluate the effect of problem-based learning (PBL) on university students' satisfaction with and academic performance in a course on epidemiology and social and demographic health. The participants in this interventional study were 529 students (272 in the intervention group and 257 in the control group) enrolled in a…
African Journals Online (AJOL)
FRANK
Barro, F.I., Mbodji, S., Ndiaye, A. L., Madougou, S., Zerbo, I., Zougmore, F. and Sissoko, G., 2004. European. Photovoltaic Solar Energy Conference and Exhibition, Poster 1AV2.57. Basu, P.K. and Singh, S.N., 1994. Solar Energy Materials and Solar Cells, 33: 317-329. Betser, Y., Ritter, D., Bahir, G., Cohen, S. and Sperling, ...
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 666, č. 5 (2008), s. 435-445 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron, * photon Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 100, č. 10 (2008), 102002/1-10200/7 ISSN 0031-9007 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * boson Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
More Details Fulltext PDF. pp 257-258. Author Index · More Details Fulltext PDF. pp 259-264. Subject Index · More Details Fulltext PDF. pp 265-266. Index · More Details Fulltext PDF. pp 267-267 Flowering Trees. Prima Vera · More Details Fulltext PDF. pp 268-268 Featured Scientist. C. V. Raman · More Details Fulltext PDF ...
obesity and systemic hypertension in accra communities
African Journals Online (AJOL)
SUMMARY. Thc stildy was carried out to deterninine the preva-. Icncc of obesity associated with systemic hypcr- tcnsion in four comn~unities in Accra. A total of. 598 persons, of \\\\ll~om 257 were Inale and 341 fe- male agcd 15ycar and above werc examined. Their blood prcssurc, weight, and height were measuretl; and liom ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Romina A Frenzel1 Gustavo P Romanelli1 Mirta N Blanco1 Luis R Piz1. Centro de Investigación y Desarrollo en Ciencias Aplicadas ``Dr. Jorge J. Ronco” (CINDECA), CCT-LaPlata-CONICET, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 47 N° 257 (B1900AJK) La Plata, Argentina ...
Method for Estimating Pesticide Use for County Areas of the Conterminous United States
2000-01-01
Vernolate 1432 Herbicide 498,688 257,728 Methazole 9096 Herbicide 491,795 859,590 Oxyfluorfen 4000 Herbicide 490,752 1,307,624 Fosetyl Al 5031 Fungicide... Oxyfluorfen Grapes 102,702 144,720 Almonds 95,932 282,152 Cotton 77,944 380,376 Apples 37,006 23,945 Pistachios 26,385 25,346 Field and Grass Seed
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 113; Issue 2. Volume 113, Issue 2. June 2004, pages 129-257. pp 129-138. The evaporation of the charged and uncharged water drops suspended in a wind tunnel · Rohini V Bhalwankar A B Sathe A K Kamra · More Details Abstract Fulltext PDF. A laboratory ...
A vanishing diffusion limit in a nonstandard system of phase field equations
Czech Academy of Sciences Publication Activity Database
Colli, P.; Gilardi, G.; Krejčí, Pavel; Sprekels, J.
2014-01-01
Roč. 3, č. 2 (2014), s. 257-275 ISSN 2163-2480 R&D Projects: GA ČR GAP201/10/2315 Institutional support: RVO:67985840 Keywords : nonstandard phase field system * nonlinear partial differential equations * asympotic limit Subject RIV: BA - General Mathematics Impact factor: 0.373, year: 2014 http://aimsciences.org/journals/displayArticlesnew.jsp?paperID=9918
Market supply response of imported sardinella in Cross River State ...
African Journals Online (AJOL)
The following results were obtained; the short-run and long-run own price elasticity were 2.062 and 1.257 which were significant at the 5 percent and 1 percent levels respectively. The error correction coefficient Ect(-1) was - 1.536 which was significant at the 5 percent level. The own price long-run elasticity estimates were ...
Czech Academy of Sciences Publication Activity Database
Šebest, Peter; Brázdová, Marie; Fojta, Miroslav; Pivoňková, Hana
2015-01-01
Roč. 16, č. 2 (2015), s. 3163-3177 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GAP301/11/2076; GA ČR(CZ) GBP206/12/G151 Institutional support: RVO:68081707 Keywords : TUMOR-SUPPRESSOR P53 * CISPLATIN -DAMAGED DNA * SUPERCOILED DNA Subject RIV: BO - Biophysics Impact factor: 3.257, year: 2015
DEFF Research Database (Denmark)
Popescu, Bogdan O; Cedazo-Minguez, Angel; Benedikz, Eirikur
2004-01-01
, we studied the effect of two other FAD PS1 mutants (M146V and L250S) and two dominant negative PS1 mutants (D257A and D385N) on basal and carbachol-stimulated phosphoinositide (PI) hydrolysis and intracellular calcium concentrations ([Ca2+]i) in SH-SY5Y neuroblastoma cells. We found a significant...
Implicit Racial Biases in Preschool Children and Adults from Asia and Africa
Qian, Miao K.; Heyman, Gail D.; Quinn, Paul C.; Messi, Francoise A.; Fu, Genyue; Lee, Kang
2016-01-01
This research used an Implicit Racial Bias Test to investigate implicit racial biases among 3- to 5-year-olds and adult participants in China (N = 213) and Cameroon (N = 257). In both cultures, participants displayed high levels of racial biases that remained stable between 3 and 5 years of age. Unlike adults, young children's implicit racial…
Increased prevalence of coronary artery disease risk markers in patients with chronic hepatitis C
DEFF Research Database (Denmark)
Roed, Torsten; Kristoffersen, Ulrik Sloth; Knudsen, Andreas
2014-01-01
% confidence interval [CI] 0.9-2.7) and smoked more (53% versus 38%, PR 1.4; 95% CI 0.9-2.1). The two groups had similar body mass index (mean 25.0 versus 25.7 kg/m(2)), whereas those with chronic hepatitis C had less dyslipidemia (including significantly lower low-density lipoprotein and cholesterol...
Mata, Luciana Regina Ferreira da; Azevedo, Cissa; Policarpo, Aryanne Gabrielle; Moraes, Juliano Teixeira
2017-06-08
to assess the factors associated with the risk of fall in patients undergoing surgical procedures. quantitative and cross-sectional study carried out with 257 adult patients in a hospital in the state of Minas Gerais, Brazil. Data were collected using the sociodemographic and clinical questionnaire, the Morse Fall Scale, and the Quality of Recovery Score. Data were submitted to descriptive statistical analysis and multinomial logistic regression. The level of significance was set at 0.05. 35.4% of patients had high risk of falls, 38.9% had moderate risk and 25.7% had low risk. The mean value in the surgical recovery scale was 175.37 points and no patient presented poor surgical recovery. Regarding the results of the bivariate analysis, it was found that age (prisk of fall, whereas cancer (p=0.004) was positively associated with moderate risk of fall. Surgical recovery (p=0,008) was inversely associated with high risk of fall. the results of this study allowed the identification of five factors associated with the risk of fall in adults in the postoperative hospital stay. These findings may support the planning of nursing actions aimed at preventing the risk of fall in the postoperative period. evaluar los factores asociados al riesgo de caída en pacientes sometidos a procedimientos quirúrgicos. estudio cuantitativo, transversal, realizado en 257 pacientes adultos en un hospital de Minas Gerais, Brasil. La recolección de datos se realizó por medio de un cuestionario sociodemográfico y clínico, Morse Fall Scale Quality of Recovery Score. Los datos fueron sometidos al análisis estadístico descriptivo y regresión logística multinomial. El nivel de significación adoptado fue de 0,05. 35,4% de los pacientes presentaron elevado riesgo de caídas, 38,9% moderado riesgo y 25,7% bajo riesgo. La escala de recuperación quirúrgica indicó valor promedio de 175,37 puntos y ningún paciente presentó recuperación quirúrgica precaria. En relación a los resultados
Defense Enterprise Accounting and Management System-Increment 1 (DEAMS Inc 1)
2016-03-01
information accurately and in conformance with Generally Accepted Accounting Principles , to comply with Congressional requirements of the Chief Financial ...2016 Major Automated Information System Annual Report Defense Enterprise Accounting and Management System-Increment 1 (DEAMS Inc 1) Defense...Phone: 937-257-2714 Fax: DSN Phone: 787-2714 DSN Fax: Date Assigned: August 17, 2015 Program Information Program Name Defense Enterprise Accounting
Effect of dietary yeast autolysate on performance, slaughter, and ...
African Journals Online (AJOL)
TOSHIBA
2017-05-22
May 22, 2017 ... During the study (from 1st to 42nd day), quails fed dietary treatments ... affect poultry performance parameters and carcass characteristics (Aydin & Aydin, .... Serum sample levels of AST, ALP, cholesterol, high-density lipoprotein (HDL), total ... 28th day. M 98 93.26 ± 1.97 96 97.26 ± 2.57 96 97.50 ± 2.24 99 ...
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 666, č. 1 (2008), s. 23-30 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * collisions Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008
Czech Academy of Sciences Publication Activity Database
Černý, Martin; Strachota, Adam; Chlup, Zdeněk; Sucharda, Zbyněk; Žaloudková, Margit; Glogar, Petr; Kuběna, Ivo
2013-01-01
Roč. 47, č. 8 (2013), s. 1055-1066 ISSN 0021-9983 R&D Projects: GA ČR GA106/09/1101 Institutional support: RVO:67985891 ; RVO:61389013 ; RVO:68081723 Keywords : fibre-reinforced composite * fracture toughness * mechanical properties * pyrolyzed siloxane resin Subject RIV: JI - Composite Materials Impact factor: 1.257, year: 2013 http://jcm.sagepub.com/content/47/8/1055.full.pdf+html
Complexity of deciding detectability in discrete event systems
Czech Academy of Sciences Publication Activity Database
Masopust, Tomáš
2018-01-01
Roč. 93, July (2018), s. 257-261 ISSN 0005-1098 Institutional support: RVO:67985840 Keywords : discrete event systems * finite automata * detectability Subject RIV: BA - General Mathematics OBOR OECD: Computer science s, information science , bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 5.451, year: 2016 https://www. science direct.com/ science /article/pii/S0005109818301730
Monopole-antimonopole interaction potential
Saurabh, Ayush; Vachaspati, Tanmay
2017-11-01
We numerically study the interactions of twisted monopole-antimonopole pairs in the 't Hooft-Polyakov model for a range of values of the scalar to vector mass ratio. We also recover the sphaleron solution at maximum twist discovered by Taubes [Commun. Math. Phys. 86, 257 (1982), 10.1007/BF01206014] and map out its energy and size as functions of parameters.
Search for stopped gluinos from p-anti-p collisions at s**(1/2) = 1.96 TeV
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš; Šimák, Vladislav
2007-01-01
Roč. 99, č. 13 (2007), 131801/1-131801/7 ISSN 0031-9007 R&D Projects: GA MŠk 1P04LA210; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : supersymmetry * gluino * neutralino * D0 * DZero Subject RIV: BF - Elementary Particle s and High Energy Physics Impact factor: 6.944, year: 2007
Swimming ability and physiological response to swimming fatigue in ...
African Journals Online (AJOL)
The swimming endurance of kuruma shrimp, Marsupenaeus japonicus (11.04 ± 2.43 g) at five swimming speeds (23.0, 26.7, 31.0, 34.6 and 38.6 cm s-1) was determined in a circulating flume at 25.7 ± 0.7°C. The plasma glucose and total protein, hepatopancreas and pleopods muscle glycogen concentrations were ...
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 669, č. 5 (2008), s. 278-286 ISSN 0370-2693 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : differential cross * D0 detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.034, year: 2008
Search for long-lived particles decaying into electron or photon pairs with the D0 detector
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 101, č. 11 (2008), 111802/1-111802/6 ISSN 0031-9007 R&D Projects: GA MŠk LC527; GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * supersymmetry * quark Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008
DEFF Research Database (Denmark)
Albert, Nikolai; Melau, Marianne; Jensen, Heidi
2017-01-01
, alogia, and affective blunting). Secondary outcomes were remission of both negative and psychotic symptoms, psychotic symptoms, suicidal ideation, substance abuse, compliance with medical treatment, adherence with treatment, client satisfaction, days in hospital care, and labour market affiliation...... with specialised mental health services (90.4% v 55.6%, Psatisfaction (estimated mean difference 2.57 points (95% confidence interval 1.36 to 3.79), P
Alzheimer's Disease: Mechanism and Approach to Cell Therapy
Czech Academy of Sciences Publication Activity Database
Amemori, Takashi; Jendelová, Pavla; Růžička, Jiří; Machová-Urdzíková, Lucia; Syková, Eva
2015-01-01
Roč. 16, č. 11 (2015), s. 26417-26451 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GBP304/12/G069; GA ČR(CZ) GAP304/11/0184 Institutional support: RVO:68378041 Keywords : alzheimer’s disease * tau * amyloid-β * mesenchymal stem cell s * neural stem cell s Subject RIV: FH - Neurology Impact factor: 3.257, year: 2015
Draft Genome Sequences of Vibrio alginolyticus Strains V1 and V2, Opportunistic Marine Pathogens
DEFF Research Database (Denmark)
Castillo, Daniel; D'Alvise, Paul; Kalatzis, Panos G.
2015-01-01
We announce the draft genome sequences of Vibrio alginolyticus strains V1 and V2, isolated from juvenile Sparus aurata and Dentex dentex, respectively, during outbreaks of vibriosis. The genome sequences are 5,257,950 bp with a G+C content of 44.5% for V. alginolyticus V1 and 5,068,299 bp with a G...
The Impact of Oral Rehydration Therapy on Childhood Diarrhoeal ...
African Journals Online (AJOL)
Results: Eight hundred and ninety one patients presented in the DTU over the one-year period in 1993/94 compared to 109 patients over the same period in 1997/98. There was a significantly higher mean duration of diarrhoea before presentation in the 1993/94 group (58.3 ± 13 hours) compared to the 1997/98 group (25.7 ...
Design Structure Matrix (DSM) Methods and Applications for Naval Ship Design
2013-05-23
Fax: 817-257-7227 E-mail: t.browninufetcu.edu Web : www. t vsonbrown i ng. com Administrative/Business Contact: Mrs. Teresa Miles Hendrix, MPA...mail: t.browninu(ajtcii.edu Web : www.tvsonbrownina.com Administrative/Business Contact: Mrs. Teresa Miles Hendrix, MPA Assistant Director of...STAKEHOLDER COM ABORDAGEM DE SISTEMAS ADAPTATIVOS A COMPLEXIDADE John Findlay, Ph D. e Abby Straus, M. Div. IMPLEMENTANDO FLEXIBILIDADE
78 FR 36543 - Sunshine Act Meeting
2013-06-18
... Between Natural Gas and Electricity Markets. ELECTRIC E-1 ER13-93-000 Avista Corporation. ER13-94-000 ER13... Transmission System Operator, Inc. E-6 EL13-52-000 Western Electricity Coordinating Council. E-7 RM13-8-000...-001 Idaho Wind Partners 1, LLC. HYDRO H-1 P-2144-040 City of Seattle, Washington. H-2 P-2114-257...
2010-07-01
... asphalt processes (A) 5 21. Hydrofining 3 Total lube processes (L) 3 8. Catalytic reforming 10 Total... 0.102 Asphalt 0.226 0.055 Lube 1.055 0.257 Reforming and alkylation 0.377 0.092 Total chromium: Crude 0.030 0.011 Cracking and coking 0.340 0.118 Asphalt 0.183 0.064 Lube 0.855 0.297 Reforming and...
Czech Academy of Sciences Publication Activity Database
Acosta, Manuel; Dařenová, Eva; Krupková, Lenka; Pavelka, Marian
256-257 (2018), s. 93-103 ISSN 0168-1923 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) EF16_013/0001609 Institutional support: RVO:86652079 Keywords : Automated chamber system * Day of the year * Picea abies * Soil carbon flux * Temperature Soil water content Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.887, year: 2016
Trends in Female Circumcision Between 1933 And 2003 in Osun ...
African Journals Online (AJOL)
1174 female live births to 413 women were included in the analysis. 52.4% of all females were circumcised. The prevalence dropped from 64.9% during the period 1933-60 to 25.7% for the period 2000–2003. For first order births, the corresponding rates were 58.8% and 25.0%. The decline for first-born females comes a ...
2013-03-01
Role of flow visualization in the development of UNICORN , Journal of Visualization 2000, Vol. 2, 257-272. [10] Gross, K. C.; Tremblay, P.; Bradley...NASA- Glenn’s Chemical Equilibrium with Applications (CEA) program. UNICORN CFD predictions were in excellent agreement with CEA calculations at...49 Appendix A – UNICORN CFD Inputs and Instruction .....................................................50 Appendix B – NASA-Glenn
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 100, č. 9 (2008), 091802/1-091802/7 ISSN 0031-9007 R&D Projects: GA MŠk LC527; GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 101, č. 18 (2008), 182004/1-182004/7 ISSN 0031-9007 R&D Projects: GA MŠk LA08047; GA MŠk 1P05LA257; GA MŠk LC527 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron * meson * polarization Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008
On a non-isothermal model for nematic liquid crystals
Czech Academy of Sciences Publication Activity Database
Feireisl, Eduard; Rocca, E.; Schimperna, G.
2011-01-01
Roč. 24, č. 1 (2011), s. 243-257 ISSN 0951-7715 R&D Projects: GA ČR GA201/09/0917; GA MŠk LC06052 Institutional research plan: CEZ:AV0Z10190503 Keywords : Navier-Stokes equations * system * flows Subject RIV: BA - General Mathematics Impact factor: 1.386, year: 2011 http://iopscience.iop.org/0951-7715/24/1/012/
Czech Academy of Sciences Publication Activity Database
Aasen, S. N.; Pospíšilová, Aneta; Eichler, T. W.; Pánek, Jiří; Hrubý, Martin; Štěpánek, Petr; Spriet, E.; Jirák, D.; Skaftnesmo, K. O.; Thorsen, F.
2015-01-01
Roč. 16, č. 9 (2015), s. 21658-21680 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA13-08336S; GA MZd(CZ) NV15-25781A Grant - others:AV ČR(CZ) M200501201 Program:M Institutional support: RVO:61389013 Keywords : melanoma brain metastasis * nanoprobe * theranostics Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.257, year: 2015
Measurement of the inclusive jet cross-section in p anti-p collisions at s**(1/2) =1.96 TeV
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Abolins, M.; Kupčo, Alexander; Lokajíček, Miloš
2008-01-01
Roč. 101, č. 6 (2008), 062001/1-062001/7 ISSN 0031-9007 R&D Projects: GA MŠk LC527; GA MŠk LA08047; GA MŠk 1P05LA257 Institutional research plan: CEZ:AV0Z10100502 Keywords : D0 * Tevatron Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 7.180, year: 2008
Czech Academy of Sciences Publication Activity Database
Zíková, Martina; Corlett, Alicia; Bendová, Zdeňka; Pajer, Petr; Bartůněk, Petr
2009-01-01
Roč. 23, č. 4 (2009), s. 520-528 ISSN 0888-8809 R&D Projects: GA AV ČR IAA500520705 Grant - others:EC(XE) LSHM-CT-2005-018652 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50110509 Keywords : thyroid hormone receptor * cholesterol metabolism * sterol-sensing domain Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.257, year: 2009
2013-05-20
...-005, QF07-55-005, QF07-56-005, QF07-257-004] Exelon Corporation, Exelon Wind 1, LLC, Exelon Wind 2, LLC, Exelon Wind 3, LLC, Exelon Wind 4, LLC, Exelon Wind 5, LLC, Exelon Wind 6, LLC, Exelon Wind 7, LLC, Exelon Wind 8, LLC, Exelon Wind 9, LLC, Exelon Wind 10, LLC, Exelon Wind 11, LLC, High Plains...
Wartime Construction Project Outcomes as a Function of Contract Type
2016-07-01
contract types has been well established. The theory of contractual incentives promulgated by Sherer (1964) established expected contractor...behaviors using a max- imization problem. The theory focuses on expected contractor behaviors in incentive contracts (cf. Federal Acquisition Regulation...Scherer, F. M. (1964). The theory of contractual incentives for cost reduction. Quarterly Journal of Economics, 78, 257–280. Tawazuh Commercial and