Energy Technology Data Exchange (ETDEWEB)
Fountaine, Katherine T., E-mail: kfountai@caltech.edu [Department of Chemistry and Chemical Engineering, California Institute of Technology, 1200 E. California Blvd., Pasadena, California 91125 (United States); Joint Center for Artificial Photosynthesis, California Institute of Technology, 1200 E. California Blvd., Pasadena, California 91125 (United States); Whitney, William S. [Joint Center for Artificial Photosynthesis, California Institute of Technology, 1200 E. California Blvd., Pasadena, California 91125 (United States); Department of Physics, California Institute of Technology, 1200 E. California Blvd., Pasadena, California 91125 (United States); Atwater, Harry A. [Joint Center for Artificial Photosynthesis, California Institute of Technology, 1200 E. California Blvd., Pasadena, California 91125 (United States); Department of Applied Physics and Materials Science, California Institute of Technology, 1200 E. California Blvd., Pasadena, California 91125 (United States)
2014-10-21
We present a unified framework for resonant absorption in periodic arrays of high index semiconductor nanowires that combines a leaky waveguide theory perspective and that of photonic crystals supporting Bloch modes, as array density transitions from sparse to dense. Full dispersion relations are calculated for each mode at varying illumination angles using the eigenvalue equation for leaky waveguide modes of an infinite dielectric cylinder. The dispersion relations along with symmetry arguments explain the selectivity of mode excitation and spectral red-shifting of absorption for illumination parallel to the nanowire axis in comparison to perpendicular illumination. Analysis of photonic crystal band dispersion for varying array density illustrates that the modes responsible for resonant nanowire absorption emerge from the leaky waveguide modes.
2006-01-01
Intel’s first dual-core Itanium processor, code-named "Montecito" is a major release of Intel's Itanium 2 Processor Family, which implements the Intel Itanium architecture on a dual-core processor with two cores per die (integrated circuit). Itanium 2 is much more powerful than its predecessor. It has lower power consumption and thermal dissipation.
Zhang, Hui; Li, Yu-Hao; Chen, Yang; Wang, Man-Man; Wang, Xue-Sheng; Yin, Xue-Bo
2017-03-01
Phototherapy shows some unique advantages in clinical application, such as remote controllability, improved selectivity, and low bio-toxicity, than chemotherapy. In order to improve the safety and therapeutic efficacy, imaging-guided therapy seems particularly important because it integrates visible information to speculate the distribution and metabolism of the probe. Here we prepare biocompatible core-shell nanocomposites for dual-modality imaging-guided photothermal and photodynamic dual-therapy by the in situ growth of porphyrin-metal organic framework (PMOF) on Fe3O4@C core. Fe3O4@C core was used as T2-weighted magnetic resonance (MR) imaging and photothermal therapy (PTT) agent. The optical properties of porphyrin were well remained in PMOF, and PMOF was therefore selected for photodynamic therapy (PDT) and fluorescence imaging. Fluorescence and MR dual-modality imaging-guided PTT and PDT dual-therapy was confirmed with tumour-bearing mice as model. The high tumour accumulation of Fe3O4@C@PMOF and controllable light excitation at the tumour site achieved efficient cancer therapy, but low toxicity was observed to the normal tissues. The results demonstrated that Fe3O4@C@PMOF was a promising dual-imaging guided PTT and PDT dual-therapy platform for tumour diagnosis and treatment with low cytotoxicity and negligible in vivo toxicity.
Intermediate mass distribution of the dual resonance pomeron
International Nuclear Information System (INIS)
Chiu, C.B.; Matsuda, S.
1978-01-01
The intermediate mass distribution of the dual resonance pomeron is determined at the one-loop level and it is shown that the mass distribution obtained is remarkably similar to a suitably defined mass distribution in the dual multiperipheral model. Thus it is suggestive to identify the intermediate states of the dual resonance pomeron with multiperipheral processes. (Auth.)
Experimental results of high power dual frequency resonant magnet excitation at TRIUMF
International Nuclear Information System (INIS)
Reiniger, K.W.; Heritier, G.
1988-06-01
We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)
Dual-band plasmonic resonator based on Jerusalem cross-shaped nanoapertures
Cetin, Arif E.; Kaya, Sabri; Mertiri, Alket; Aslan, Ekin; Erramilli, Shyamsunder; Altug, Hatice; Turkmen, Mustafa
2015-06-01
In this paper, we both experimentally and numerically introduce a dual-resonant metamaterial based on subwavelength Jerusalem cross-shaped apertures. We numerically investigate the physical origin of the dual-resonant behavior, originating from the constituting aperture elements, through finite difference time domain calculations. Our numerical calculations show that at the dual-resonances, the aperture system supports large and easily accessible local electromagnetic fields. In order to experimentally realize the aperture system, we utilize a high-precision and lift-off free fabrication method based on electron-beam lithography. We also introduce a fine-tuning mechanism for controlling the dual-resonant spectral response through geometrical device parameters. Finally, we show the aperture system's highly advantageous far- and near-field characteristics through numerical calculations on refractive index sensitivity. The quantitative analyses on the availability of the local fields supported by the aperture system are employed to explain the grounds behind the sensitivity of each spectral feature within the dual-resonant behavior. Possessing dual-resonances with large and accessible electromagnetic fields, Jerusalem cross-shaped apertures can be highly advantageous for wide range of applications demanding multiple spectral features with strong nearfield characteristics.
Analysis and measurement of the stability of dual-resonator oscillators
Ghaed, Hassan
2012-01-01
This paper investigates the stability of oscillators with dual-resonating tanks. After deriving oscillator models, it is shown that contrary to prior belief, there can be only one stable oscillating state. Sufficient conditions for stable oscillating states are derived and silicon measurement results are used to prove their validity. A fully integrated transmitter for intraocular pressure sensing that leverages the dual-resonator tank is designed and fabricated based on the derived models. An unstable version of the transmitter is also demonstrated to prove the concept of instability in dual-resonator oscillators © 2012 IEEE.
Compact Dual-Band Bandpass Filter Using Stubs Loaded Ring Resonator
Xu, Jin
2016-01-01
This paper presents a novel second-order dual-band bandpass filter (BPF) by using proposed stubs loaded ring resonator. The resonant behavior of proposed stubs loaded ring resonator is analyzed by even-/odd-mode method, which shows its multiple-mode resonant characteristic. Parameters sweep is done so as to give the design guidelines. As an example, a second-order dual-band BPF operating at 1.8/5.2 GHz for GSM and WLAN applications is designed, fabricated and measured. The fabricated filter has a very compact size of 0.05λg×0.15λg. Measured results also show that the proposed dual-band BPF has a better than 20 dB rejection upper stopband from 5.47 GHz to 12.56 GHz. Good agreement is shown between the simulated and measured results.
Analysis and Synthesis of Leaky-Wave Devices in Planar Technology
Martinez Ros, Alejandro Javier
The work developed along this doctoral thesis has been focused on the analysis and synthesis of microwave devices in planar technology. In particular, several types of devices based on the radiation mechanism of leaky waves have been studied. Typically, the radiation properties in leaky-wave devices are determined by the complex propagation constant of the leaky mode, wherein the phase constant is responsible for the pointing angle and the leakage rate for the intensity of the radiated fields. In this manner, by controlling both amplitude and phase of the leaky mode, an effective control over the device's radiation diagram can be obtained. Moreover, with the purpose of efficiently obtaining the leaky mode's radiation properties as function of the main geometrical parameters of the structure, several modal tools based on the transverse resonance analysis of the structure have been performed. In order to demonstrate this simultaneous control over the complex propagation constant in planar technology, several types of leaky-wave devices, including antennas (LWAs), multiplexors and near-field focusing systems, have been designed and manufactured in the technology of substrate integrated waveguide (SIW). This recently proposed technology, allows the design of devices based on classical waveguide technology with standard manufacturing techniques used for printed circuit board (PCB) designs. In this way, most of the parts that form a communication system can be integrated into a single substrate, thus reducing its cost and providing a more robust and compact device, which has less losses compared to other planar technologies such as the microstrip. El trabajo llevado a cabo durante la realizacion de esta tesis doctoral, se ha centrado en el analisis y sintesis de dispositivos de microondas en tecnologia planar. En concreto, se han estudiado diferentes tipos de dispositivos basados en radiacion por ondas de fuga "leaky waves", en los cuales las propiedades de radiacion
Dual resonant structure for energy harvesting from random vibration sources at low frequency
Directory of Open Access Journals (Sweden)
Shanshan Li
2016-01-01
Full Text Available We introduce a design with dual resonant structure which can harvest energy from random vibration sources at low frequency range. The dual resonant structure consists of two spring-mass subsystems with different frequency responses, which exhibit strong coupling and broad bandwidth when the two masses collide with each other. Experiments with piezoelectric elements show that the energy harvesting device with dual resonant structure can generate higher power output than the sum of the two separate devices from random vibration sources.
Spatial mode discriminator based on leaky waveguides
Xu, Jing; Liu, Jialing; Shi, Hongkang; Chen, Yuntian
2018-06-01
We propose a conceptually simple and experimentally compatible configuration to discriminate the spatial mode based on leaky waveguides, which are inserted in-between the transmission link. The essence of such a spatial mode discriminator is to introduce the leakage of the power flux on purpose for detection. Importantly, the leaky angle of each individual spatial mode with respect to the propagation direction are different for non-degenerated modes, while the radiation patterns of the degenerated spatial modes in the plane perpendicular to the propagation direction are also distinguishable. Based on these two facts, we illustrate the operation principle of the spatial mode discriminators via two concrete examples; a w-type slab leaky waveguide without degeneracy, and a cylindrical leaky waveguide with degeneracy. The correlation between the leakage angle and the spatial mode distribution for a slab leaky waveguide, as well as differences between the in-plane radiation patterns of degenerated modes in a cylindrical leaky waveguide, are verified numerically and analytically. Such findings can be readily useful in discriminating the spatial modes for optical communication or optical sensing.
Directory of Open Access Journals (Sweden)
Sidan Tian
2016-06-01
Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA
Design and analysis of a novel dual-mass MEMS resonant output gyroscope
Directory of Open Access Journals (Sweden)
Yang Gao
2018-02-01
Full Text Available This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS resonant output gyroscope (ROG, which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.
Leaky vessels as a potential source of stromal acidification in tumours
Martin, Natasha K.
2010-12-01
Malignant tumours are characterised by higher rates of acid production and a lower extracellular pH than normal tissues. Previous mathematical modelling has indicated that the tumour-derived production of acid leads to a gradient of low pH in the interior of the tumour extending to a normal pH in the peritumoural tissue. This paper uses mathematical modelling to examine the potential of leaky vessels as an additional source of stromal acidification in tumours. We explore whether and to what extent increasing vascular permeability in vessels can lead to the breakdown of the acid gradient from the core of the tumour to the normal tissue, and a progressive acidification of the peritumoural stroma. We compare our mathematical simulations to experimental results found in vivo with a tumour implanted in the mammary fat pad of a mouse in a window chamber construct. We find that leaky vasculature can cause a net acidification of the normal tissue away from the tumour boundary, though not a progressive acidification over time as seen in the experiments. Only through progressively increasing the leakiness can the model qualitatively reproduce the experimental results. Furthermore, the extent of the acidification predicted by the mathematical model is less than as seen in the window chamber, indicating that although vessel leakiness might be acting as a source of acid, it is not the only factor contributing to this phenomenon. Nevertheless, tumour destruction of vasculature could result in enhanced stromal acidification and invasion, hence current therapies aimed at buffering tumour pH should also examine the possibility of preventing vessel disruption.
Dual Symmetry in Bent-Core Liquid Crystals and Unconventional Superconductors
Directory of Open Access Journals (Sweden)
Vladimir Lorman
2010-01-01
Full Text Available We extend the Landau theory of bent-core mesophases and d-wave high-Tc superconductors by considering additional secondary pseudo-proper order parameters. These systems exhibit a remarkable analogy relating their symmetry groups, lists of phases, and an infinite set of physical tensors. This analogy lies upon an internal dual structure shared by the two theories. We study the dual operator transforming rotations into translations in liquid crystals, and gauge symmetries into rotations in superconductors. It is used to classify the bent-core line defects, and to analyze the electronic gap structure of lamellar d-wave superfluids.
Effect of curing mode on the hardness of dual-cured composite resin core build-up materials
Directory of Open Access Journals (Sweden)
César Augusto Galvão Arrais
2010-06-01
Full Text Available This study evaluated the Knoop Hardness (KHN values of two dual-cured composite resin core build-up materials and one resin cement exposed to different curing conditions. Two dual-cured core build-up composite resins (LuxaCore®-Dual, DMG; and FluoroCore®2, Dentsply Caulk, and one dual-cured resin cement (Rely X ARC, 3M ESPE were used in the present study. The composite materials were placed into a cylindrical matrix (2 mm in height and 3 mm in diameter, and the specimens thus produced were either light-activated for 40 s (Optilux 501, Demetron Kerr or were allowed to self-cure for 10 min in the dark (n = 5. All specimens were then stored in humidity at 37°C for 24 h in the dark and were subjected to KHN analysis. The results were submitted to 2-way ANOVA and Tukey's post-hoc test at a pre-set alpha of 5%. All the light-activated groups exhibited higher KHN values than the self-cured ones (p = 0.00001, regardless of product. Among the self-cured groups, both composite resin core build-up materials showed higher KHN values than the dual-cured resin cement (p = 0.00001. LuxaCore®-Dual exhibited higher KHN values than FluoroCore®2 (p = 0.00001 when they were allowed to self-cure, while no significant differences in KHN values were observed among the light-activated products. The results suggest that dual-cured composite resin core build-up materials may be more reliable than dual-cured resin cements when curing light is not available.
Directional Emission from Dielectric Leaky-Wave Nanoantennas
Peter, Manuel; Hildebrandt, Andre; Schlickriede, Christian; Gharib, Kimia; Zentgraf, Thomas; Förstner, Jens; Linden, Stefan
2017-07-01
An important source of innovation in nanophotonics is the idea to scale down known radio wave technologies to the optical regime. One thoroughly investigated example of this approach are metallic nanoantennas which employ plasmonic resonances to couple localized emitters to selected far-field modes. While metals can be treated as perfect conductors in the microwave regime, their response becomes Drude-like at optical frequencies. Thus, plasmonic nanoantennas are inherently lossy. Moreover, their resonant nature requires precise control of the antenna geometry. A promising way to circumvent these problems is the use of broadband nanoantennas made from low-loss dielectric materials. Here, we report on highly directional emission from active dielectric leaky-wave nanoantennas made of Hafnium dioxide. Colloidal semiconductor quantum dots deposited in the nanoantenna feed gap serve as a local light source. The emission patterns of active nanoantennas with different sizes are measured by Fourier imaging. We find for all antenna sizes a highly directional emission, underlining the broadband operation of our design.
On the quark structure of resonance states in dual models
International Nuclear Information System (INIS)
Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.
1975-01-01
It is shown using as an example the Veneziano dual model, that each particular dual model already contains a certain latent quark structure unambiauously determined by internal properties of the dual model. To prove this degeneration of the resonance state spectrum is studied by introducing an additional disturbing interaction into the model being considered. Induced transitions of particles into a vacuum act as such an additional disturbance. This method complements the known factorization method of Fubini, Gordon and Veneziano and turns out to be free from an essential limitation of the latter connected with implicit assumption about the basence of internal additive laws of conservation in the model. By using the method of induced transitions of particles into a vacuum it has been possible to show that the resonance state spectrum is indeed more degenerated than it should be expected from the factorization theorem, and that the supplementary degeneration corresponds to the quark model with an infinite number of quarks of the increasing mass. Structures of some terms of the dual amplitude expansion over the degrees of the constant of the induced transition of particles to vacuum are considered; it is shown that the summation of this expansion may be reduced to a solution of a certain integral equation. On the basis of the integral equation obtained an integral representation ofr dual amplitudes is established. The problems related with degeneration of resonance states and with determination of additive quantum numbers leading to the quark interpretation of the degeneration being considered are discussed
Group Velocity for Leaky Waves
Rzeznik, Andrew; Chumakova, Lyubov; Rosales, Rodolfo
2017-11-01
In many linear dispersive/conservative wave problems one considers solutions in an infinite medium which is uniform everywhere except for a bounded region. In general, localized inhomogeneities of the medium cause partial internal reflection, and some waves leak out of the domain. Often one only desires the solution in the inhomogeneous region, with the exterior accounted for by radiation boundary conditions. Formulating such conditions requires definition of the direction of energy propagation for leaky waves in multiple dimensions. In uniform media such waves have the form exp (d . x + st) where d and s are complex and related by a dispersion relation. A complex s is required since these waves decay via radiation to infinity, even though the medium is conservative. We present a modified form of Whitham's Averaged Lagrangian Theory along with modulation theory to extend the classical idea of group velocity to leaky waves. This allows for solving on the bounded region by representing the waves as a linear combination of leaky modes, each exponentially decaying in time. This presentation is part of a joint project, and applications of these results to example GFD problems will be presented by L. Chumakova in the talk ``Leaky GFD Problems''. This work is partially supported by NSF Grants DMS-1614043, DMS-1719637, and 1122374, and by the Hertz Foundation.
Dual resonance models and their currents
International Nuclear Information System (INIS)
Johnson, E.A.
1978-01-01
It is shown how dual resonance models were rederived from the concept of a string tracing out a surface in space-time. Thus, interacting strings reproduce the dual amplitudes. A scheme for tackling the unitarity problem began to develop. As a consistent theory of hadronic processes began to be built, workers at the same time were naturally led to expect that leptons could be included with hadrons in a unified dual theory. Thus, there is a search for dual amplitudes which would describe interactions between hadrons and currents (for example, electrons), as well as interactions involving only hadrons. Such amplitudes, it is believed, will be the correct ones, describing the real world. Such amplitudes will provide valuable information concerning such things as hadronic form factors. The great difficulties in building current-amplitudes with the required properties of proper factorization on a good spectrum, duality, current algebra, and proper asymptotic behavior are described. Dual models at the present time require for consistency, an intercept value of α 0 = 1 and a dimension value of d = 26 (or d = 10). There have been speculations that the unphysical dimension may be made physical by associating the ''extra dimensions'' with certain internal degrees of freedom. However, it is desired that the theory itself, force the dimension d = 4. It is quite possible that the dimension problem and the intercept problem are tied together and that resolving either problem will resolve the other. Order by order, a new dual current is constructed that is manifestly factorizable and which appears to be valid for arbitrary space-time dimension. The fact that this current is not bound at d = 26, leads to interesting speculations on the nature of dual currents
Deng, Wei; Wang, Ya
2017-09-01
This paper reports a dual resonant rectilinear-to-rotary oscillation converter (RROC) for low frequency broadband electromagnetic energy harvesting from ambient vibrations. An approximate theoretical model has been established to integrate the electromechanical coupling into a comprehensive electromagnetic-dynamic model of the dual resonant RROC. Numerical simulation has proved the nature of dual resonances by revealing that both the rectilinear resonance and the rotary resonance could be achieved when the stand-alone rectilinear oscillator (RLO) and the stand-alone rotary oscillator (RTO) were excited independently. Simulation on the magnetically coupled RROC has also shown that the rectilinear resonance and the rotary resonance could be obtained simultaneously in the low-frequency region (2-14 Hz) with well-defined restoring torque (M r ) and the initial rotation angle of the RLO (ψ). The magnetic interaction patterns between the rectilinear and the RTOs have been categorized based on aforementioned simulation results. Both simulation and experimental results have demonstrated broadband output attributing from the dual resonances. Experimental results have also indicated that the RROC could have wide bandwidth in a much lower frequency region (2-8 Hz) even without the rotary resonance as long as the system parameters are carefully tuned. Parameter analysis on different values of M r and ψ are experimentally carried out to provide a quantitative guidance of designing the RROC to achieve an optimal power density.
Ionic core effects on the Mie resonance in lithium clusters
International Nuclear Information System (INIS)
Yabana, K.
1994-01-01
We investigate effects of atomic cores on the Mie resonance in lithium metal clusters, perturbing a helium Hamiltonian with zero-range pseudopotentials. The resonance is red-shifted with respect to the classical formula by core effects, most important of which is the increased effective mass due to the core potentials. Much of the large shift seen in lithium clusters is thereby explained if the strength of the Pseudopotentials is taken from band structure calculations. However, such pseudopotentials cause the resonance to be greatly broadened, contrary to observation
Dual band metamaterial perfect absorber based on Mie resonances
Energy Technology Data Exchange (ETDEWEB)
Liu, Xiaoming; Lan, Chuwen; Li, Bo; Zhou, Ji, E-mail: zhouji@tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Bi, Ke [School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhao, Qian [State Key Lab of Tribology, Department of Precision Instruments and Mechanology, Tsinghua University, Beijing 100084 (China)
2016-08-08
We numerically and experimentally demonstrated a polarization insensitive dual-band metamaterial perfect absorber working in wide incident angles based on the two magnetic Mie resonances of a single dielectric “atom” with simple structure. Two absorption bands with simulated absorptivity of 99% and 96%, experimental absorptivity of 97% and 94% at 8.45 and 11.97 GHz were achieved due to the simultaneous magnetic and electric resonances in dielectric “atom” and copper plate. Mie resonances of dielectric “atom” provide a simple way to design metamaterial perfect absorbers with high symmetry.
Design of a dual linear polarization antenna using split ring resonators at X-band
Ahmed, Sadiq; Chandra, Madhukar
2017-11-01
Dual linear polarization microstrip antenna configurations are very suitable for high-performance satellites, wireless communication and radar applications. This paper presents a new method to improve the co-cross polarization discrimination (XPD) for dual linear polarized microstrip antennas at 10 GHz. For this, three various configurations of a dual linear polarization antenna utilizing metamaterial unit cells are shown. In the first layout, the microstrip patch antenna is loaded with two pairs of spiral ring resonators, in the second model, a split ring resonator is placed between two microstrip feed lines, and in the third design, a complementary split ring resonators are etched in the ground plane. This work has two primary goals: the first is related to the addition of metamaterial unit cells to the antenna structure which permits compensation for an asymmetric current distribution flow on the microstrip antenna and thus yields a symmetrical current distribution on it. This compensation leads to an important enhancement in the XPD in comparison to a conventional dual linear polarized microstrip patch antenna. The simulation reveals an improvement of 7.9, 8.8, and 4 dB in the E and H planes for the three designs, respectively, in the XPD as compared to the conventional dual linear polarized patch antenna. The second objective of this paper is to present the characteristics and performances of the designs of the spiral ring resonator (S-RR), split ring resonator (SRR), and complementary split ring resonator (CSRR) metamaterial unit cells. The simulations are evaluated using the commercial full-wave simulator, Ansoft High-Frequency Structure Simulator (HFSS).
Directory of Open Access Journals (Sweden)
Billy W. Day
2010-11-01
Full Text Available Biosensors have been used extensively in the scientific community for several purposes, most notably to determine association and dissociation kinetics, protein-ligand, protein-protein, or nucleic acid hybridization interactions. A number of different types of biosensors are available in the field, each with real or perceived benefits over the others. This review discusses the basic theory and operational arrangements of four commercially available types of optical biosensors: surface plasmon resonance, resonant mirror, resonance waveguide grating, and dual polarization interferometry. The different applications these techniques offer are discussed from experiments and results reported in recently published literature. Additionally, recent advancements or modifications to the current techniques are also discussed.
Analysis of Leaky Modes in Photonic Crystal Fibers Using the Surface Integral Equation Method
Directory of Open Access Journals (Sweden)
Jung-Sheng Chiang
2018-04-01
Full Text Available A fully vectorial algorithm based on the surface integral equation method for the modelling of leaky modes in photonic crystal fibers (PCFs by solely solving the complex propagation constants of characteristic equations is presented. It can be used for calculations of the complex effective index and confinement losses of photonic crystal fibers. As complex root examination is the key technique in the solution, the new algorithm which possesses this technique can be used to solve the leaky modes of photonic crystal fibers. The leaky modes of solid-core PCFs with a hexagonal lattice of circular air-holes are reported and discussed. The simulation results indicate how the confinement loss by the imaginary part of the effective index changes with air-hole size, the number of rings of air-holes, and wavelength. Confinement loss reductions can be realized by increasing the air-hole size and the number of air-holes. The results show that the confinement loss rises with wavelength, implying that the light leaks more easily for longer wavelengths; meanwhile, the losses are decreased significantly as the air-hole size d/Λ is increased.
Leaky feeder: the communication backbone
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-01-01
The need to communicate with all areas of the underground operation in monitoring the movement of men, materials and vehicles, as well as the optimum performance of conveyor systems, has been effectively met with the installation of a Flexcom leaky feeder cable network at a coliery in Mpumalanga. Installed by the South African subsidiary of Mine Radio Systems (MRS), based in Canada, Flexcom is an RF communications highway for underground mines. The system can provide up to 32 voice/data control channels and up to 16 video channels, all operating simultaneously. The system uses a series of bi-directional amplifiers (or signal boosters) spaced at 350 m intervals along the leaky feeder cable, with branching units and termination units added as required. Communication is possible within 50 m of the leaky feeder cable. MRS has 11 conveyors monitored via the SCADA program at the mine and the system produces reports as required which are accessible via cellphone from anywhere in the world. The wireless monitoring of miners and equipment contributes to mine safety. 3 figs.
Ellipsoidal all-dielectric Fano resonant core-shell metamaterials
Reena, Reena; Kalra, Yogita; Kumar, Ajeet
2018-06-01
In this paper, ellipsoidal core (Si) and shell (SiO2) metamaterial has been proposed for highly directional properties. At the wavelength of magnetic resonance, Fano dip occurs in the backward scattering cross section and forward scattering enhancement takes place at the same wavelength so that there is an increment in the directivity. Effect on the directivity by changing the length of ellipsoidal nanoparticle along semi-axes has been analyzed. Two Fano resonances have been observed by decreasing the length of the nanoparticle along the semi-axis having electric polarization, where first and second Fano resonances are attributed to the dipole and quadrupole moments, respectively. These Fano resonant wavelengths in ellipsoidal nanoparticle exhibit higher directivity than the Kerker's type scattering or forward scattering shown by symmetrical structures like sphere. So, this core-shell metamaterial can act as an efficient directional nanoantenna.
Interacting-string picture of dual-resonance models
International Nuclear Information System (INIS)
Mandelstam, S.
1985-01-01
Dual-resonance models are an alyzed by means of operators which act within the physical Hilbert space of positive-metric states. The basis of the method is to extend the relativistic-string picture of a previous study to interacting particles. Functional methods are used, but their relation to the operator is evident, and factorization is maintained. An expression is given for the N-point amplitude in terms of physical-particle operators. For the three-point function the Neumann functions which occur in this expression are evaluated, so that we have a formula for the on- and off-energy-shell vertex. The authors assume that the string has no longitudinal degrees of freedom, and their results are Lorentz invariant and dual only if d=26
Gong, Jianxiao; Zhou, Fei; Li, Zhiyuan; Tang, Zhiyong
2012-06-19
We have synthesized Au@Ag core-shell nanocubes containing Au cores with varying shapes and sizes through modified seed-mediated methods. Bromide ions are found to be crucial in the epitaxial growth of Ag atoms onto Au cores and in the formation of the shell's cubic shape. The Au@Ag core-shell nanocubes exhibit very abundant and distinct localized surface plasmon resonance (LSPR) properties, which are core-shape and size-dependent. With the help of theoretical calculation, the physical origin and the resonance mode profile of each LSPR peak are identified and studied. The core-shell nanocrystals with varying shaped cores offer a new rich category for LSPR control through the plasmonic coupling effect between core and shell materials.
Characterization of leaky faults
International Nuclear Information System (INIS)
Shan, Chao.
1990-05-01
Leaky faults provide a flow path for fluids to move underground. It is very important to characterize such faults in various engineering projects. The purpose of this work is to develop mathematical solutions for this characterization. The flow of water in an aquifer system and the flow of air in the unsaturated fault-rock system were studied. If the leaky fault cuts through two aquifers, characterization of the fault can be achieved by pumping water from one of the aquifers, which are assumed to be horizontal and of uniform thickness. Analytical solutions have been developed for two cases of either a negligibly small or a significantly large drawdown in the unpumped aquifer. Some practical methods for using these solutions are presented. 45 refs., 72 figs., 11 tabs
Song, Hyon-Min; Wei, Qingshan; Ong, Quy K; Wei, Alexander
2010-09-28
Plasmon-resonant gold nanostars (NSTs) with magnetic cores were synthesized by a multistep sequence from superparamagnetic Fe3O4 nanoparticles (NPs) and evaluated as optical contrast agents under magnetomotive (MM) imaging conditions. Core-shell Fe3O4@Au NPs were prepared in nonpolar organic solvents with nanometer control over shell thickness and with good epitaxy to the Fe3O4 surface. Anisotropic growth was performed in micellar solutions of cetyltrimethylammonium bromide (CTAB) under mildly reducing conditions, resulting in NSTs with physical features similar to those produced from colloidal gold seeds. NSTs could be produced below 100 nm from tip to tip, but seed size had a significant impact on growth habit, with larger seed particles producing submicrometer-sized "morning stars". Both NSTs and aggregated core-shell NPs are responsive to in-plane magnetic field gradients and can provide enhanced near-infrared (NIR) contrast under MM conditions, but do so by different mechanisms. NSTs can modulate polarized NIR scattering with minimal translational motion, giving the appearance of a periodic but stationary "blinking", whereas core-shell NP aggregates require lateral displacement for signal modulation. The polarization-sensitive MM imaging modality offers the dual advantage of enhanced signal quality and reduced background signal and can be applied toward the detection of magnetomotive NSTs in heterogeneous biological samples, as illustrated by their detection inside of granular cells such as macrophages.
International Nuclear Information System (INIS)
Kirch, J. D.; Chang, C.-C.; Boyle, C.; Mawst, L. J.; Botez, D.; Lindberg, D.; Earles, T.
2015-01-01
Five, 8.36 μm-emitting quantum-cascade lasers (QCLs) have been monolithically phase-locked in the in-phase array mode via resonant leaky-wave coupling. The structure is fabricated by etch and regrowth which provides large index steps (Δn = 0.10) between antiguided-array elements and interelement regions. Such high index contrast photonic-crystal (PC) lasers have more than an order of magnitude higher index contrast than PC-distributed feedback lasers previously used for coherent beam combining in QCLs. Absorption loss to metal layers inserted in the interelement regions provides a wide (∼1.0 μm) range in interelement width over which the resonant in-phase mode is strongly favored to lase. Room-temperature, in-phase-mode operation with ∼2.2 kA/cm 2 threshold-current density is obtained from 105 μm-wide aperture devices. The far-field beam pattern has lobewidths 1.65× diffraction limit (D.L.) and 82% of the light in the main lobe, up to 1.8× threshold. Peak pulsed near-D.L. power of 5.5 W is obtained, with 4.5 W emitted in the main lobe. Means of how to increase the device internal efficiency are discussed
A Dual-Core System Solution for Wearable Health Monitors
Santana Arnaiz, O.A.; Bouwens, F.; Huisken, J.A.; De Groot, H.; Bennebroek, M.T.; Van Meerbergen, J.L.; Abbo, A.A.; Fraboulet, A.
2011-01-01
This paper presents a system design study for wearable sensor devices intended for healthcare and lifestyle applications based on ECG,EEG and activity monitoring. In order to meet the low-power requirement of these applications, a dual-core signal processing system is proposed which combines an
Design of ultrathin dual-resonant reflective polarization converter with customized bandwidths
Kundu, Debidas; Mohan, Akhilesh; Chakrabarty, Ajay
2017-10-01
In this paper, an ultrathin dual-resonant reflective polarization converter is proposed to obtain customized bandwidths using precise space-filling technique to its top geometry. The unit cell of the dual-resonant prototype consists of conductive square ring with two diagonally arranged slits, supported by metal-backed thin dielectric layer. It offers two narrow bands with fractional bandwidths of 3.98 and 6.65% and polarization conversion ratio (PCR) of 97.16 and 98.87% at 4.52 and 6.97 GHz, respectively. The resonances are brought in proximity to each other by changing the length of surface current paths of the two resonances. By virtue of this mechanism, two polarization converters with two different types of bandwidths are obtained. One polarization converter produces a full-width at half-maxima PCR bandwidth of 34%, whereas another polarization converter produces a 90% PCR bandwidth of 19%. All the proposed polarization converters are insensitive to wide variations of incident angle for both TE- and TM-polarized incident waves. Measured results show good agreement with the numerically simulated results.
Soliton-based ultrafast multi-wavelength nonlinear switching in dual-core photonic crystal fibre
International Nuclear Information System (INIS)
Stajanca, P; Pysz, D; Michalka, M; Bugar, I; Andriukaitis, G; Balciunas, T; Fan, G; Baltuska, A
2014-01-01
Systematic experimental study of ultrafast multi-wavelength all-optical switching performance in a dual-core photonic crystal fibre is presented. The focus is on nonlinearly induced switching between the two output ports at non-excitation wavelengths, which are generated during nonlinear propagation of femtosecond pulses in the anomalous dispersion region of a dual-core photonic crystal fibre made of multicomponent glass. Spatial and spectral characteristics of the fibre output radiation were measured separately for both fibre cores under various polarization and intensity conditions upon selective, individual excitation of each fibre core. Polarization-controlled nonlinear switching performance at multiple non-excitation wavelengths was demonstrated in the long-wavelength optical communication bands and beyond. Depending on the input pulse polarization, narrowband switching operation at 1560 nm and 1730 nm takes place with double core extinction ratio contrasts of 9 dB and 14.5 dB, respectively. Moreover, our approach allows switching with simultaneous wavelength shift from 1650 to 1775 nm with extinction ratio contrast larger than 18 dB. In addition, non-reciprocal behaviour of the soliton fission process under different fibre core excitations was observed and its effect on the multi-wavelength nonlinear switching performance was explained, taking into account the slight dual-core structure asymmetry. The obtained results represent ultrafast all-optical switching with an extended dimension of wavelength shift, controllable with both the input radiation intensity and the polarization by simple propagation along a 14 mm long fibre. (paper)
Leaky coaxial cable signal transmission for remote facilities
Smith, S. F.; Crutcher, R. I.
To develop reliable communications methods to meet the rigorous requirements for nuclear hot cells and similar environments, including control of cranes, transporters, and advanced servomanipulators, the Consolidated Fuel Reprocessing Program (CFRP) at Oak Ridge National Laboratory (ORNL) has conducted extensive tests of numerous technologies to determine their applicability to remote operations. To alleviate the need for large bundles of cables that must accommodate crane/transporter motion relative to the boundaries of the cell, several transmission techniques are available, including slotted-line radio-frequency couplers, infrared beams, fiber-optic cables, free-space microwave, and inductively coupled leaky coaxial cable. This paper discusses the general characteristics, mode of operation, and proposed implementation of leaky coaxial cable technology in a waste-handling facility scheduled to be built in the near future at ORNL. In addition, specific system hardware based around the use of leaky coaxial cable is described in detail. Finally, data from a series of radiation exposure tests conducted by the CFRP on several samples of the basic leaky coaxial cable and associated connectors are presented.
Subsonic leaky Rayleigh waves at liquid-solid interfaces.
Mozhaev, V G; Weihnacht, M
2002-05-01
The paper is devoted to the study of leaky Rayleigh waves at liquid-solid interfaces close to the border of the existence domain of these modes. The real and complex roots of the secular equation are computed for interface waves at the boundary between water and a binary isotropic alloy of gold and silver with continuously variable composition. The change of composition of the alloy allows one to cross a critical velocity for the existence of leaky waves. It is shown that, contrary to popular opinion, the critical velocity does not coincide with the phase velocity of bulk waves in liquid. The true threshold velocity is found to be smaller, the correction being of about 1.45%. Attention is also drawn to the fact that using the real part of the complex phase velocity as a velocity of leaky waves gives only approximate value. The most interesting feature of the waves under consideration is the presence of energy leakage in the subsonic range of the phase velocities where, at first glance, any radiation by harmonic waves is not permitted. A simple physical explanation of this radiation with due regard for inhomogeneity of radiated and radiating waves is given. The controversial question of the existence of leaky Rayleigh waves at a water/ice interface is reexamined. It is shown that the solution considered previously as a leaky wave is in fact the solution of the bulk-wave-reflection problem for inhomogeneous waves.
360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Xue, Weiqi; Liu, Liu
2010-01-01
We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...
The early years of string theory: The dual resonance model
International Nuclear Information System (INIS)
Ramond, P.
1987-10-01
This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story
Analysis and design of efficient planar leaky-wave antennas
Ettore, M.
2008-01-01
This thesis deals with the effective design of planar leaky-wave antennas. The work describes a methodology based on the polar expansion of Green's function representations to address very different geometrical configurations which might appear to have little in common. In fact leaky waves with
Topologically-protected one-way leaky waves in nonreciprocal plasmonic structures
Hassani Gangaraj, S. Ali; Monticone, Francesco
2018-03-01
We investigate topologically-protected unidirectional leaky waves on magnetized plasmonic structures acting as homogeneous photonic topological insulators. Our theoretical analyses and numerical experiments aim at unveiling the general properties of these exotic surface waves, and their nonreciprocal and topological nature. In particular, we study the behavior of topological leaky modes in stratified structures composed of a magnetized plasma at the interface with isotropic conventional media, and we show how to engineer their propagation and radiation properties, leading to topologically-protected backscattering-immune wave propagation, and highly directive and tunable radiation. Taking advantage of the non-trivial topological properties of these leaky modes, we also theoretically demonstrate advanced functionalities, including arbitrary re-routing of leaky waves on the surface of bodies with complex shapes, as well as the realization of topological leaky-wave (nano)antennas with isolated channels of radiation that are completely independent and separately tunable. Our findings help shedding light on the behavior of topologically-protected modes in open wave-guiding structures, and may open intriguing directions for future antenna generations based on topological structures, at microwaves and optical frequencies.
Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Liu, Liu; Xue, Weiqi
2010-01-01
We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator...
Simpson's Paradox in the Interpretation of "Leaky Pipeline" Data
Walton, Paul H.; Walton, Daniel J.
2016-01-01
The traditional "leaky pipeline" plots are widely used to inform gender equality policy and practice. Herein, we demonstrate how a statistical phenomenon known as Simpson's paradox can obscure trends in gender "leaky pipeline" plots. Our approach has been to use Excel spreadsheets to generate hypothetical "leaky…
International Nuclear Information System (INIS)
Frazão, O; Silva, S F; Viegas, J; Baptista, J M; Santos, J L; Roy, P
2010-01-01
A hybrid Fabry–Perot/Michelson interferometer sensor using a dual asymmetric core microstructured fiber is demonstrated. The hybrid interferometer presents three waves. Two parallel Fabry–Perot cavities with low finesse are formed between the splice region and the end of a dual-core microstructured fiber. A Michelson configuration is obtained by the two small cores of the microstructured fiber. The spectral response of the hybrid interferometer presents two pattern fringes with different frequencies due to the respective optical path interferometers. The hybrid interferometer was characterized in strain and temperature presenting different sensitivity coefficients for each topology. Due to these characteristics, this novel sensing head is able to measure strain and temperature, simultaneously
Experimental evidence for dual diffractive resonances in nucleon-nucleus scattering
International Nuclear Information System (INIS)
Ion, D.B.; Ion-Mihai, R.
1981-09-01
Experimental data on nucleon-nucleus scattering for laboratory momenta between 0.9:10 GeV/c are analysed in terms of the dual diffractive resonance (DDR) mechanism. The experimental data for all the nuclei are found to agree well with the predictions of the collective DDR states dominance. (authors)
Modelling and simulation of a thermally induced optical transparency in a dual micro-ring resonator.
Lydiate, Joseph
2017-07-01
This paper introduces the simulation and modelling of a novel dual micro-ring resonator. The geometric configuration of the resonators, and the implementation of a simulated broadband excitation source, results in the realization of optical transparencies in the combined through port output spectrum. The 130 nm silicon on insulator rib fabrication process is adopted for the simulation of the dual-ring configuration. Two titanium nitride heaters are positioned over the coupling regions of the resonators, which can be operated independently, to control the spectral position of the optical transparency. A third heater, centrally located above the dual resonator rings, can be used to red shift the entire spectrum to a required reference resonant wavelength. The free spectral range with no heater currents applied is 4.29 nm. For a simulated heater current of 7 mA (55.7 mW heater power) applied to one of the through coupling heaters, the optical transparency exhibits a red shift of 1.79 nm from the reference resonant wavelength. The ring-to-ring separation of approximately 900 nm means that it can be assumed that there is a zero ring-to-ring coupling field in this model. This novel arrangement has potential applications as a gas mass airflow sensor or a gas species identification sensor.
Dual and tri-band bandpass filters based on novel Π-shaped resonator
Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei
2014-05-01
A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.
Reduced thermal sensitivity of hybrid air-core photonic band-gap fiber ring resonator
Feng, Li-shuang; Wang, Kai; Jiao, Hong-chen; Wang, Jun-jie; Liu, Dan-ni; Yang, Zhao-hua
2018-01-01
A novel hybrid air-core photonic band-gap fiber (PBF) ring resonator with twin 90° polarization-axis rotated splices is proposed and demonstrated. Frist, we measure the temperature dependent birefringence coefficient of air-core PBF and Panda fiber. Experimental results show that the relative temperature dependent birefringence coefficient of air-core PBF is 1.42×10-8/°C, which is typically 16 times less than that of Panda fiber. Then, we extract the geometry profile of air-core PBF from scanning electron microscope (SEM) images. Numerical modal is built to distinguish the fast axis and slow axis in the fiber. By precisely setting the length difference in air-core PBF and Panda fiber between two 90° polarization-axis rotated splicing points, the hybrid air-core PBF ring resonator is constructed, and the finesse of the resonator is 8.4. Environmental birefringence variation induced by temperature change can be well compensated, and experimental results show an 18-fold reduction in thermal sensitivity, compared with resonator with twin 0° polarization-axis rotated splices.
Dynamic stability analysis of fractional order leaky integrator echo state neural networks
Pahnehkolaei, Seyed Mehdi Abedi; Alfi, Alireza; Tenreiro Machado, J. A.
2017-06-01
The Leaky integrator echo state neural network (Leaky-ESN) is an improved model of the recurrent neural network (RNN) and adopts an interconnected recurrent grid of processing neurons. This paper presents a new proof for the convergence of a Lyapunov candidate function to zero when time tends to infinity by means of the Caputo fractional derivative with order lying in the range (0, 1). The stability of Fractional-Order Leaky-ESN (FO Leaky-ESN) is then analyzed, and the existence, uniqueness and stability of the equilibrium point are provided. A numerical example demonstrates the feasibility of the proposed method.
Simpson’s Paradox in the interpretation of “leaky pipeline” data
Directory of Open Access Journals (Sweden)
Walton Paul H.
2016-12-01
Full Text Available The traditional ‘leaky pipeline’ plots are widely used to inform gender equality policy and practice. Herein, we demonstrate how a statistical phenomenon known as Simpson’s paradox can obscure trends in gender ‘leaky pipeline’ plots. Our approach has been to use Excel spreadsheets to generate hypothetical ‘leaky pipeline’ plots of gender inequality within an organisation. The principal factors, which make up these hypothetical plots, can be input into the model so that a range of potential situations can be modelled. How the individual principal factors are then reflected in ‘leaky pipeline’ plots is shown. We find that the effect of Simpson’s paradox on leaky pipeline plots can be simply and clearly illustrated with the use of hypothetical modelling and our study augments the findings in other statistical reports of Simpson’s paradox in clinical trial data and in gender inequality data. The findings in this paper, however, are presented in a way, which makes the paradox accessible to a wide range of people.
Sliding-Mode Control to Compensate PVT Variations in Dual Core Systems
Pourshaghaghi, H.R.; Fatemi, S.H.; Pineda de Gyvez, J.
2012-01-01
In this paper, we present a novel robust sliding-mode controller for stabilizing supply voltage and clock frequency of dual core processors determined by dynamic voltage and frequency scaling (DVFS) methods in the presence of systematic and random variations. We show that maximum rejection for
Modelling and analysis of the transformer current resonance in dual active bridge converters
DEFF Research Database (Denmark)
Qin, Zian; Shen, Zhan; Blaabjerg, Frede
2017-01-01
Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency....... In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model...
Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation
Energy Technology Data Exchange (ETDEWEB)
Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)
2017-12-15
Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)
Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation
International Nuclear Information System (INIS)
Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian
2017-01-01
Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)
Leaky Gut As a Danger Signal for Autoimmune Diseases
Directory of Open Access Journals (Sweden)
Qinghui Mu
2017-05-01
Full Text Available The intestinal epithelial lining, together with factors secreted from it, forms a barrier that separates the host from the environment. In pathologic conditions, the permeability of the epithelial lining may be compromised allowing the passage of toxins, antigens, and bacteria in the lumen to enter the blood stream creating a “leaky gut.” In individuals with a genetic predisposition, a leaky gut may allow environmental factors to enter the body and trigger the initiation and development of autoimmune disease. Growing evidence shows that the gut microbiota is important in supporting the epithelial barrier and therefore plays a key role in the regulation of environmental factors that enter the body. Several recent reports have shown that probiotics can reverse the leaky gut by enhancing the production of tight junction proteins; however, additional and longer term studies are still required. Conversely, pathogenic bacteria that can facilitate a leaky gut and induce autoimmune symptoms can be ameliorated with the use of antibiotic treatment. Therefore, it is hypothesized that modulating the gut microbiota can serve as a potential method for regulating intestinal permeability and may help to alter the course of autoimmune diseases in susceptible individuals.
Nazari, Tavakol; Khazaeinezhad, Reza; Jung, Woohyun; Joo, Boram; Kong, Byung-Joo; Oh, Kyunghwan
2015-07-13
Dual resonant bands in UV and the visible range were simultaneously observed in the enhanced optical transmission (EOT) through star-shaped plasmonic structures. EOTs through four types of polygonal bull's eyes with a star aperture surrounded by the concentric star grooves were analyzed and compared for 3, 4, 5, and 6 corners, using finite difference time domain (FDTD) method. In contrast to plasmonic resonances in the visible range, the UV-band resonance intensity was found to scale with the number of corners, which is related with higher order multipole interactions. Spectral positions and relative intensities of the dual resonances were analyzed parametrically to find optimal conditions to maximize EOT in UV-visible dual bands.
Zhang, Yulong; Wang, Tianyang; Zhang, Ai; Peng, Zhuoteng; Luo, Dan; Chen, Rui; Wang, Fei
2016-12-01
In this paper, we present design and test of a broadband electrostatic energy harvester with a dual resonant structure, which consists of two cantilever-mass subsystems each with a mass attached at the free edge of a cantilever. Comparing to traditional devices with single resonant frequency, the proposed device with dual resonant structure can resonate at two frequencies. Furthermore, when one of the cantilever-masses is oscillating at resonance, the vibration amplitude is large enough to make it collide with the other mass, which provides strong mechanical coupling between the two subsystems. Therefore, this device can harvest a decent power output from vibration sources at a broad frequency range. During the measurement, continuous power output up to 6.2-9.8 μW can be achieved under external vibration amplitude of 9.3 m/s 2 at a frequency range from 36.3 Hz to 48.3 Hz, which means the bandwidth of the device is about 30% of the central frequency. The broad bandwidth of the device provides a promising application for energy harvesting from the scenarios with random vibration sources. The experimental results indicate that with the dual resonant structure, the vibration-to-electricity energy conversion efficiency can be improved by 97% when an external random vibration with a low frequency filter is applied.
SIMULATION OF CHARACTERISTICS OF DUAL-CORE PHASE SHIFTING TRANSFORMER
Directory of Open Access Journals (Sweden)
Kalinin L.P.
2014-04-01
Full Text Available The role and importance of phase shifting transformers are increased as a result of the further development of integrated power systems. This gives the rise to new technical solutions which entails the necessity of comparison of new developments with existing. The article consider the technical characteristics of dual-core phase shifting transformer which later will be used as a basis for comparison with other competing options and assess of their technical efficiency.
The Ultrawideband Leaky Lens Antenna
Bruni, S.; Neto, A.; Marliani, F.
2007-01-01
A novel directive and nondispersive antenna is presented: the ultrawideband (UWB) leaky lens. It is based on the broad band Cherenkov radiation occurring at a slot printed between different infinite homogeneous dielectrics. The first part of the paper presents the antenna concept and the UWB design.
International Nuclear Information System (INIS)
Jang, Haeyun; Lee, Chaedong; Nam, Gi-Eun; Quan, Bo; Choi, Hyuck Jae; Yoo, Jung Sun; Piao, Yuanzhe
2016-01-01
The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex ® with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.
Energy Technology Data Exchange (ETDEWEB)
Jang, Haeyun; Lee, Chaedong [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Nam, Gi-Eun [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Quan, Bo [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Choi, Hyuck Jae [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Yoo, Jung Sun [Seoul National University, Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Smart Humanity Convergence Center (Korea, Republic of); Piao, Yuanzhe, E-mail: parkat9@snu.ac.kr [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of)
2016-02-15
The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex{sup ®} with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.
Dual-mode plasmonic nanorod type antenna based on the concept of a trapped dipole.
Panaretos, Anastasios H; Werner, Douglas H
2015-04-06
In this paper we theoretically investigate the feasibility of creating a dual-mode plasmonic nanorod antenna. The proposed design methodology relies on adapting to optical wavelengths the principles of operation of trapped dipole antennas, which have been widely used in the low MHz frequency range. This type of antenna typically employs parallel LC circuits, also referred to as "traps", which are connected along the two arms of the dipole. By judiciously choosing the resonant frequency of these traps, as well as their position along the arms of the dipole, it is feasible to excite the λ/2 resonance of both the original dipole as well as the shorter section defined by the length of wire between the two traps. This effectively enables the dipole antenna to have a dual-mode of operation. Our analysis reveals that the implementation of this concept at the nanoscale requires that two cylindrical pockets (i.e. loading volumes) be introduced along the length of the nanoantenna, inside which plasmonic core-shell particles are embedded. By properly selecting the geometry and constitution of the core-shell particle as well as the constitution of the host material of the two loading volumes and their position along the nanorod, the equivalent effect of a resonant parallel LC circuit can be realized. This effectively enables a dual-mode operation of the nanorod antenna. The proposed methodology introduces a compact approach for the realization of dual-mode optical sensors while at the same time it clearly illustrates the inherent tuning capabilities that core-shell particles can offer in a practical framework.
International Nuclear Information System (INIS)
Fan Zhen-Kai; Li Shu-Guang; Fan Yu-Qiu; Zhang Wan; An Guo-Wen; Bao Ya-Jie
2014-01-01
We design a novel kind of polarization beam splitter based on a gold-filled dual-core photonic crystal fiber (DC-PCF). Owing to filling with two gold wires in this DC-PCF, its coupling characteristics can be changed greatly by the second-order surface plasmon polariton (SPP) and the resonant coupling between the surface plasmon modes and the fiber-core guided modes can enhance the directional power transfer in the two fiber-cores. Numerical results by using the finite element method show the extinction ratio at the wavethlengths of 1.327 μm and 1.55 μm can reach −58 dB and −60 dB and the bandwidths as the extinction ratio better than −12 dB are about 54 nm and 47 nm, respectively. Compared with the gold-unfilled DC-PCF, a 1.746-mm-long gold-filled DC-PCF is better applied to the polarization beam splitter in the two communication bands of λ = 1.327 μm and 1.55 μm. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Li, Guo-Yang; Xu, Guoqiang; Zheng, Yang; Cao, Yanping
2018-03-01
Surface acoustic wave (SAW) devices have found a wide variety of technical applications, including SAW filters, SAW resonators, microfluidic actuators, biosensors, flow measurement devices, and seismic wave shields. Stretchable/flexible electronic devices, such as sensory skins for robotics, structural health monitors, and wearable communication devices, have received considerable attention across different disciplines. Flexible SAW devices are essential building blocks for these applications, wherein piezoelectric films may need to be integrated with the compliant substrates. When piezoelectric films are much stiffer than soft substrates, SAWs are usually leaky and the devices incorporating them suffer from acoustic losses. In this study, the propagation of SAWs in a wrinkled bilayer system is investigated, and our analysis shows that non-leaky modes can be achieved by engineering stress patterns through surface wrinkles in the system. Our analysis also uncovers intriguing bandgaps (BGs) related to the SAWs in a wrinkled bilayer system; these are caused by periodic deformation patterns, which indicate that diverse wrinkling patterns could be used as metasurfaces for controlling the propagation of SAWs.
Curvature and position of nested tubes in hollow-core anti-resonant fibers
DEFF Research Database (Denmark)
Habib, Md Selim; Markos, Christos; Bang, Ole
2017-01-01
Hollow-core anti-resonant (HC-AR) fibers where a symmetric distribution of cladding tubes compose a “negative-curvature” core boundary have extraordinary optical properties, such as low transmission loss, wide transmission bands and weak power overlap between the core modes and the silica parts [1...
Atoche, Alejandro Castillo; Castillo, Javier Vázquez
2012-01-01
A high-speed dual super-systolic core for reconstructive signal processing (SP) operations consists of a double parallel systolic array (SA) machine in which each processing element of the array is also conceptualized as another SA in a bit-level fashion. In this study, we addressed the design of a high-speed dual super-systolic array (SSA) core for the enhancement/reconstruction of remote sensing (RS) imaging of radar/synthetic aperture radar (SAR) sensor systems. The selected reconstructive SP algorithms are efficiently transformed in their parallel representation and then, they are mapped into an efficient high performance embedded computing (HPEC) architecture in reconfigurable Xilinx field programmable gate array (FPGA) platforms. As an implementation test case, the proposed approach was aggregated in a HW/SW co-design scheme in order to solve the nonlinear ill-posed inverse problem of nonparametric estimation of the power spatial spectrum pattern (SSP) from a remotely sensed scene. We show how such dual SSA core, drastically reduces the computational load of complex RS regularization techniques achieving the required real-time operational mode. PMID:22736964
International Nuclear Information System (INIS)
Bora, B.; Bhuyan, H.; Favre, M.; Wyndham, E.; Chuaqui, H.
2012-01-01
Plasma series resonance (PSR) effect is well known in geometrically asymmetric capacitively couple radio frequency plasma. However, plasma series resonance effect in geometrically symmetric plasma has not been properly investigated. In this work, a theoretical approach is made to investigate the plasma series resonance effect and its influence on Ohmic and stochastic heating in geometrically symmetric discharge. Electrical asymmetry effect by means of dual frequency voltage waveform is applied to excite the plasma series resonance. The results show considerable variation in heating with phase difference between the voltage waveforms, which may be applicable in controlling the plasma parameters in such plasma.
Modulational Instability in Linearly Coupled Asymmetric Dual-Core Fibers
Directory of Open Access Journals (Sweden)
Arjunan Govindarajan
2017-06-01
Full Text Available We investigate modulational instability (MI in asymmetric dual-core nonlinear directional couplers incorporating the effects of the differences in effective mode areas and group velocity dispersions, as well as phase- and group-velocity mismatches. Using coupled-mode equations for this system, we identify MI conditions from the linearization with respect to small perturbations. First, we compare the MI spectra of the asymmetric system and its symmetric counterpart in the case of the anomalous group-velocity dispersion (GVD. In particular, it is demonstrated that the increase of the inter-core linear-coupling coefficient leads to a reduction of the MI gain spectrum in the asymmetric coupler. The analysis is extended for the asymmetric system in the normal-GVD regime, where the coupling induces and controls the MI, as well as for the system with opposite GVD signs in the two cores. Following the analytical consideration of the MI, numerical simulations are carried out to explore nonlinear development of the MI, revealing the generation of periodic chains of localized peaks with growing amplitudes, which may transform into arrays of solitons.
Observation of the Earth liquid core resonance by extensometers
Bán, Dóra; Mentes, Gyula
2016-04-01
The axis of the fluid outer core of the Earth and the rotation axis of the mantle do not coincide therefore restoring forces are set up at the core-mantle boundary which try to realign the two axes causing a resonance effect. In celestial reference system it is called the "Free Core Nutation" (FCN), which can be characterized by a period of 432 days while in the Earth reference system it is called the "Nearly Diurnal Free Wobble" (NDFW). The frequency of this phenomenon is near to the diurnal tidal frequencies, especially to P1 and K1 waves. Due to its resonance effect this phenomenon can be detected also by quartz tube extensometers suitable for Earth tides recording. In this study data series measured in several extensometric stations were used to reveal the presence of the FCN resonance. In the Pannonian Basin there are five observatories where extensometric measurements were carried out in different lengths of time. Four stations in Hungary: Sopronbánfalva Geodynamical Observatory (2000-2014), Budapest Mátyáshegy Gravity and Geodynamic Observatory (2005-2012), Pécs uranium mine (1991-1999), Bakonya, near to Pécs (2004-2005) and in Slovakia: Vyhne Earth Tide Observatory (2001-2013). Identical instrumentation in different observatories provides the opportunity to compare measurements with various topography, geology and environmental parameters. The results are also compared to values inferred from extensometric measurements in other stations.
Focusing Leaky Waves: A Class of Electromagnetic Localized Waves with Complex Spectra
Fuscaldo, Walter; Comite, Davide; Boesso, Alessandro; Baccarelli, Paolo; Burghignoli, Paolo; Galli, Alessandro
2018-05-01
Localized waves, i.e., the wide class of limited-diffraction, limited-dispersion solutions to the wave equation are generally characterized by real wave numbers. We consider the role played by localized waves with generally complex "leaky" wave numbers. First, the impact of the imaginary part of the wave number (i.e., the leakage constant) on the diffractive (spatial broadening) features of monochromatic localized solutions (i.e., beams) is rigorously evaluated. Then general conditions are derived to show that only a restricted class of spectra (either real or complex) allows for generating a causal localized wave. It turns out that backward leaky waves fall into this category. On this ground, several criteria for the systematic design of wideband radiators, namely, periodic radial waveguides based on backward leaky waves, are established in the framework of leaky-wave theory. An effective design method is proposed to minimize the frequency dispersion of the proposed class of devices and the impact of the "leakage" on the dispersive (temporal broadening) features of polychromatic localized solutions (i.e., pulses) is accounted for. Numerical results corroborate the concept, clearly highlighting the advantages and limitations of the leaky-wave approach for the generation of localized pulses at millimeter-wave frequencies, where energy focusing is in high demand in modern applications.
Curilla, L.; Astrauskas, I.; Pugzlys, A.; Stajanca, P.; Pysz, D.; Uherek, F.; Baltuska, A.; Bugar, I.
2018-05-01
We demonstrate ultrafast soliton-based nonlinear balancing of dual-core asymmetry in highly nonlinear photonic crystal fiber at sub-nanojoule pulse energy level. The effect of fiber asymmetry was studied experimentally by selective excitation and monitoring of individual fiber cores at different wavelengths between 1500 nm and 1800 nm. Higher energy transfer rate to non-excited core was observed in the case of fast core excitation due to nonlinear asymmetry balancing of temporal solitons, which was confirmed by the dedicated numerical simulations based on the coupled generalized nonlinear Schrödinger equations. Moreover, the simulation results correspond qualitatively with the experimentally acquired dependences of the output dual-core extinction ratio on excitation energy and wavelength. In the case of 1800 nm fast core excitation, narrow band spectral intensity switching between the output channels was registered with contrast of 23 dB. The switching was achieved by the change of the excitation pulse energy in sub-nanojoule region. The performed detailed analysis of the nonlinear balancing of dual-core asymmetry in solitonic propagation regime opens new perspectives for the development of ultrafast nonlinear all-optical switching devices.
Dual-band reflective polarization converter based on slotted wire resonators
Li, Fengxia; Zhang, Linbo; Zhou, Peiheng; Chen, Haiyan; Zhao, Rui; Zhou, Yang; Liang, Difei; Lu, Haipeng; Deng, Longjiang
2018-02-01
A dual-band and high-efficiency reflective linear polarization converter composed of a layer of slotted metal wires has been proposed. Both the simulated and experimental results indicate that the structure can convert a linearly polarized wave to its cross-polarized state for two distinct frequency bands under normal incidence: 9.8-15.1 and 19.2-25.7 GHz. This phenomenon is attributed to a resonance that corresponds to the "trapped mode" at 15.8 GHz. This mode is stable with structural parameters and incident angle at a relatively wide range, and thus becomes promising for dual-band (also multiband) devices design. By surface current distribution and electric field analysis, the operation mechanism has been illuminated, especially for the "trapped mode", identified by the equally but also oppositely directed currents in each unit cell.
Amaritsakul, Yongyut; Chao, Ching-Kong; Lin, Jinn
2014-09-01
Pedicle screws are used for treating several types of spinal injuries. Although several commercial versions are presently available, they are mostly either fully cylindrical or fully conical. In this study, the bending strengths of seven types of commercial pedicle screws and a newly designed double dual core screw were evaluated by finite element analyses and biomechanical tests. All the screws had an outer diameter of 7 mm, and the biomechanical test consisted of a cantilever bending test in which a vertical point load was applied using a level arm of 45 mm. The boundary and loading conditions of the biomechanical tests were applied to the model used for the finite element analyses. The results showed that only the conical screws with fixed outer diameter and the new double dual core screw could withstand 1,000,000 cycles of a 50-500 N cyclic load. The new screw, however, exhibited lower stiffness than the conical screw, indicating that it could afford patients more flexible movements. Moreover, the new screw produced a level of stability comparable to that of the conical screw, and it was also significantly stronger than the other screws. The finite element analysis further revealed that the point of maximum tensile stress in the screw model was comparable to the point at which fracture occurred during the fatigue test. Copyright © 2014 IPEM. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Qi Wang
2016-06-01
Full Text Available A cascaded symmetrical dual-taper Mach-Zehnder interferometer structure based on guided-mode and leaky-mode interference is proposed in this paper. Firstly, the interference spectrum characteristics of interferometer has been analyzed by the Finite Difference-Beam Propagation Method (FD-BPM. When the diameter of taper waist is 20 μm–30 μm, dual-taper length is 1 mm and taper distance is 4 cm–6 cm, the spectral contrast is higher, which is suitable for sensing. Secondly, experimental research on refractive index sensitivity is carried out. A refractive index sensitivity of 62.78 nm/RIU (refractive index unit can achieved in the RI range of 1.3333–1.3792 (0%~25% NaCl solution, when the sensor structure parameters meet the following conditions: diameter of taper waist is 24 μm, dual-taper length is 837 μm and taper distance is 5.5 cm. The spectrum contrast is 0.8 and measurement resolution is 1.6 × 10−5 RIU. The simulation analysis is highly consistent with experimental results. Research shows that the sensor has promising application in low RI fields where high-precision measurement is required due to its high sensitivity and stability.
Energy Technology Data Exchange (ETDEWEB)
Chen, Jia Nen; Liu, Jun [Tianjin Key Laboratory of the Design and Intelligent Control of the Advanced Mechatronical System, Tianjin University of Technology, Tianjin (China); Zhang, Wei; Yao, Ming Hui [College of Mechanical Engineering, Beijing University of Technology, Beijing (China); Sun, Min [School of Science, Tianjin Chengjian University, Tianjin (China)
2016-09-15
Nonlinear vibrations of carbon fiber reinforced composite sandwich plate with pyramidal truss core are investigated. The governing equation of motion for the sandwich plate is derived by using a Zig-Zag theory under consideration of geometrically nonlinear. The natural frequencies of sandwich plates with different dimensions are calculated and compared with those obtained from the classic laminated plate theory and Reddy's third-order shear deformation plate theory. The frequency responses and waveforms of the sandwich plate when 1:3 internal resonance occurs are obtained, and the characteristics of the internal resonance are discussed. The influences of layer number of face sheet, strut radius, core height and inclination angle on the nonlinear responses of the sandwich plate are analyzed. The results demonstrate that the strut radius and inclination angle mainly affect the resonance frequency band of the sandwich plate, and the layer number and core height not only influence the resonance frequency band but also significantly affect the response amplitude.
Label-free biosensing with high sensitivity in dual-core microstructured polymer optical fibers
DEFF Research Database (Denmark)
Markos, Christos; Yuan, Wu; Vlachos, Kyriakos
2011-01-01
We present experimentally feasible designs of a dual-core microstructured polymer optical fiber (mPOF), which can act as a highly sensitive, label-free, and selective biosensor. An immobilized antigen sensing layer on the walls of the holes in the mPOF provides the ability to selectively capture...
A dual resonance model for high energy electroweak reactions
International Nuclear Information System (INIS)
Picard, Jean-Francois
1995-01-01
The aim of this work is to propose an original model for the weak interaction at high energy (about 1 TeV) that is inspired from resonance dual models established for hadron physics. The first chapter details the basis and assumptions of the standard model. The second chapter deals with various scenarios that go beyond the standard model and that involve a strong interaction and a perturbative approach to assess coupling. The third chapter is dedicated to the main teachings of hadron physics concerning resonances, the model of Regge poles and the concept of duality. We present our new model in the fourth chapter, we build a scenario in which standard fermions and the 3 massive gauge bosons would have a sub-structure alike that of hadrons. In order to give non-null values to the width of resonances we use the K matrix method, we describe this method in the last chapter and we apply it for the computation of the width of the Z 0 boson. Our model predicts a large spectra of states particularly with the 143-up-lets of ff-bar states. The K matrix method has allowed us to compute amplitudes for helicity, then to collapse them in amplitudes invariant with SU(2) and to project these amplitudes in partial waves of helicity. For most resonances partial widths are very low compared to their mass
Li, Na; Takagaki, Tomohiro; Sadr, Alireza; Waidyasekera, Kanchana; Ikeda, Masaomi; Chen, Jihua; Nikaido, Toru; Tagami, Junji
2011-12-01
To evaluate the microtensile bond strength (μTBS) and acid-base resistant zone (ABRZ) of two dualcuring core systems to dentin using four curing modes. Sixty-four caries-free human molars were randomly divided into two groups according to two dual-curing resin core systems: (1) Clearfil DC Core Automix; (2) Estelite Core Quick. For each core system, four different curing modes were applied to the adhesive and core resin: (1) dual-cured and dual-cured (DD); (2) chemically cured and dual-cured (CD); (3) dual-cured and chemically cured (DC); (4) chemically cured and chemically cured (CC). The specimens were sectioned into sticks (n = 20 for each group) for the microtensile bond test. μTBS data were analyzed using two-way ANOVA and the Dunnett T3 test. Failure patterns were examined with scanning electron microscopy (SEM) to determine the proportion of each mode. Dentin sandwiches were produced and subjected to an acid-base challenge. After argon-ion etching, the ultrastructure of ABRZ was observed using SEM. For Clearfil DC Core Automix, the μTBS values in MPa were as follows: DD: 29.1 ± 5.4, CD: 21.6 ± 5.6, DC: 17.9 ± 2.8, CC: 11.5 ± 3.2. For Estelite Core Quick, they were: DD: 48.9 ±5.7, CD: 20.5 ± 4.7, DC: 41.4 ± 8.3, CC: 19.1 ± 6.0. The bond strength was affected by both material and curing mode, and the interaction of the two factors was significant (p < 0.001). Within both systems, there were significant differences among groups, and the DD group showed the highest μTBS (p < 0.05). ABRZ morphology was not affected by curing mode, but it was highly adhesive-material dependent. The curing mode of dual-curing core systems affects bond strength to dentin, but has no significant effect on the formation of ABRZ.
Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.
Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun
2014-03-01
To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.
Sound Transmission Loss Through a Corrugated-Core Sandwich Panel with Integrated Acoustic Resonators
Schiller, Noah H.; Allen, Albert R.; Zalewski, Bart F; Beck, Benjamin S.
2014-01-01
The goal of this study is to better understand the effect of structurally integrated resonators on the transmission loss of a sandwich panel. The sandwich panel has facesheets over a corrugated core, which creates long aligned chambers that run parallel to the facesheets. When ports are introduced through the facesheet, the long chambers within the core can be used as low-frequency acoustic resonators. By integrating the resonators within the structure they contribute to the static load bearing capability of the panel while also attenuating noise. An analytical model of a panel with embedded resonators is derived and compared with numerical simulations. Predictions show that acoustic resonators can significantly improve the transmission loss of the sandwich panel around the natural frequency of the resonators. In one configuration with 0.813 m long internal chambers, the diffuse field transmission loss is improved by more than 22 dB around 104 Hz. The benefit is achieved with no added mass or volume relative to the baseline structure. The embedded resonators are effective because they radiate sound out-of-phase with the structure. This results in destructive interference, which leads to less transmitted sound power.
A New Kind of Circular Polarization Leaky-Wave Antenna Based on Substrate Integrated Waveguide
Directory of Open Access Journals (Sweden)
Chong Zhang
2015-01-01
Full Text Available A new kind of circular polarization leaky-wave antenna with N-shaped slots cut in the upper side of substrate integrated waveguide (SIW is investigated and presented. The radiation pattern and polarization axial ratio of the leaky-wave antenna are studied. The results show that the width of N-shaped slots has significant effect on the circular polarization property of the antenna. By properly choosing structural parameters, the SIW based leaky-wave antenna can realize circular polarization with excellent axial ratio in 8 GHz satellite band.
Practical experience with the leaky-fuel monitoring at Bohunice NPP
International Nuclear Information System (INIS)
Kacmar, M.; Cizek, J.
2001-01-01
The first part of this paper describes practical experience with the fuel monitoring in operating reactors from point of view possible leakages. Summarized in the paper are numbers leaky fuel assemblies both for NPP and for particular units. Some failure causes are discussed for operational conditions of Bohunice NPP. In the second part of paper critical power ramps on hot fuel rod of leaky fuel assemblies are analysed to eliminate failures from PCI. The main aim of the paper is the need to understand the mechanism and causes of failures (Authors)
GR712RC- Dual-Core Processor- Product Status
Sturesson, Fredrik; Habinc, Sandi; Gaisler, Jiri
2012-08-01
The GR712RC System-on-Chip (SoC) is a dual core LEON3FT system suitable for advanced high reliability space avionics. Fault tolerance features from Aeroflex Gaisler’s GRLIB IP library and an implementation using Ramon Chips RadSafe cell library enables superior radiation hardness.The GR712RC device has been designed to provide high processing power by including two LEON3FT 32- bit SPARC V8 processors, each with its own high- performance IEEE754 compliant floating-point-unit and SPARC reference memory management unit.This high processing power is combined with a large number of serial interfaces, ranging from high-speed links for data transfers to low-speed control buses for commanding and status acquisition.
Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams
Directory of Open Access Journals (Sweden)
Xiaohui Du
2016-01-01
Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.
Coupled Particle Transport and Pattern Formation in a Nonlinear Leaky-Box Model
Barghouty, A. F.; El-Nemr, K. W.; Baird, J. K.
2009-01-01
Effects of particle-particle coupling on particle characteristics in nonlinear leaky-box type descriptions of the acceleration and transport of energetic particles in space plasmas are examined in the framework of a simple two-particle model based on the Fokker-Planck equation in momentum space. In this model, the two particles are assumed coupled via a common nonlinear source term. In analogy with a prototypical mathematical system of diffusion-driven instability, this work demonstrates that steady-state patterns with strong dependence on the magnetic turbulence but a rather weak one on the coupled particles attributes can emerge in solutions of a nonlinearly coupled leaky-box model. The insight gained from this simple model may be of wider use and significance to nonlinearly coupled leaky-box type descriptions in general.
Pressure vessels and methods of sealing leaky tubes disposed in pressure vessels
International Nuclear Information System (INIS)
Larson, G.C.
1980-01-01
This invention relates to pressure vessels and to methods of sealing leaky tubes in them and is especially applicable to pressure vessels in the form of sheet-and-tube type heat exchangers constructed with a large number of relatively small diameter tubes grouped in a bundle. To seal off a leaky tube in such a heat exchanger an explosive activated plug in the form of a hollow metal body is used, inserted at each end of the tube to be sealed. Using the arrangement of pressure vessel and associated tube sheets and the explosive activated plug method of sealing a leaky tube as described in this invention it is claimed that distortion of the adjacent tubes and the tube sheets is reduced when the explosive activated plugs are detonated. (U.K.)
The First Steps into a "Leaky Pipeline"
DEFF Research Database (Denmark)
Emerek, Ruth; Larsen, Britt Østergaard
2011-01-01
Research shows that the higher the level of academic positions at universities the lower the percentage of women among employees also applies at Danish universities. This may be due to a historical backlog or merely to a 'Leaky pipeline', as earlier studies have revealed that an increasing propor...
Peng, Yung-Kang; Lui, Cathy N. P.; Chen, Yu-Wei; Chou, Shang-Wei; Chou, Pi-Tai; Yung, Ken K. L.; Edman Tsang, S. C.
2018-01-01
Tagging recognition group(s) on superparamagnetic iron oxide is known to aid localisation (imaging), stimulation and separation of biological entities using magnetic resonance imaging (MRI) and magnetic agitation/separation (MAS) techniques. Despite the wide applicability of iron oxide nanoparticles in T 2-weighted MRI and MAS, the quality of the images and safe manipulation of the exceptionally delicate neural cells in a live brain are currently the key challenges. Here, we demonstrate the engineered manganese oxide clusters-iron oxide core-shell nanoparticle as an MR dual-modal contrast agent for neural stem cells (NSCs) imaging and magnetic manipulation in live rodents. As a result, using this engineered nanoparticle and associated technologies, identification, stimulation and transportation of labelled potentially multipotent NSCs from a specific location of a live brain to another by magnetic means for self-healing therapy can therefore be made possible.
Ultrasmall Dual-Band Metamaterial Antennas Based on Asymmetrical Hybrid Resonators
Directory of Open Access Journals (Sweden)
Ji-Xu Zhu
2016-01-01
Full Text Available A new type of hybrid resonant circuit model is investigated theoretically and experimentally. The resonant model consists of a right hand (RH patch part and a composite right and left handed (CRLH part (RH + CRLH, which determines a compact size and also a convenient frequency modulation characteristic for the proposed antennas. For experimental demonstration, two antennas are fabricated. The former dual-band antenna operating at f-1=3.5 GHz (Wimax and f+1=5.25 GHz (WLAN occupies an area of 0.21λ0×0.08λ0, and two dipolar radiation patterns are obtained with comparable gains of about 6.1 and 6.2 dB, respectively. The latter antenna advances in many aspects such as an ultrasmall size of only 0.16λ0×0.08λ0, versatile radiation patterns with a monopolar pattern at f0=2.4 GHz (Bluetooth, and a dipole one at f+1=3.5 GHz (Wimax and also comparable antenna gains. Circuit parameters are extracted and researched. Excellent performances of the antennas based on hybrid resonators predict promising applications in multifunction wireless communication systems.
Semi-analytical model for hollow-core anti-resonant fibers
Directory of Open Access Journals (Sweden)
Wei eDing
2015-03-01
Full Text Available We detailedly describe a recently-developed semi-analytical method to quantitatively calculate light transmission properties of hollow-core anti-resonant fibers (HC-ARFs. Formation of equiphase interface at fiber’s outermost boundary and outward light emission ruled by Helmholtz equation in fiber’s transverse plane constitute the basis of this method. Our semi-analytical calculation results agree well with those of precise simulations and clarify the light leakage dependences on azimuthal angle, geometrical shape and polarization. Using this method, we show investigations on HC-ARFs having various core shapes (e.g. polygon, hypocycloid with single- and multi-layered core-surrounds. The polarization properties of ARFs are also studied. Our semi-analytical method provides clear physical insights into the light guidance in ARF and can play as a fast and useful design aid for better ARFs.
Wang, Cuiling; Zhang, Shouheng; Qiao, Shizhu; Du, Honglei; Liu, Xiaomin; Sun, Ruicong; Chu, Xian-Ming; Miao, Guo-Xing; Dai, Youyong; Kang, Shishou; Yan, Shishen; Li, Shandong
2018-05-01
Dual-mode ferromagnetic resonance is observed in FeCoB/Ru/FeCoB trilayer synthetic antiferromagnets with uniaxial in-plane magnetic anisotropy. The optical mode is present in the (0-108 Oe) magnetic field range, where the top and bottom layer magnetizations are aligned in opposite directions. The strong acoustic mode appears, when the magnetic field exceeds the 300 Oe value, which corresponds to the flop transition in the trilayer. Magnetic field and angular dependences of resonant frequencies are studied for both optical (low-field) and acoustic (high field) modes. The low-field mode is found to be anisotropic but insensitive to the magnetic field value. In contrast, the high field mode is quasi-isotropic, but its resonant frequency is tunable by the value of the magnetic field. The coexistence of two modes of ferromagnetic resonance as well as switching between them with the increase in the magnetic field originates from the difference in the sign of interlayer coupling energy at the parallel and antiparallel configurations of the synthetic antiferromagnet. The dual-mode resonance in the studied trilayer structures provides greater flexibility in the design and functionalization of micro-inductors in monolithic microwave integrated circuits.
Energy Technology Data Exchange (ETDEWEB)
Satoh, Kei; Takagi, Yuta; Narahashi, Shoichi [Research Laboratories, NTT DOCOMO, INC., 3-6 Hikari-no-oka Yokosuka, Kanagawa 239-8536 Japan (Japan); Nojima, Toshio, E-mail: satokei@nttdocomo.co.j [Graduate School of Information Science and Technology, Hokkaido University, Kita 14, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-0814 Japan (Japan)
2010-06-01
This paper presents a high-temperature superconducting coplanar-waveguide quarter-wavelength resonator that has two different resonant modes for use in a dual-band bandpass filter (DBPF). An RF filter with multiple passbands such as the DBPF is a basic element that is expected to achieve broadband transmission by using separated frequency bands aggregately and simultaneously in future mobile communication systems. The proposed resonator has a folded center conductor and two open stubs that are aligned close to it. The odd- and even-mode resonant frequencies are configured using the space between the folded center conductor and the open stubs. It is easy to configure the odd- and even-mode coupling coefficients independently because the two resonant modes have different current density distributions. Consequently, a DBPF with two different bandwidths can be easily designed. This paper presents three design examples for a four-pole Chebyshev DBPF with different combinations of fractional bandwidths in order to investigate the validity of the proposed resonator. This paper also presents measured results of the DBPF based on the design examples from the standpoint of experimental investigation. The designed and measured frequency responses confirm that the proposed resonator is effective in achieving DBPFs not only with two of the same bandwidths but also with two different bandwidths.
Covariant introduction of quark spin into the dual resonance model
International Nuclear Information System (INIS)
Iroshnikov, G.S.
1979-01-01
A very simple method of insertion of a quark spin into the dual resonance model of hadron interaction is proposed. The method is suitable for amplitudes with an arbitrary number of particles. The amplitude of interaction of real particles is presented as a product of contribution of oscillatory excitations in the (q anti q) system and of a spin factor. The latter is equal to the trace of the product of the external particle wave functions constructed from structural quarks and satisfying the relativistic Bargman-Wigner equations. Two examples of calculating the meson interaction amplitudes are presented
Radial flow towards well in leaky unconfined aquifer
Mishra, P. K.; Kuhlman, K. L.
2012-12-01
An analytical solution is developed for three-dimensional flow towards a partially penetrating large- diameter well in an unconfined aquifer bounded below by a leaky aquitard of finite or semi-infinite extent. The analytical solution is derived using Laplace and Hankel transforms, then inverted numerically. Existing solutions for flow in leaky unconfined aquifers neglect the unsaturated zone following an assumption of instantaneous drainage due to Neuman. We extend the theory of leakage in unconfined aquifers by (1) including water flow and storage in the unsaturated zone above the water table, and (2) allowing the finite-diameter pumping well to partially penetrate the aquifer. The investigation of model-predicted results shows that aquitard leakage leads to significant departure from the unconfined solution without leakage. The investigation of dimensionless time-drawdown relationships shows that the aquitard drawdown also depends on unsaturated zone properties and the pumping-well wellbore storage effects.
Dielectric Meta-Holograms Enabled with Dual Magnetic Resonances in Visible Light.
Li, Zile; Kim, Inki; Zhang, Lei; Mehmood, Muhammad Q; Anwar, Muhammad S; Saleem, Murtaza; Lee, Dasol; Nam, Ki Tae; Zhang, Shuang; Luk'yanchuk, Boris; Wang, Yu; Zheng, Guoxing; Rho, Junsuk; Qiu, Cheng-Wei
2017-09-26
Efficient transmission-type meta-holograms have been demonstrated using high-index dielectric nanostructures based on Huygens' principle. It is crucial that the geometry size of building blocks be judiciously optimized individually for spectral overlap of electric and magnetic dipoles. In contrast, reflection-type meta-holograms using the metal/insulator/metal scheme and geometric phase can be readily achieved with high efficiency and small thickness. Here, we demonstrate a general platform for design of dual magnetic resonance based meta-holograms based on the geometric phase using silicon nanostructures that are quarter wavelength thick for visible light. Significantly, the projected holographic image can be unambiguously observed without a receiving screen even under the illumination of natural light. Within the well-developed semiconductor industry, our ultrathin magnetic resonance-based meta-holograms may have promising applications in anticounterfeiting and information security.
Superluminal plasmons with resonant gain in population inverted bilayer graphene
Low, Tony
2017-12-28
AB-stacked bilayer graphene with a tunable electronic bandgap in excess of the optical phonon energy presents an interesting active medium, and we consider such theoretical possibility in this work. We argue the possibility of a highly resonant optical gain in the vicinity of the asymmetry gap. Associated with this resonant gain are strongly amplified plasmons, plasmons with negative group velocity and superluminal effects, as well as directional leaky modes.
Superluminal plasmons with resonant gain in population inverted bilayer graphene
Low, Tony; Chen, Pai-Yen; Basov, D. N.
2017-01-01
AB-stacked bilayer graphene with a tunable electronic bandgap in excess of the optical phonon energy presents an interesting active medium, and we consider such theoretical possibility in this work. We argue the possibility of a highly resonant optical gain in the vicinity of the asymmetry gap. Associated with this resonant gain are strongly amplified plasmons, plasmons with negative group velocity and superluminal effects, as well as directional leaky modes.
Wahr, J. M.; Sasao, T.
1981-01-01
The effects of the oceans, which are subject to a resonance due to a free rotational eigenmode of an elliptical, rotating earth with a fluid outer core having an eigenfrequency of (1 + 1/460) cycle/day, on the body tide and nutational response of the earth to the diurnal luni-tidal force are computed. The response of an elastic, rotating, elliptical, oceanless earth with a fluid outer core to a given load distribution on its surface is first considered, and the tidal sea level height for equilibrium and nonequilibrium oceans is examined. Computations of the effects of equilibrium and nonequilibrium oceans on the nutational and deformational responses of the earth are then presented which show small but significant perturbations to the retrograde 18.6-year and prograde six-month nutations, and more important effects on the earth body tide, which is also resonant at the free core notation eigenfrequency.
Performance Improvement of Polymer Solar Cells by Surface-Energy-Induced Dual Plasmon Resonance.
Yao, Mengnan; Shen, Ping; Liu, Yan; Chen, Boyuan; Guo, Wenbin; Ruan, Shengping; Shen, Liang
2016-03-09
The surface plasmon resonance (SPR) effect of metal nanoparticles (MNPs) is effectively applied on polymer solar cells (PSCs) to improve power conversion efficiency (PCE). However, universality of the reported results mainly focused on utilizing single type of MNPs to enhance light absorption only in specific narrow wavelength range. Herein, a surface-energy-induced dual MNP plasmon resonance by thermally evaporating method was presented to achieve the absorption enhancement in wider range. The differences of surface energy between silver (Ag), gold (Au), and tungsten trioxide (WO3) compared by contact angle images enable Ag and Au prefer to respectively aggregate into isolated islands rather than films at the initial stage of the evaporation process, which was clearly demonstrated in the atomic force microscopy (AFM) measurement. The sum of plasmon-enhanced wavelength range induced by both Ag NPs (350-450 nm) and Au NPs (450-600 nm) almost cover the whole absorption spectra of active layers, which compatibly contribute a significant efficiency improvement from 4.57 ± 0.16 to 6.55 ± 0.12% compared to the one without MNPs. Besides, steady state photoluminescence (PL) measurements provide strong evidence that the SPR induced by the Ag-Au NPs increase the intensity of light absorption. Finally, ultraviolet photoelectron spectroscopy (UPS) reveals that doping Au and Ag causes upper shift of both the work function and valence band of WO3, which is directly related to hole collection ability. We believe the surface-energy-induced dual plasmon resonance enhancement by simple thermally evaporating technique might pave the way toward higher-efficiency PSCs.
Energy Technology Data Exchange (ETDEWEB)
Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.
2014-09-15
Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.
The Hagedorn Spectrum and the Dual Resonance Model: An Old Love Affair
Veneziano, Gabriele
2016-01-01
In this contribution I recall how people working in the late 1960s on the dual resonance model came to the surprising discovery of a Hagedorn-like spectrum, and why they should not have been surprised. I will then turn to discussing the Hagedorn spectrum from a string theory viewpoint (which adds a huge degeneracy to the exponential spectrum). Finally, I will discuss how all this can be reinterpreted in the new incarnation of string theory through the properties of quantum black holes.
Effects of Rubber Loading on the Ultrasonic Backward Radiation Profile of Leaky Lamb Wave
International Nuclear Information System (INIS)
Song, Sung Jin; Jung, Min Ho; Kim, Young H.; Kwon, Sung Duk
2002-01-01
The characterization of adhesive property in multi-layer materials has been hot issue for a long time. In order to evaluate adhesive properties, we constructed fully automated system for the backward radiation of leaky Lamb wave. The backward radiation profiles were obtained for the bare steel plate and plates with rubber-loading. The rf waveforms and frequency spectra of backward radiation show the characteristics of involved leaky Lamb wave modes. As the thickness of rubber-loading increased, the amplitude of profile at the incident angle of 13.4' exponentially decreased. Scanning the incident position over the partially rubber-loaded specimen shows good agreement with the actual rubber-loading. The backward radiation of leaky Lamb wave has great potential to evaluate the adhesive condition as well as material properties of plates
International Nuclear Information System (INIS)
Hu Yong; Li Jing-Chao; Shen Ming-Wu; Shi Xiang-Yang
2014-01-01
Recent advances with iron oxide/gold (Fe 3 O 4 /Au) composite nanoparticles (CNPs) in dual-modality magnetic resonance (MR) and computed tomography (CT) imaging applications are reviewed. The synthesis and assembly of “dumbbelllike” and “core/shell” Fe 3 O 4 /Au CNPs is introduced. Potential applications of some developed Fe 3 O 4 /Au CNPs as contrast agents for dual-mode MR/CT imaging applications are described in detail. (topical review - magnetism, magnetic materials, and interdisciplinary research)
A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications
DEFF Research Database (Denmark)
Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng
2017-01-01
This paper proposes a dual-bridge (DB) LLC resonant converter for wide input applications. The topology is an integration of a half-bridge (HB) LLC circuit and a full-bridge (FB) LLC circuit. The fixed-frequency PWM control is employed and a range of twice the minimum input voltage can be covered....... Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...
Saturated-unsaturated flow in a compressible leaky-unconfined aquifer
Mishra, Phoolendra K.; Vesselinov, Velimir V.; Kuhlman, Kristopher L.
2012-06-01
An analytical solution is developed for three-dimensional flow towards a partially penetrating large-diameter well in an unconfined aquifer bounded below by a leaky aquitard of finite or semi-infinite extent. The analytical solution is derived using Laplace and Hankel transforms, then inverted numerically. Existing solutions for flow in leaky unconfined aquifers neglect the unsaturated zone following an assumption of instantaneous drainage due to Neuman. We extend the theory of leakage in unconfined aquifers by (1) including water flow and storage in the unsaturated zone above the water table, and (2) allowing the finite-diameter pumping well to partially penetrate the aquifer. The investigation of model-predicted results shows that aquitard leakage leads to significant departure from the unconfined solution without leakage. The investigation of dimensionless time-drawdown relationships shows that the aquitard drawdown also depends on unsaturated zone properties and the pumping-well wellbore storage effects.
Slow light based on plasmon-induced transparency in dual-ring resonator-coupled MDM waveguide system
International Nuclear Information System (INIS)
Zhan, Shiping; Li, Hongjian; He, Zhihui; Li, Boxun; Yang, Hui; Cao, Guangtao
2014-01-01
We report a theoretical and numerical investigation of the plasmon-induced transparency (PIT) effect in a dual-ring resonator-coupled metal–dielectric–metal waveguide system. A transfer matrix method (TMM) is introduced to analyse the transmission and dispersion properties in the transparency window. A tunable PIT is realized in a constant separation design. The phase dispersion and slow-light effect are discussed in both the resonance and non-resonance conditions. Finally, a propagation constant based on the TMM is derived for the periodic system. It is found that the group index in the transparency window of the proposed structure can be easily tuned by the period p, which provides a new understanding, and a group index ∼51 is achieved. The quality factor of resonators can also be effective in adjusting the dispersion relation. These observations could be helpful to fundamental research and applications for integrated plasmonic devices. (paper)
Xu, Chen; Zhang, Cheng; Wang, Yingxi; Li, Liu; Li, Ling; Whittaker, Andrew K.
2017-12-01
In this study, novel magnetic core-shell nanoparticles Fe3O4@La-BTC/GO have been synthesized by the layer-by-layer self-assembly (LBL) method and further modified by attachment of amino-modified PEG chains. The nanoparticles were thoroughly characterized by x-ray diffraction, FTIR, scanning electron microscopy and transmission electron microscopy. The core-shell structure was shown to be controlled by the LBL method. The drug loading of doxorubicin (DOX) within the Fe3O4@La-BTC/GO-PEG nanoparticles with different numbers of deposited layers was investigated. It was found that DOX loading increased with increasing number of metal organic framework coating layers, indicating that the drug loading can be controlled through the controllable LBL method. Cytotoxicity assays indicated that the Fe3O4@La-BTC/GO-PEG nanoparticles were biocompatible. The DOX was released rapidly at pH 3.8 and pH 5.8, but at pH 7.4 the rate and extent of release was greatly attenuated. The nanoparticles therefore demonstrate an excellent pH-triggered drug release. In addition, the particles could be tracked by magnetic resonance imaging (MRI) and fluorescence optical imaging (FOI). A clear dose-dependent contrast enhancement in T 2-weighted MR images and fluorescence images indicate the potential of these nanoparticles as dual-mode MRI/FOI contrast agents.
Transient well flow in leaky multiple-aquifer systems
Hemker, C. J.
1985-10-01
A previously developed eigenvalue analysis approach to groundwater flow in leaky multiple aquifers is used to derive exact solutions for transient well flow problems in leaky and confined systems comprising any number of aquifers. Equations are presented for the drawdown distribution in systems of infinite extent, caused by wells penetrating one or more of the aquifers completely and discharging each layer at a constant rate. Since the solution obtained may be regarded as a combined analytical-numerical technique, a type of one-dimensional modelling can be applied to find approximate solutions for several complicating conditions. Numerical evaluations are presented as time-drawdown curves and include effects of storage in the aquitard, unconfined conditions, partially penetrating wells and stratified aquifers. The outcome of calculations for relatively simple systems compares very well with published corresponding results. The proposed multilayer solution can be a valuable tool in aquifer test evaluation, as it provides the analytical expression required to enable the application of existing computer methods to the determination of aquifer characteristics.
Fixing the Leaky Pipeline | Women in Science | Initiatives | Indian ...
Indian Academy of Sciences (India)
Home; Initiatives; Women in Science; Fixing the Leaky Pipeline ... Why aren't there many women in the top spots in academia? .... of women scientists, at a young age of 52, after a valiant battle with cancer, today on 29th March 2016 in Delhi.
Low-loss single-mode hollow-core fiber with anisotropic anti-resonant elements
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
A hollow-core fiber using anisotropic anti-resonant tubes in thecladding is proposed for low loss and effectively single-mode guidance. We show that the loss performance and higher-order mode suppression is significantly improved by using symmetrically distributed anisotropic antiresonant tubes i...
Acoustically Driven Fluid and Particle Motion in Confined and Leaky Systems
Barnkob, Rune; Nama, Nitesh; Ren, Liqiang; Huang, Tony Jun; Costanzo, Francesco; Kähler, Christian J.
2018-01-01
The acoustic motion of fluids and particles in confined and acoustically leaky systems is receiving increasing attention for its use in medicine and biotechnology. A number of contradicting physical and numerical models currently exist, but their validity is uncertain due to the unavailability of hard-to-access experimental data for validation. We provide experimental benchmarking data by measuring 3D particle trajectories and demonstrate that the particle trajectories can be described numerically without any fitting parameter by a reduced-fluid model with leaky impedance-wall conditions. The results reveal the hitherto unknown existence of a pseudo-standing wave that drives the acoustic streaming as well as the acoustic radiation force on suspended particles.
Resonant Tidal Excitation of Internal Waves in the Earth's Fluid Core
Tyler, Robert H.; Kuang, Weijia
2014-01-01
It has long been speculated that there is a stably stratified layer below the core-mantle boundary, and two recent studies have improved the constraints on the parameters describing this stratification. Here we consider the dynamical implications of this layer using a simplified model. We first show that the stratification in this surface layer has sensitive control over the rate at which tidal energy is transferred to the core. We then show that when the stratification parameters from the recent studies are used in this model, a resonant configuration arrives whereby tidal forces perform elevated rates of work in exciting core flow. Specifically, the internal wave speed derived from the two independent studies (150 and 155 m/s) are in remarkable agreement with the speed (152 m/s) required for excitation of the primary normal mode of oscillation as calculated from full solutions of the Laplace Tidal Equations applied to a reduced-gravity idealized model representing the stratified layer. In evaluating this agreement it is noteworthy that the idealized model assumed may be regarded as the most reduced representation of the stratified dynamics of the layer, in that there are no non-essential dynamical terms in the governing equations assumed. While it is certainly possible that a more realistic treatment may require additional dynamical terms or coupling, it is also clear that this reduced representation includes no freedom for coercing the correlation described. This suggests that one must accept either (1) that tidal forces resonantly excite core flow and this is predicted by a simple model or (2) that either the independent estimates or the dynamical model does not accurately portray the core surface layer and there has simply been an unlikely coincidence between three estimates of a stratification parameter which would otherwise have a broad plausible range.
Wu, Lifu; Qiu, Xiaojun; Guo, Yecai
2018-06-01
To tune the noise amplification in the feedback system caused by the waterbed effect effectively, an adaptive algorithm is proposed in this paper by replacing the scalar leaky factor of the leaky FxLMS algorithm with a real symmetric Toeplitz matrix. The elements in the matrix are calculated explicitly according to the noise amplification constraints, which are defined based on a simple but efficient method. Simulations in an ANC headphone application demonstrate that the proposed algorithm can adjust the frequency band of noise amplification more effectively than the FxLMS algorithm and the leaky FxLMS algorithm.
A Novel Computational Method to Reduce Leaky Reaction in DNA Strand Displacement
Directory of Open Access Journals (Sweden)
Xin Li
2015-01-01
Full Text Available DNA strand displacement technique is widely used in DNA programming, DNA biosensors, and gene analysis. In DNA strand displacement, leaky reactions can cause DNA signals decay and detecting DNA signals fails. The mostly used method to avoid leakage is cleaning up after upstream leaky reactions, and it remains a challenge to develop reliable DNA strand displacement technique with low leakage. In this work, we address the challenge by experimentally evaluating the basic factors, including reaction time, ratio of reactants, and ion concentration to the leakage in DNA strand displacement. Specifically, fluorescent probes and a hairpin structure reporting DNA strand are designed to detect the output of DNA strand displacement, and thus can evaluate the leakage of DNA strand displacement reactions with different reaction time, ratios of reactants, and ion concentrations. From the obtained data, mathematical models for evaluating leakage are achieved by curve derivation. As a result, it is obtained that long time incubation, high concentration of fuel strand, and inappropriate amount of ion concentration can weaken leaky reactions. This contributes to a method to set proper reaction conditions to reduce leakage in DNA strand displacement.
Isotope effects accompanying evaporation of water from leaky containers.
Rozanski, Kazimierz; Chmura, Lukasz
2008-03-01
Laboratory experiments aimed at quantifying isotope effects associated with partial evaporation of water from leaky containers have been performed under three different settings: (i) evaporation into dry atmosphere, performed in a dynamic mode, (ii) evaporation into dry atmosphere, performed in a static mode, and (iii) evaporation into free laboratory atmosphere. The results demonstrate that evaporative enrichment of water stored in leaky containers can be properly described in the framework of the Craig-Gordon evaporation model. The key parameter controlling the degree of isotope enrichment is the remaining fraction of water in the leaking containers. Other factors such as temperature, relative humidity, or extent of kinetic fractionation play only minor roles. Satisfactory agreement between observed and predicted isotope enrichments for both (18)O and (2)H in experiments for the case of evaporation into dry atmosphere could be obtained only when molecular diffusivity ratios of isotope water molecules as suggested recently by Cappa et al. [J. Geophys. Res., 108, 4525-4535, (2003).] were adopted. However, the observed and modelled isotope enrichments for (2)H and (18)O could be reconciled also for the ratios of molecular diffusivities obtained by Merlivat [J. Chem. Phys., 69, 2864-2871 (1978).], if non-negligible transport resistance in the viscous liquid sub-layer adjacent to the evaporating surface is considered. The evaporation experiments revealed that the loss of mass of water stored in leaky containers in the order of 1%, will lead to an increase of the heavy isotope content in this water by ca. 0.35 and 1.1 per thousand, for delta (18)O and delta (2)H, respectively.
Asymptotic spectral analysis in colliding leaky quantum layers
Czech Academy of Sciences Publication Activity Database
Kondej, S.; Krejčiřík, David
2017-01-01
Roč. 446, č. 2 (2017), s. 1328-1355 ISSN 0022-247X R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : quantum layers * leaky graphs * Delta interaction supported on hypersurfaces * Norm-resolvent convergence * non-self-adjoint interaction Subject RIV: BE - Theoretical Physics OBOR OECD: Applied mathematics Impact factor: 1.064, year: 2016
International Nuclear Information System (INIS)
Haverkort, Maurits W.
2016-01-01
Depending on the material and edge under consideration, core level spectra manifest themselves as local excitons with multiplets, edge singularities, resonances, or the local projected density of states. Both extremes, i.e., local excitons and non-interacting delocalized excitations are theoretically well under control. Describing the intermediate regime, where local many body interactions and band-formation are equally important is a challenge. Here we discuss how Quanty , a versatile quantum many body script language, can be used to calculate a variety of different core level spectroscopy types on solids and molecules, both in the frequency as well as the time domain. The flexible nature of Quanty allows one to choose different approximations for different edges and materials. For example, using a newly developed method merging ideas from density renormalization group and quantum chemistry [1-3], Quanty can calculate excitons, resonances and band-excitations in x-ray absorption, photoemission, x-ray emission, fluorescence yield, non-resonant inelastic x-ray scattering, resonant inelastic x-ray scattering and many more spectroscopy types. Quanty can be obtained from: http://www.quanty.org. (paper)
Alfaro, Cristina; Durán, Richard; Hunt, Alexandra; Aragón, María José
2014-01-01
Recent education reforms have begun to reframe academic discussion and teacher practice surrounding bilingual educational approaches for preparing "21st century, college and career ready" citizens. Given this broader context, in this article we examine ways that we might join implementation of dual language programs, Common Core State…
Low-loss hollow-core silica fibers with adjacent nested anti-resonant tubes
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2015-01-01
We report on numerical design optimization of hollow-core antiresonant fibers with the aim of reducing transmission losses. We show that re-arranging the nested anti-resonant tubes in the cladding to be adjacent has the effect of significantly reducing leakage as well as bending losses, and for r...
Gap asymptotics in a weakly bent leaky quantum wire
Czech Academy of Sciences Publication Activity Database
Exner, Pavel; Kondej, S.
2015-01-01
Roč. 48, č. 49 (2015), s. 495301 ISSN 1751-8113 R&D Projects: GA ČR(CZ) GA14-06818S Institutional support: RVO:61389005 Keywords : singular Schroedinger operators * delta interaction * leaky quantum wires * weak perturbation * asymptotic expansion Subject RIV: BE - Theoretical Physics Impact factor: 1.933, year: 2015
Numerical simulation of the leaky dielectric microdroplet generation in electric fields
Kamali, Reza; Manshadi, Mohammad Karim Dehghan
2016-07-01
Microdroplet generation has a vast range of applications in the chemical, biomedical, and biological sciences. Several devices are applied to produce microdroplets, such as Co-flow, T-junction and Flow-focusing. The important point in the producing process is controlling the separated fluid volume in these devices. On the other hand, a large number of liquids, especially aqueous one, are influenced by electric or magnetic fields. As a consequence, an electric field could be used in order to affect the separated fluid volume. In this study, effects of an electric field on the microdroplet generation in a Co-flow device are investigated numerically. Furthermore, effects of some electrical properties such as permittivity on the separating process of microdroplets are studied. Leaky dielectric and perfect dielectric models are used in this investigation. According to the results, in the microdroplet generating process, leaky dielectric fluids show different behaviors, when an electric field is applied to the device. In other words, in a constant electric field strength, the volume of generated microdroplets can increase or decrease, in comparison with the condition without the electric field. However, for perfect dielectric fluids, droplet volume always decreases with increasing the electric field strength. In order to validate the numerical method of this study, deformation of a leaky dielectric droplet in an electric field is investigated. Results are compared with Taylor theoretical model.
Laser Generated Leaky Acoustic Waves for Needle Visualization.
Wu, Kai-Wen; Wang, Yi-An; Li, Pai-Chi
2018-04-01
Ultrasound (US)-guided needle operation is usually used to visualize both tissue and needle position such as tissue biopsy and localized drug delivery. However, the transducer-needle orientation is limited due to reflection of the acoustic waves. We proposed a leaky acoustic wave method to visualize the needle position and orientation. Laser pulses are emitted on top of the needle to generate acoustic waves; then, these acoustic waves propagate along the needle surface. Leaky wave signals are detected by the US array transducer. The needle position can be calculated by phase velocities of two different wave modes and their corresponding emission angles. In our experiments, a series of needles was inserted into a tissue mimicking phantom and porcine tissue to evaluate the accuracy of the proposed method. The results show that the detection depth is up to 51 mm and the insertion angle is up to 40° with needles of different diameters. It is demonstrated that the proposed approach outperforms the conventional B-mode US-guided needle operation in terms of the detection range while achieving similar accuracy. The proposed method reveals the potentials for further clinical applications.
Foley, W Dennis; Shuman, William P; Siegel, Marilyn J; Sahani, Dushyant V; Boll, Daniel T; Bolus, David N; De Cecco, Carlo N; Kaza, Ravi K; Morgan, Desiree E; Schoepf, U Joseph; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L
This is the second of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography. This paper, part 2, addresses radiation dose and iodine sensitivity in dual-energy computed tomography.
A complete fuel development facility utilizing a dual core TRIGA reactor system
Energy Technology Data Exchange (ETDEWEB)
Middleton, A; Law, G C [General Atomic Co., San Diego, CA (United States)
1974-07-01
A TRIGA Dual Core Reactor System has been chosen by the Romanian Government as the heart of a new fuel development facility which will be operated by the Romanian Institute for Nuclear Technologies. The Facility, which will be operational in 1976, is an integral part of the Romanian National Program for Power Reactor Development, with particular emphasis being placed on fuel development. The unique combination of a new 14 MW steady state TRIGA reactor, and the well-proven TRIGA Annular Core Pulsing Reactor (ACPR) in one below-ground reactor pool resulted in a substantial construction cost savings and gives the facility remarkable experimental flexibility. The inherent safety of the TRIGA fuel elements in both reactor cores means that a secondary containment building is not necessary, resulting in further construction cost savings. The 14 MW steady state reactor gives acceptably high neutron fluxes for long- term testing of various prototype fuel-cladding-coolant combinations; and the TRIGA ACPR high pulse capability allows transient testing of fuel specimens, which is so important for accurate prediction of the performance of power reactor fuel elements under postulated failure conditions. The 14 MW steady state reactor has one large and three small in-core irradiation loop positions, two large irradiation loop positions adjacent to the core face, and twenty small holes in the beryllium reflector for small capsule irradiation. The power level of 14 MW will yield peak unperturbed thermal neutron fluxes in the central experiment position approaching 3.0 x 10{sup 14} n/cm{sup 2}-sec. The ACPR has one large dry central experimental cavity which can be loaded at pool level through a shielded offset loading tube; a small diameter in-core flux trap; and an in-core pneumatically-operated capsule irradiation position. A peak pulse of 15,000 MW will yield a peak fast neutron flux in the central experimental cavity of about 1.5 x 10{sup 17} n/cm{sup 2}-sec. The pulse width at
Real-Time Characterization of Materials Degradation Using Leaky Lamb Wave
Shiuh, S.; Bar-Cohen, Y.
1997-01-01
Leaky Lamb wave (LLW) propagation in composite materials has been studied extensively since it was first observed in 1982. The wave is induced using a pitch-catch arrangement and the plate wave modes are detected by searching minima in the reflected spectra.
Kromdijk, Johannes; Ubierna, Nerea; Cousins, Asaph B; Griffiths, Howard
2014-07-01
Crop species with the C4 photosynthetic pathway are generally characterized by high productivity, especially in environmental conditions favouring photorespiration. In comparison with the ancestral C3 pathway, the biochemical and anatomical modifications of the C4 pathway allow spatial separation of primary carbon acquisition in mesophyll cells and subsequent assimilation in bundle-sheath cells. The CO2-concentrating C4 cycle has to operate in close coordination with CO2 reduction via the Calvin-Benson-Bassham (CBB) cycle in order to keep the C4 pathway energetically efficient. The gradient in CO2 concentration between bundle-sheath and mesophyll cells facilitates diffusive leakage of CO2. This rate of bundle-sheath CO2 leakage relative to the rate of phosphoenolpyruvate carboxylation (termed leakiness) has been used to probe the balance between C4 carbon acquisition and subsequent reduction as a result of environmental perturbations. When doing so, the correct choice of equations to derive leakiness from stable carbon isotope discrimination (Δ(13)C) during gas exchange is critical to avoid biased results. Leakiness responses to photon flux density, either short-term (during measurements) or long-term (during growth and development), can have important implications for C4 performance in understorey light conditions. However, recent reports show leakiness to be subject to considerable acclimation. Additionally, the recent discovery of two decarboxylating C4 cycles operating in parallel in Zea mays suggests that flexibility in the transported C4 acid and associated decarboxylase could also aid in maintaining C4/CBB balance in a changing environment. In this paper, we review improvements in methodology to estimate leakiness, synthesize reports on bundle-sheath leakiness, discuss different interpretations, and highlight areas where future research is necessary. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology
Okwuosa, Tochukwu C; Pereira, Beatriz C; Arafat, Basel; Cieszynska, Milena; Isreb, Abdullah; Alhnan, Mohamed A
2017-02-01
Individualizing gastric-resistant tablets is associated with major challenges for clinical staff in hospitals and healthcare centres. This work aims to fabricate gastric-resistant 3D printed tablets using dual FDM 3D printing. The gastric-resistant tablets were engineered by employing a range of shell-core designs using polyvinylpyrrolidone (PVP) and methacrylic acid co-polymer for core and shell structures respectively. Filaments for both core and shell were compounded using a twin-screw hot-melt extruder (HME). CAD software was utilized to design a capsule-shaped core with a complementary shell of increasing thicknesses (0.17, 0.35, 0.52, 0.70 or 0.87 mm). The physical form of the drug and its integrity following an FDM 3D printing were assessed using x-ray powder diffractometry (XRPD), thermal analysis and HPLC. A shell thickness ≥0.52 mm was deemed necessary in order to achieve sufficient core protection in the acid medium. The technology proved viable for incorporating different drug candidates; theophylline, budesonide and diclofenac sodium. XRPD indicated the presence of theophylline crystals whilst budesonide and diclofenac sodium remained amorphous in the PVP matrix of the filaments and 3D printed tablets. Fabricated tablets demonstrated gastric resistant properties and a pH responsive drug release pattern in both phosphate and bicarbonate buffers. Despite its relatively limited resolution, FDM 3D printing proved to be a suitable platform for a single-process fabrication of delayed release tablets. This work reveals the potential of dual FDM 3D printing as a unique platform for personalising delayed release tablets to suit an individual patient's needs.
Frequency dependent steering with backward leaky waves via photonic crystal interface layer.
Colak, Evrim; Caglayan, Humeyra; Cakmak, Atilla O; Villa, Alessandro D; Capolino, Filippo; Ozbay, Ekmel
2009-06-08
A Photonic Crystal (PC) with a surface defect layer (made of dimers) is studied in the microwave regime. The dispersion diagram is obtained with the Plane Wave Expansion Method. The dispersion diagram reveals that the dimer-layer supports a surface mode with negative slope. Two facts are noted: First, a guided (bounded) wave is present, propagating along the surface of the dimer-layer. Second, above the light line, the fast traveling mode couple to the propagating spectra and as a result a directive (narrow beam) radiation with backward characteristics is observed and measured. In this leaky mode regime, symmetrical radiation patterns with respect to the normal to the PC surface are attained. Beam steering is observed and measured in a 70 degrees angular range when frequency ranges in the 11.88-13.69 GHz interval. Thus, a PC based surface wave structure that acts as a frequency dependent leaky wave antenna is presented. Angular radiation pattern measurements are in agreement with those obtained via numerical simulations that employ the Finite Difference Time Domain Method (FDTD). Finally, the backward radiation characteristics that in turn suggest the existence of a backward leaky mode in the dimer-layer are experimentally verified using a halved dimer-layer structure.
Middle School Girls and the "Leaky Pipeline" to Leadership
Shapiro, Mary; Grossman, Diane; Carter, Suzanne; Martin, Karyn; Deyton, Patricia; Hammer, Diane
2015-01-01
Why do girls perform so well academically yet lose ground as professional women? This diminishing number of women up the leadership hierarchy is often referred to as the "leaky pipeline," and attributed to many factors: external ones such as work environments not conducive to work/life balance, and internal ones such as women's own…
Grover, D.; Seth, R. K.
2018-05-01
Analysis and numerical results are presented for the thermoelastic dissipation of a homogeneous isotropic, thermally conducting, Kelvin-Voigt type circular micro-plate based on Kirchhoff's Love plate theory utilizing generalized viscothermoelasticity theory of dual-phase-lagging model. The analytical expressions for thermoelastic damping of vibration and frequency shift are obtained for generalized dual-phase-lagging model and coupled viscothermoelastic plates. The scaled thermoelastic damping has been illustrated in case of circular plate and axisymmetric circular plate for fixed aspect ratio for clamped and simply supported boundary conditions. It is observed that the damping of vibrations significantly depend on time delay and mechanical relaxation times in addition to thermo-mechanical coupling in circular plate under resonance conditions and plate dimensions.
Toward single-mode UV to near-IR guidance using hollow-core anti-resonant silica fiber
DEFF Research Database (Denmark)
Habib, Md Selim; Antonio-Lopez, Jose Enrique; Van Newkirk, Amy
2017-01-01
Hollow-core anti-resonant (HC-AR) fibers with a “negative-curvature” of the core-cladding boundary have been extensively studied over the past few years owing to their low loss and wide transmission bandwidths. The key unique feature of the HC-AR fiber is that the coupling between the core and cl...... a silica HC-AR fiber having a single ring of 7 non-touching capillaries, designed to have effectively single-mode operation and low loss from UV to near-IR....
Study of loading by beam of dual-resonator structure of linear electron accelerator
International Nuclear Information System (INIS)
Milovanov, O.S.; Smirnov, I.A.
1988-01-01
Loading by the beam of the accelerating structure of an Argus dual-resonator linear electron accelerator with a kinetic energy of ∼ 1 MeV and a pulsed beam current of up to 0.5 A is studied experimentally. It is shown that the conditions for stable single-frequency operation of the magnetron are disrupted and the acceleration process is cut off at certain electron-beam currents. Experimental curves of the maximum beam current and maximum electron efficiency of the Argus linear electron accelerator as functions of rf power are given
A fast spectrum dual path flow cermet reactor
International Nuclear Information System (INIS)
Anghaie, S.; Feller, G.J.; Peery, S.D.; Parsley, R.C.
1993-01-01
A cermet fueled, dual path fast reactor for space nuclear propulsion applications is conceptually designed. The reactor utilizes an outer annulus core and an inner cylindrical core with radial and axial reflector. The dual path flow minimizes the impact of power peaking near the radial reflector. Basic neutronics and core design aspects of the reactor are discussed. The dual path reactor is integrated into a 25000 lbf thrust nuclear rocket
International Nuclear Information System (INIS)
Ma Ye-Wan; Wu Zhao-Wang; Zhang Li-Hua; Liu Wan-Fang; Zhang Jie
2015-01-01
The local surface plasmon resonances (LSPRs) of dielectric-Ag core-shell nanospheres are studied by the discretedipole approximation method. The result shows that LSPRs are sensitive to the surrounding medium refractive index, which shows a clear red-shift with the increasing surrounding medium refractive index. A dielectric-Ag core-shell nanosphere exhibits a strong coupling between the core and shell plasmon resonance modes. LSPRs depend on the shell thickness and the composition of dielectric-core and metal-shell. LSPRs can be tuned over a longer wavelength range by changing the ratio of core to shell value. The lower energy mode ω_− shows a red-shift with the increasing dielectric-core value and the inner core radius, while blue-shifted with the increasing outer shell thickness. The underlying mechanisms are analyzed with the plasmon hybridization theory and the phase retardation effect. (paper)
Schmidt, Rita; Webb, Andrew
2017-10-11
Magnetic resonance imaging and spectroscopy (MRI and MRS) are both widely used techniques in medical diagnostics and research. One of the major thrusts in recent years has been the introduction of ultrahigh-field magnets in order to boost the sensitivity. Several MRI studies have examined further potential improvements in sensitivity using metamaterials, focusing on single frequency applications. However, metamaterials have yet to reach a level that is practical for routine MRI use. In this work, we explore a new metamaterial implementation for MRI, a dual-nuclei resonant structure, which can be used for both proton and heteronuclear magnetic resonance. Our approach combines two configurations, one based on a set of electric dipoles for the low frequency band, and the second based on a set of magnetic dipoles for the high frequency band. We focus on the implementation of a dual-nuclei metamaterial for phosphorus and proton imaging and spectroscopy at an ultrahigh-field strength of 7 T. In vivo scans using this flexible and compact structure show that it locally enhances both the phosphorus and proton transmit and receive sensitivities.
DEFF Research Database (Denmark)
Iwaszczuk, Krzysztof; Bisgaard, Christer Zoffmann; Andronico, Alessio
2013-01-01
We investigate the electromagnetic design of whispering gallery mode (WGM) terahertz (THz) resonators. Terahertz radiation is generated by difference-frequency mixing of two electrically pumped high-order near-infrared laser WGM's at room temperature in the active cavity. Due to the leaky nature...... this symmetry by modification of the dielectric environment of the resonator, and demonstrate a fabrication-optimized structure based on a concentric grating design which efficiently couples the emitted radiation into a narrow, near-gaussian forward-propagating cone of well-defined linear or circular...
Research on SEU hardening of heterogeneous Dual-Core SoC
Huang, Kun; Hu, Keliu; Deng, Jun; Zhang, Tao
2017-08-01
The implementation of Single-Event Upsets (SEU) hardening has various schemes. However, some of them require a lot of human, material and financial resources. This paper proposes an easy scheme on SEU hardening for Heterogeneous Dual-core SoC (HD SoC) which contains three techniques. First, the automatic Triple Modular Redundancy (TMR) technique is adopted to harden the register heaps of the processor and the instruction-fetching module. Second, Hamming codes are used to harden the random access memory (RAM). Last, a software signature technique is applied to check the programs which are running on CPU. The scheme need not to consume additional resources, and has little influence on the performance of CPU. These technologies are very mature, easy to implement and needs low cost. According to the simulation result, the scheme can satisfy the basic demand of SEU-hardening.
Climate Prediction Center (CPC) Global Monthly Leaky Bucket Soil Moisture Analysis
National Oceanic and Atmospheric Administration, Department of Commerce — Monthly global soil moisture, runoff, and evaporation data sets produced by the Leaky Bucket model at 0.5? ? 0.5? resolution for the period from 1948 to the present....
Lai, Alex L.; Tamm, Lukas K.
2010-01-01
Our previous studies showed that an angled boomerang-shaped structure of the influenza hemagglutinin (HA) fusion domain is critical for virus entry into host cells by membrane fusion. Because the acute angle of ∼105° of the wild-type fusion domain promotes efficient non-leaky membrane fusion, we asked whether different angles would still support fusion and thus facilitate virus entry. Here, we show that the G13A fusion domain mutant produces a new leaky fusion phenotype. The mutant fusion domain structure was solved by NMR spectroscopy in a lipid environment at fusion pH. The mutant adopted a boomerang structure similar to that of wild type but with a shallower kink angle of ∼150°. G13A perturbed the structure of model membranes to a lesser degree than wild type but to a greater degree than non-fusogenic fusion domain mutants. The strength of G13A binding to lipid bilayers was also intermediate between that of wild type and non-fusogenic mutants. These membrane interactions provide a clear link between structure and function of influenza fusion domains: an acute angle is required to promote clean non-leaky fusion suitable for virus entry presumably by interaction of the fusion domain with the transmembrane domain deep in the lipid bilayer. A shallower angle perturbs the bilayer of the target membrane so that it becomes leaky and unable to form a clean fusion pore. Mutants with no fixed boomerang angle interacted with bilayers weakly and did not promote any fusion or membrane perturbation. PMID:20826788
Dual-Resonant Implantable Circular Patch Antenna for Biotelemetry Communication
Directory of Open Access Journals (Sweden)
Rongqiang Li
2016-01-01
Full Text Available A compact broadband implantable circular patch antenna is designed and experimentally demonstrated for Medical Implant Communications Service (MICS band (402–405 MHz. Compared with other similar implantable antennas, the proposed antenna incorporates three advantages for biotelemetry communication. First, it can realize a broad impedance bandwidth by exhibiting dual resonances. Second, it can obtain a compact structure by introducing two arc-shaped slots, a rectangular slot and a circular slot on metal radiating patch. Finally, it can display a friendly shape by using a circular structure. The proposed antenna occupies a volume of about 431.5 mm3 (10.42 × 1.27π mm3, which is a compromise between miniaturization and bandwidth. The measured −10 dB impedance bandwidth is 55 MHz (385–440 MHz. Furthermore, the radiation performance and human body safety consideration of the antenna are examined and characterized.
Anisotropic anti-resonant elements gives broadband single-mode low-loss hollow-core fibers
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
Hollow-core fibers with node-free anisotropic anti-resonant elements give broadband low-loss fibers that are also single-moded. At 1.06 μm silica-based fiber designs show higher-order-mode extinction-ratio >1000 and losses below 10 dB/km over a broad wavelength range....
Leukemic Cells "Gas Up" Leaky Bone Marrow Blood Vessels.
Itkin, Tomer; Rafii, Shahin
2017-09-11
In this issue of Cancer Cell, Passaro et al. demonstrate how leukemia through aberrant induction of reactive oxygen species and nitric oxide production trigger marrow vessel leakiness, instigating pro-leukemic function. Disrupted tumor blood vessels promote exhaustion of non-malignant stem and progenitor cells and may facilitate leukemia relapse following chemotherapeutic treatment. Copyright © 2017. Published by Elsevier Inc.
Leaky-box approximation to the fractional diffusion model
International Nuclear Information System (INIS)
Uchaikin, V V; Sibatov, R T; Saenko, V V
2013-01-01
Two models based on fractional differential equations for galactic cosmic ray diffusion are applied to the leaky-box approximation. One of them (Lagutin-Uchaikin, 2000) assumes a finite mean free path of cosmic ray particles, another one (Lagutin-Tyumentsev, 2004) uses distribution with infinite mean distance between collision with magnetic clouds, when the trajectories have form close to ballistic. Calculations demonstrate that involving boundary conditions is incompatible with spatial distributions given by the second model.
Directory of Open Access Journals (Sweden)
Yingsong Li
2012-04-01
Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.
Leaky vessels as a potential source of stromal acidification in tumours
Martin, Natasha K.; Gaffney, Eamonn A.; Gatenby, Robert A.; Maini, Philip K.
2010-01-01
results found in vivo with a tumour implanted in the mammary fat pad of a mouse in a window chamber construct. We find that leaky vasculature can cause a net acidification of the normal tissue away from the tumour boundary, though not a progressive
Ebert, Sandra; Koo, Charmaine K W; Weiss, Jochen; McClements, David Julian
2017-02-01
Antisolvent precipitation is commonly used to fabricate protein nanoparticles using a simple batch method that involves injecting a protein-solvent mixture into an antisolvent. In this study, the potential of producing core-shell protein nanoparticles by antisolvent precipitation using a continuous dual-channel microfluidization method was investigated. The solvent phase (zein in ethanol) and antisolvent phase (casein in water) were made to impinge on each other at high velocity, which generates intense shear, turbulent, and cavitation forces that ensure thorough mixing and breakup of the phases. Relatively small core-shell protein nanoparticles (dnanoparticles went from positive at low pH to negative at high pH, with a point of zero charge around pH5. Electron microscopy indicated that the protein particles formed had a roughly spherical shape. The results suggest that the dual-channel microfluidizer could be used to continuously form protein nanoparticles by antisolvent precipitation. Nevertheless, when the microfluidization method was compared with the simple batch method the size of the particles produced under similar conditions were fairly similar. Copyright © 2016 Elsevier Ltd. All rights reserved.
Core-shell titanium dioxide-titanium nitride nanotube arrays with near-infrared plasmon resonances
Farsinezhad, Samira; Shanavas, Thariq; Mahdi, Najia; Askar, Abdelrahman M.; Kar, Piyush; Sharma, Himani; Shankar, Karthik
2018-04-01
Titanium nitride (TiN) is a ceramic with high electrical conductivity which in nanoparticle form, exhibits localized surface plasmon resonances (LSPRs) in the visible region of the solar spectrum. The ceramic nature of TiN coupled with its dielectric loss factor being comparable to that of gold, render it attractive for CMOS polarizers, refractory plasmonics, surface-enhanced Raman scattering and a whole host of sensing applications. We report core-shell TiO2-TiN nanotube arrays exhibiting LSPR peaks in the range 775-830 nm achieved by a simple, solution-based, low cost, large area-compatible fabrication route that does not involve laser-writing or lithography. Self-organized, highly ordered TiO2 nanotube arrays were grown by electrochemical anodization of Ti thin films on fluorine-doped tin oxide-coated glass substrates and then conformally coated with a thin layer of TiN using atomic layer deposition. The effects of varying the TiN layer thickness and thermal annealing on the LSPR profiles were also investigated. Modeling the TiO2-TiN core-shell nanotube structure using two different approaches, one employing effective medium approximations coupled with Fresnel coefficients, resulted in calculated optical spectra that closely matched the experimentally measured spectra. Modeling provided the insight that the observed near-infrared resonance was not collective in nature, and was mainly attributable to the longitudinal resonance of annular nanotube-like TiN particles redshifted due to the presence of the higher permittivity TiO2 matrix. The resulting TiO2-TiN core-shell nanotube structures also function as visible light responsive photocatalysts, as evidenced by their photoelectrochemical water-splitting performance under light emitting diode illumination using 400, 430 and 500 nm photons.
Abraham, Ann Rose; Raneesh, B.; Das, Dipankar; Oluwafemi, Oluwatobi Samuel; Thomas, Sabu; Kalarikkal, Nandakumar
2018-04-01
The electric field control of magnetism in multiferroics is attractive for the realization of ultra-fast and miniaturized low power device applications like nonvolatile memories. Room temperature hybrid multiferroic heterostructures with core-shell (0-0) architecture (ferrite core and ferroelectric shell) were developed via a two-step method. High-Resolution Transmission Electron Microscopy (HRTEM) images confirm the core-shell structure. The temperature dependant magnetization measurements and Mossbauer spectra reveal superparamagnetic nature of the core-shell sample. The ferroelectric hysteresis loops reveal leaky nature of the samples. The results indicate the promising applications of the samples for magneto-electric memories and spintronics.
Off-resonance frequency operation for power transfer in a loosely coupled air core transformer
Scudiere, Matthew B
2012-11-13
A power transmission system includes a loosely coupled air core transformer having a resonance frequency determined by a product of inductance and capacitance of a primary circuit including a primary coil. A secondary circuit is configured to have a substantially same product of inductance and capacitance. A back EMF generating device (e.g., a battery), which generates a back EMF with power transfer, is attached to the secondary circuit. Once the load power of the back EMF generating device exceeds a certain threshold level, which depends on the system parameters, the power transfer can be achieved at higher transfer efficiency if performed at an operating frequency less than the resonance frequency, which can be from 50% to 95% of the resonance frequency.
Numerical investigation of a tunable band-pass plasmonic filter with a hollow-core ring resonator
International Nuclear Information System (INIS)
Setayesh, Amir; Mirnaziry, S Reza; Abrishamian, Mohammad Sadegh
2011-01-01
In this study, a compact nanoscale plasmonic filter which consists of two metal–insulator–metal (MIM) waveguides coupled to each other by a rectangular ring resonator is presented and investigated numerically. The propagating modes of surface plasmon polaritons (SPPs) are studied in this structure. By replacing a portion of the ring core with air, while the outer dimensions of the structure are kept constant, we illustrate the possibility of the redshift of resonant wavelengths in order to tune the resonance modes. This feature is useful for integrated circuits in which we have limitations on the outer dimensions of the filter structure and it is not possible to enlarge the dimension of the ring resonator to reach longer resonant wavelengths. The corresponding results are illustrated by the 2D finite-difference time-domain (FDTD) method. The proposed structure has potential applications in plasmonic integrated circuits and can be simply fabricated
Numerical investigation of a tunable band-pass plasmonic filter with a hollow-core ring resonator
Setayesh, Amir; Mirnaziry, S. Reza; Sadegh Abrishamian, Mohammad
2011-03-01
In this study, a compact nanoscale plasmonic filter which consists of two metal-insulator-metal (MIM) waveguides coupled to each other by a rectangular ring resonator is presented and investigated numerically. The propagating modes of surface plasmon polaritons (SPPs) are studied in this structure. By replacing a portion of the ring core with air, while the outer dimensions of the structure are kept constant, we illustrate the possibility of the redshift of resonant wavelengths in order to tune the resonance modes. This feature is useful for integrated circuits in which we have limitations on the outer dimensions of the filter structure and it is not possible to enlarge the dimension of the ring resonator to reach longer resonant wavelengths. The corresponding results are illustrated by the 2D finite-difference time-domain (FDTD) method. The proposed structure has potential applications in plasmonic integrated circuits and can be simply fabricated.
Research on dual-parameter optical fiber sensor based on thin-core fiber and spherical structure
Tong, Zhengrong; Wang, Xue; Zhang, Weihua; Xue, Lifang
2018-04-01
A novel dual-parameter optical fiber sensor is proposed and experimentally demonstrated. The proposed sensor is based on a fiber in-line Mach-Zehnder interferometer, which is fabricated by sandwiching a section of thin-core fiber between two spherical structures made of single-mode fibers. The transmission spectrum exhibits the response of the interference between the core and the different cladding modes. Due to the different wavelength shifts of the two selected dips, the simultaneous measurement of temperature and the surrounding refractive index can be achieved. The measured temperature sensitivities are 0.067 nm/°C and 0.050 nm/°C, and the refractive index sensitivities are -119.9 nm/RIU and -69.71 nm/RIU, respectively. In addition, the compact size, simple fabrication and cost-effectiveness of the fiber sensor are also advantages.
Electromagnetic Form Factors of Hadrons in Dual-Large Nc QCD
International Nuclear Information System (INIS)
Dominguez, C. A.
2011-01-01
In this talk, results are presented of determinations of electromagnetic form factors of hadrons (pion, proton, and Δ(1236)) in the framework of Dual-Large N c QCD (Dual-QCD ∞ ). This framework improves considerably tree-level VMD results by incorporating an infinite number of zero-width resonances, with masses and couplings fixed by the dual-resonance (Veneziano-type) model.
International Nuclear Information System (INIS)
Chen, J.M.; Lu, K.T.; Lee, J.M.; Ho, S.C.; Chang, H.W.; Lee, Y.Y.
2005-01-01
State-selective dissociation dynamics for the excited fragments of gaseous Si(CH 3 ) 2 Cl 2 following Cl 2p and Si 2p core-level excitations have been investigated by resonant photoemission spectroscopy and dispersed UV/optical fluorescence spectroscopy. The main features in the gaseous Si(CH 3 ) 2 Cl 2 fluorescence spectrum are identified as the emission from excited Si*, Si + *, CH* and H*. The core-to-Rydberg excitations at both Si 2p and Cl 2p edges lead to a noteworthy production of not only the excited atomic fragments, neutral and ionic (Si*, Si + *) but also the excited diatomic fragments (CH*). In particular, the excited neutral atomic fragments Si* are significantly reinforced. The experimental results provide deeper insight into the state-selective dissociation dynamics for the excited fragments of molecules via core-level excitation
Learning Sparse Visual Representations with Leaky Capped Norm Regularizers
Wangni, Jianqiao; Lin, Dahua
2017-01-01
Sparsity inducing regularization is an important part for learning over-complete visual representations. Despite the popularity of $\\ell_1$ regularization, in this paper, we investigate the usage of non-convex regularizations in this problem. Our contribution consists of three parts. First, we propose the leaky capped norm regularization (LCNR), which allows model weights below a certain threshold to be regularized more strongly as opposed to those above, therefore imposes strong sparsity and...
A Low-Cost and Portable Dual-Channel Fiber Optic Surface Plasmon Resonance System.
Liu, Qiang; Liu, Yun; Chen, Shimeng; Wang, Fang; Peng, Wei
2017-12-04
A miniaturization and integration dual-channel fiber optic surface plasmon resonance (SPR) system was proposed and demonstrated in this paper. We used a yellow light-emitting diode (LED, peak wavelength 595 nm) and built-in web camera as a light source and detector, respectively. Except for the detection channel, one of the sensors was used as a reference channel to compensate nonspecific binding and physical absorption. We packaged the LED and surface plasmon resonance (SPR) sensors together, which are flexible enough to be applied to mobile devices as a compact and portable system. Experimental results show that the normalized intensity shift and refractive index (RI) of the sample have a good linear relationship in the RI range from 1.328 to 1.348. We used this sensor to monitor the reversible, specific interaction between lectin concanavalin A (Con A) and glycoprotein ribonuclease B (RNase B), which demonstrate its capabilities of specific identification and biochemical samples concentration detection. This sensor system has potential applications in various fields, such as medical diagnosis, public health, food safety, and environment monitoring.
Energy Technology Data Exchange (ETDEWEB)
An, Yanling; Wei, Pan; Fan, Meiqiang, E-mail: fanmeiqiang@126.com; Chen, Da; Chen, Haichao; Ju, QiangJian; Tian, Guanglei; Shu, Kangying
2016-07-01
Highlights: • A dual core-shell hPANI/S/PANI composite was prepared in situ synthesis. • Cycle performance of the hPANI/S/PANI composite was enhanced. • The improvement was due to fine sulfur particles wrapped by two PANI films. • Some positive effects were elaborated. - Abstract: In this study, a dual-shell hollow polyaniline/sulfur-core/polyaniline (hPANI/S/PANI) composite was prepared by successively depositing PANI, S, and PANI on the surface of a template silicon sphere. The electrochemical properties of this composite were evaluated using a lithium plate as an anode in lithium/sulfur cells. The hPANI/S/PANI composite showed a discharge capacity of 572.2 mAh g{sup −1} after 214 cycles at 0.1 C, and the Coulombic efficiency was above 87% in the whole charge/discharge cycle. The improved cycle property of the hPANI/S/PANI composite can be ascribed to the fine sulfur particles homogeneously deposited on the PANI surface and sprawled inside the two PANI layers during the charge/discharge cycle. This behavior stabilized the nanostructure of sulfur and enhanced its conductivity.
Reducing support loss in micromechanical ring resonators using phononic band-gap structures
Energy Technology Data Exchange (ETDEWEB)
Hsu, Feng-Chia; Huang, Tsun-Che; Wang, Chin-Hung; Chang, Pin [Industrial Technology Research Institute-South, Tainan 709, Taiwan (China); Hsu, Jin-Chen, E-mail: fengchiahsu@itri.org.t, E-mail: hsujc@yuntech.edu.t [Department of Mechanical Engineering, National Yunlin University of Science and Technology, Douliou, Yunlin 64002, Taiwan (China)
2011-09-21
In micromechanical resonators, energy loss via supports into the substrates may lead to a low quality factor. To eliminate the support loss, in this paper a phononic band-gap structure is employed. We demonstrate a design of phononic-crystal (PC) strips used to support extensional wine-glass mode ring resonators to increase the quality factor. The PC strips are introduced to stop elastic-wave propagation by the band-gap and deaf-band effects. Analyses of resonant characteristics of the ring resonators and the dispersion relations, eigenmodes, and transmission properties of the PC strips are presented. With the proposed resonator architecture, the finite-element simulations show that the leaky power is effectively reduced and the stored energy inside the resonators is enhanced simultaneously as the operating frequencies of the resonators are within the band gap or deaf bands. Realization of a high quality factor micromechanical ring resonator with minimized support loss is expected.
Reducing support loss in micromechanical ring resonators using phononic band-gap structures
International Nuclear Information System (INIS)
Hsu, Feng-Chia; Huang, Tsun-Che; Wang, Chin-Hung; Chang, Pin; Hsu, Jin-Chen
2011-01-01
In micromechanical resonators, energy loss via supports into the substrates may lead to a low quality factor. To eliminate the support loss, in this paper a phononic band-gap structure is employed. We demonstrate a design of phononic-crystal (PC) strips used to support extensional wine-glass mode ring resonators to increase the quality factor. The PC strips are introduced to stop elastic-wave propagation by the band-gap and deaf-band effects. Analyses of resonant characteristics of the ring resonators and the dispersion relations, eigenmodes, and transmission properties of the PC strips are presented. With the proposed resonator architecture, the finite-element simulations show that the leaky power is effectively reduced and the stored energy inside the resonators is enhanced simultaneously as the operating frequencies of the resonators are within the band gap or deaf bands. Realization of a high quality factor micromechanical ring resonator with minimized support loss is expected.
Contributed Review: Nuclear magnetic resonance core analysis at 0.3 T
International Nuclear Information System (INIS)
Mitchell, Jonathan; Fordham, Edmund J.
2014-01-01
Nuclear magnetic resonance (NMR) provides a powerful toolbox for petrophysical characterization of reservoir core plugs and fluids in the laboratory. Previously, there has been considerable focus on low field magnet technology for well log calibration. Now there is renewed interest in the study of reservoir samples using stronger magnets to complement these standard NMR measurements. Here, the capabilities of an imaging magnet with a field strength of 0.3 T (corresponding to 12.9 MHz for proton) are reviewed in the context of reservoir core analysis. Quantitative estimates of porosity (saturation) and pore size distributions are obtained under favorable conditions (e.g., in carbonates), with the added advantage of multidimensional imaging, detection of lower gyromagnetic ratio nuclei, and short probe recovery times that make the system suitable for shale studies. Intermediate field instruments provide quantitative porosity maps of rock plugs that cannot be obtained using high field medical scanners due to the field-dependent susceptibility contrast in the porous medium. Example data are presented that highlight the potential applications of an intermediate field imaging instrument as a complement to low field instruments in core analysis and for materials science studies in general
An Exposed-Core Grapefruit Fibers Based Surface Plasmon Resonance Sensor
Directory of Open Access Journals (Sweden)
Xianchao Yang
2015-07-01
Full Text Available To solve the problem of air hole coating and analyte filling in microstructured optical fiber-based surface plasmon resonance (SPR sensors, we designed an exposed-core grapefruit fiber (EC-GFs-based SPR sensor. The exposed section of the EC-GF is coated with a SPR, supporting thin silver film, which can sense the analyte in the external environment. The asymmetrically coated fiber can support two separate resonance peaks (x- and y-polarized peaks with orthogonal polarizations and x-polarized peak, providing a much higher peak loss than y-polarized, also the x-polarized peak has higher wavelength and amplitude sensitivities. A large analyte refractive index (RI range from 1.33 to 1.42 is calculated to investigate the sensing performance of the sensor, and an extremely high wavelength sensitivity of 13,500 nm/refractive index unit (RIU is obtained. The silver layer thickness, which may affect the sensing performance, is also discussed. This work can provide a reference for developing a high sensitivity, real-time, fast-response, and distributed SPR RI sensor.
Low loss mid-IR transmission bands using silica hollow-core anisotropic anti-resonant fibers
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
In this paper, a node-free anisotropic hollow-core anti-resonant fiber has been proposed to give low transmission loss in the near-IR to mid-IR spectral regime. The proposed silica-based fiber design shows transmission loss below 10 dB/km at 2.94 μm with multiple low loss transmission bands. Tran...
Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais
2017-01-13
An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.
Song, Hyon-Min; Wei, Qingshan; Ong, Quy K.; Wei, Alexander
2010-01-01
Plasmon-resonant gold nanostars (NSTs) with magnetic cores were synthesized by a multistep sequence from superparamagnetic Fe3O4 nanoparticles (NPs), and evaluated as optical contrast agents under magnetomotive (MM) imaging conditions. Core–shell Fe3O4@Au NPs were prepared in nonpolar organic solvents with nanometer control over shell thickness, and with good epitaxy to the Fe3O4 surface. Anisotropic growth was performed in micellar solutions of cetyltrimethylammonium bromide (CTAB) under mil...
International Nuclear Information System (INIS)
Prabhu Gaunkar, N.; Bouda, N. R. Y.; Nlebedim, I. C.; Hadimani, R. L.; Mina, M.; Jiles, D. C.; Bulu, I.; Ganesan, K.; Song, Y. Q.
2015-01-01
This work presents investigations and detailed analysis of ringing in a non-resonant pulsed nuclear magnetic resonance (NMR) circuit. Ringing is a commonly observed phenomenon in high power switching circuits. The oscillations described as ringing impede measurements in pulsed NMR systems. It is therefore desirable that those oscillations decay fast. It is often assumed that one of the causes behind ringing is the role of the magnetic core used in the antenna (acting as an inductive load). We will demonstrate that an LRC subcircuit is also set-up due to the inductive load and needs to be considered due to its parasitic effects. It is observed that the parasitics associated with the inductive load become important at certain frequencies. The output response can be related to the response of an under-damped circuit and to the magnetic core material. This research work demonstrates and discusses ways of controlling ringing by considering interrelationships between different contributing factors
Energy Technology Data Exchange (ETDEWEB)
Prabhu Gaunkar, N., E-mail: neelampg@iastate.edu; Bouda, N. R. Y.; Nlebedim, I. C.; Hadimani, R. L.; Mina, M.; Jiles, D. C. [Department of Electrical and Computer Engineering, Iowa State University, Ames, Iowa 50011 (United States); Bulu, I.; Ganesan, K.; Song, Y. Q. [Schlumberger-Doll Research, Cambridge, Massachusetts 02139 (United States)
2015-05-07
This work presents investigations and detailed analysis of ringing in a non-resonant pulsed nuclear magnetic resonance (NMR) circuit. Ringing is a commonly observed phenomenon in high power switching circuits. The oscillations described as ringing impede measurements in pulsed NMR systems. It is therefore desirable that those oscillations decay fast. It is often assumed that one of the causes behind ringing is the role of the magnetic core used in the antenna (acting as an inductive load). We will demonstrate that an LRC subcircuit is also set-up due to the inductive load and needs to be considered due to its parasitic effects. It is observed that the parasitics associated with the inductive load become important at certain frequencies. The output response can be related to the response of an under-damped circuit and to the magnetic core material. This research work demonstrates and discusses ways of controlling ringing by considering interrelationships between different contributing factors.
Aronoff-Spencer, Eliah; Venkatesh, A G; Sun, Alex; Brickner, Howard; Looney, David; Hall, Drew A
2016-12-15
Yeast cell lines were genetically engineered to display Hepatitis C virus (HCV) core antigen linked to gold binding peptide (GBP) as a dual-affinity biobrick chimera. These multifunctional yeast cells adhere to the gold sensor surface while simultaneously acting as a "renewable" capture reagent for anti-HCV core antibody. This streamlined functionalization and detection strategy removes the need for traditional purification and immobilization techniques. With this biobrick construct, both optical and electrochemical immunoassays were developed. The optical immunoassays demonstrated detection of anti-HCV core antibody down to 12.3pM concentrations while the electrochemical assay demonstrated higher binding constants and dynamic range. The electrochemical format and a custom, low-cost smartphone-based potentiostat ($20 USD) yielded comparable results to assays performed on a state-of-the-art electrochemical workstation. We propose this combination of synthetic biology and scalable, point-of-care sensing has potential to provide low-cost, cutting edge diagnostic capability for many pathogens in a variety of settings. Copyright © 2016 Elsevier B.V. All rights reserved.
Ferguson, A L; Hughes, A D; Tufail, U; Baumann, C G; Scott, D J; Hoggett, J G
2000-09-22
The interaction between the core form of bacterial RNA polymerases and sigma factors is essential for specific promoter recognition, and for coordinating the expression of different sets of genes in response to varying cellular needs. The interaction between Escherichia coli core RNA polymerase and sigma 70 has been investigated by surface plasmon resonance. The His-tagged form of sigma 70 factor was immobilised on a Ni2+-NTA chip for monitoring its interaction with core polymerase. The binding constant for the interaction was found to be 1.9x10(-7) M, and the dissociation rate constant for release of sigma from core, in the absence of DNA or transcription, was 4x10(-3) s(-1), corresponding to a half-life of about 200 s.
The Morris-Lecar neuron model embeds a leaky integrate-and-fire model
DEFF Research Database (Denmark)
Ditlevsen, Susanne; Greenwood, Priscilla
2013-01-01
We showthat the stochastic Morris–Lecar neuron, in a neighborhood of its stable point, can be approximated by a two-dimensional Ornstein Uhlenbeck (OU) modulation of a constant circular motion. The associated radial OU process is an example of a leaky integrate-and-fire (LIF) model prior to firing...
Ferromagnetic resonance studies of lunar core stratigraphy
Housley, R. M.; Cirlin, E. H.; Goldberg, I. B.; Crowe, H.
1976-01-01
We first review the evidence which links the characteristic ferromagnetic resonance observed in lunar fines samples with agglutinatic glass produced primarily by micrometeorite impacts and present new results on Apollo 15, 16, and 17 breccias which support this link by showing that only regolith breccias contribute significantly to the characteristic FMR intensity. We then provide a calibration of the amount of Fe metal in the form of uniformly magnetized spheres required to give our observed FMR intensities and discuss the theoretical magnetic behavior to be expected of Fe spheres as a function of size. Finally, we present FMR results on samples from every 5 mm interval in the core segments 60003, 60009, and 70009. These results lead us to suggest: (1) that secondary mixing may generally be extensive during regolith deposition so that buried regolith surfaces are hard to recognize or define; and (2) that local grinding of rocks and pebbles during deposition may lead to short scale fluctuations in grain size, composition, and apparent exposure age of samples.
Properties of quasi-elastic processes due to exchange of one dual pomeron
International Nuclear Information System (INIS)
Gedalin, Eh.V.; Gurvich, E.G.
1975-01-01
The asymptotic (at S tending to infinity) characteristics of four-particle amplitudes of diffraction scattering of resonance states in the dual-resonance model is considered in the lower order of the dual theory of perturbations. It is shown that for transverse transferred momentum K→0, at least for part of the spectrum of states of the dual resonance model - i.e. of the transverse states -, the scattering amplitudes are zero, except for the elastically scattered ones, which are all identical. (author)
Directory of Open Access Journals (Sweden)
T. Marchenko
2015-08-01
Full Text Available We present an experimental and theoretical study of resonant inelastic x-ray scattering (RIXS in the carbon disulphide CS_{2} molecule near the sulfur K-absorption edge. We observe a strong evolution of the RIXS spectral profile with the excitation energy tuned below the lowest unoccupied molecular orbital (LUMO absorption resonance. The reason for this is twofold. Reducing the photon energy in the vicinity of the LUMO absorption resonance leads to a relative suppression of the LUMO contribution with respect to the emission signal from the higher unoccupied molecular orbitals, which results in the modulation of the total RIXS profile. At even larger negative photon-energy detuning from the resonance, the excitation-energy dependence of the RIXS profile is dominated by the onset of electron dynamics triggered by a coherent excitation of multiple electronic states. Furthermore, our study demonstrates that in the hard x-ray regime, localization of the S 1s core hole occurs in CS_{2} during the RIXS process because of the orientational dephasing of interference between the waves scattering on the two sulfur atoms. Core-hole localization leads to violation of the symmetry selection rules for the electron transitions observed in the spectra.
Coupling between core and cladding modes in a helical core fiber with large core offset
International Nuclear Information System (INIS)
Napiorkowski, Maciej; Urbanczyk, Waclaw
2016-01-01
We analyzed the effect of resonant coupling between core and cladding modes in a helical core fiber with large core offset using the fully vectorial method based on the transformation optics formalism. Our study revealed that the resonant couplings to lower order cladding modes predicted by perturbative methods and observed experimentally in fibers with small core offsets are in fact prohibited for larger core offsets. This effect is related to the lack of phase matching caused by elongation of the optical path of the fundamental modes in the helical core. Moreover, strong couplings to the cladding modes of the azimuthal modal number much higher than predicted by perturbative methods may be observed for large core offsets, as the core offset introduces higher order angular harmonics in the field distribution of the fundamental modes. Finally, in contrast to previous studies, we demonstrate the existence of spectrally broad polarization sensitive couplings to the cladding modes suggesting that helical core fibers with large core offsets may be used as broadband circular polarizers. (paper)
Mini-cavity plasma core reactors for dual-mode space nuclear power/propulsion systems
International Nuclear Information System (INIS)
Chow, S.
1976-01-01
A mini-cavity plasma core reactor is investigated for potential use in a dual-mode space power and propulsion system. In the propulsive mode, hydrogen propellant is injected radially inward through the reactor solid regions and into the cavity. The propellant is heated by both solid driver fuel elements surrounding the cavity and uranium plasma before it is exhausted out the nozzle. The propellant only removes a fraction of the driver power, the remainder is transferred by a coolant fluid to a power conversion system, which incorporates a radiator for heat rejection. In the power generation mode, the plasma and propellant flows are shut off, and the driver elements supply thermal power to the power conversion system, which generates electricity for primary electric propulsion purposes
Resonant photoemission at core-level shake-up thresholds: Valence-band satellites in nickel
International Nuclear Information System (INIS)
Bjoerneholm, O.; Andersen, J.N.; Wigren, C.; Nilsson, A.; Nyholm, R.; Ma; Ortensson, N.
1990-01-01
Three-hole satellites (3d 7 final-state configuration) in the nickel valence-band photoelectron spectrum have been identified at 13 and 18 eV binding energy with use of synchrotron radiation from the MAX storage ring. The three-hole satellites show resonances at photon energies close to the threshold for excitation of 3p 5 3d 9 core-hole shake-up states. The 13-eV satellite also shows a resonance directly at the 3p threshold. This is interpreted as an interference between the direct three-hole ionization and a shake-up transition in the Auger decay of the 3p hole. This shake-up process is also identified directly in the M 2,3 M 4,5 M 4,5 Auger spectrum
An FMM based on dual tree traversal for many-core architectures
Yokota, Rio
2013-09-01
The present work attempts to integrate the independent efforts in the fast N-body community to create the fastest N-body library for many-core and heterogenous architectures. Focus is placed on low accuracy optimizations, in response to the recent interest to use FMM as a preconditioner for sparse linear solvers. A direct comparison with other state-of-the-art fast N-body codes demonstrates that orders of magnitude increase in performance can be achieved by careful selection of the optimal algorithm and low-level optimization of the code. The current N-body solver uses a fast multipole method with an efficient strategy for finding the list of cell-cell interactions by a dual tree traversal. A task-based threading model is used to maximize thread-level parallelism and intra-node load-balancing. In order to extract the full potential of the SIMD units on the latest CPUs, the inner kernels are optimized using AVX instructions.
Chen, Yen-Lin; Chiang, Hsin-Han; Chiang, Chuan-Yen; Liu, Chuan-Ming; Yuan, Shyan-Ming; Wang, Jenq-Haur
2012-01-01
This study proposes a vision-based intelligent nighttime driver assistance and surveillance system (VIDASS system) implemented by a set of embedded software components and modules, and integrates these modules to accomplish a component-based system framework on an embedded heterogamous dual-core platform. Therefore, this study develops and implements computer vision and sensing techniques of nighttime vehicle detection, collision warning determination, and traffic event recording. The proposed system processes the road-scene frames in front of the host car captured from CCD sensors mounted on the host vehicle. These vision-based sensing and processing technologies are integrated and implemented on an ARM-DSP heterogamous dual-core embedded platform. Peripheral devices, including image grabbing devices, communication modules, and other in-vehicle control devices, are also integrated to form an in-vehicle-embedded vision-based nighttime driver assistance and surveillance system.
Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays
International Nuclear Information System (INIS)
Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.
2004-01-01
The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone
Compact Dual-Band Zeroth-Order Resonance Antenna
International Nuclear Information System (INIS)
Xu He-Xiu; Wang Guang-Ming; Gong Jian-Qiang
2012-01-01
A novel microstrip zeroth-order resonator (ZOR) antenna and its equivalent circuit model are exploited with two zeroth-order resonances. It is constructed based on a resonant-type composite right/left handed transmission line (CRLH TL) using a Wunderlich-shaped extended complementary single split ring resonator pair (W-ECSSRRP) and a series capacitive gap. The gap either can be utilized for double negative (DNG) ZOR antenna or be removed to engineer a simplified elision-negative ZOR (ENG) antenna. For verification, a DNG ZOR antenna sample is fabricated and measured. Numerical and experimental results agree well with each other, indicating that the omnidirectional radiations occur at two frequency bands which are accounted for by two shunt branches in the circuit model. The size of the antenna is 49% more compact than its previous counterpart. The superiority of W-ECSSRRP over CSSRRP lies in the lower fundamental resonance of the antenna by 38.2% and the introduction of a higher zeroth-order resonance. (fundamental areas of phenomenology(including applications))
Adhesion of resin composite core materials to dentin.
O'Keefe, K L; Powers, J M
2001-01-01
This study determined (1) the effect of polymerization mode of resin composite core materials and dental adhesives on the bond strength to dentin, and (2) if dental adhesives perform as well to dentin etched with phosphoric acid as to dentin etched with self-etching primer. Human third molars were sectioned 2 mm from the highest pulp horn and polished. Three core materials (Fluorocore [dual cured], Core Paste [self-cured], and Clearfil Photo Core [light cured]) and two adhesives (Prime & Bond NT Dual Cure and Clearfil SE Bond [light cured]) were bonded to dentin using two dentin etching conditions. After storage, specimens were debonded in microtension and bond strengths were calculated. Scanning electron micrographs of representative bonding interfaces were analyzed. Analysis showed differences among core materials, adhesives, and etching conditions. Among core materials, dual-cured Fluorocore had the highest bond strengths. There were incompatibilities between self-cured Core Paste and Prime & Bond NT in both etched (0 MPa) and nonetched (3.0 MPa) dentin. Among adhesives, in most cases Clearfil SE Bond had higher bond strengths than Prime & Bond NT and bond strengths were higher to self-etched than to phosphoric acid-etched dentin. Scanning electron micrographs did not show a relationship between resin tags and bond strengths. There were incompatibilities between a self-cured core material and a dual-cured adhesive. All other combinations of core materials and adhesives produced strong in vitro bond strengths both in the self-etched and phosphoric acid-etched conditions.
Resonant-spin-ordering of vortex cores in interacting mesomagnets
Jain, Shikha
2013-03-01
The magnetic system of interacting vortex-state elements have a dynamically reconfigurable ground state characterized by different relative polarities and chiralities of the individual disks; and have a corresponding dynamically controlled spectrum of collective excitation modes that determine the microwave absorption of the crystal. The development of effective methods for dynamic control of the ground state in this vortex-type magnonic crystal is of interest both from fundamental and technological viewpoints. Control of vortex chirality has been demonstrated previously using various techniques; however, control and manipulation of vortex polarities remain challenging. In this work, we present a robust and efficient way of selecting the ground state configuration of interacting magnetic elements using resonant-spin-ordering approach. This is achieved by driving the system from the linear regime of constant vortex gyrations to the non-linear regime of vortex-core reversals at a fixed excitation frequency of one of the coupled modes. Subsequently reducing the excitation field to the linear regime stabilizes the system to a polarity combination whose resonant frequency is decoupled from the initialization frequency. We have utilized the resonant approach to transition between the two polarity combinations (parallel or antiparallel) in a model system of connected dot-pairs which may form the building blocks of vortex-based magnonic crystals. Taking a step further, we have extended the technique by studying many-particle system for its potential as spin-torque oscillators or logic devices. Work at Argonne was supported by the U. S. DOE, Office of BES, under Contract No. DE-AC02-06CH11357. This work was in part supported by grant DMR-1015175 from the U. S. National Science Foundation, by a Contract from the U.S. Army TARDEC and RDECOM.
DEFF Research Database (Denmark)
Hansen, Troels Vejle; Kim, Oleksiy S.; Breinbjerg, Olav
2014-01-01
For spherical antennas consisting of a solid magnetodielectric lossy core with an impressed surface current density exciting a superposition of the ${\\rm TE}_{mn}$ and ${\\rm TM}_{mn}$ spherical modes, we analytically determine the radiation quality factor $Q$ and radiation efficiency $e$ . Also, we...
Anderson, Christian E; Donnola, Shannon B; Jiang, Yun; Batesole, Joshua; Darrah, Rebecca; Drumm, Mitchell L; Brady-Kalnay, Susann M; Steinmetz, Nicole F; Yu, Xin; Griswold, Mark A; Flask, Chris A
2017-08-16
Injectable Magnetic Resonance Imaging (MRI) contrast agents have been widely used to provide critical assessments of disease for both clinical and basic science imaging research studies. The scope of available MRI contrast agents has expanded over the years with the emergence of molecular imaging contrast agents specifically targeted to biological markers. Unfortunately, synergistic application of more than a single molecular contrast agent has been limited by MRI's ability to only dynamically measure a single agent at a time. In this study, a new Dual Contrast - Magnetic Resonance Fingerprinting (DC - MRF) methodology is described that can detect and independently quantify the local concentration of multiple MRI contrast agents following simultaneous administration. This "multi-color" MRI methodology provides the opportunity to monitor multiple molecular species simultaneously and provides a practical, quantitative imaging framework for the eventual clinical translation of molecular imaging contrast agents.
Directory of Open Access Journals (Sweden)
Ye Chang
2018-01-01
Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.
Broadband polymer microstructured THz fiber coupler with downdoped cores
DEFF Research Database (Denmark)
Nielsen, Kristian; Rasmussen, Henrik K.; Bang, Ole
2010-01-01
We demonstrate a broadband THz directional coupler based on a dual core photonic crystal fiber (PCF) design with mechanically down-doped core regions. For a center frequency of 1.3 THz we demonstrate a bandwidth of 0.65 THz.......We demonstrate a broadband THz directional coupler based on a dual core photonic crystal fiber (PCF) design with mechanically down-doped core regions. For a center frequency of 1.3 THz we demonstrate a bandwidth of 0.65 THz....
Marchenko , T; Carniato , S; Journel , L; Guillemin , R; Kawerk , E; Žitnik , M; Kavčič , M; Bučar , K; Bohinc , R; Petric , M; da Cruz , V Vaz; Gel'mukhanov , F; Simon , Marielle
2015-01-01
International audience; We present an experimental and theoretical study of resonant inelastic x-ray scattering (RIXS) in the CS2 molecule near the S 1s edge. We show that localization of the S 1s core-hole occurs in CS2 during the RIXS process due to the orientational dephasing of interference between the waves scattering on the two sulfur atoms. Strong evolution of the RIXS profile with the excitation energy far below the first absorption resonance reflects the onset of electron dynamics tr...
Varma, Ruchi; Ghosh, Jayanta
2018-06-01
A new hybrid technique, which is a combination of neural network (NN) and support vector machine, is proposed for designing of different slotted dual band proximity coupled microstrip antennas. Slots on the patch are employed to produce the second resonance along with size reduction. The proposed hybrid model provides flexibility to design the dual band antennas in the frequency range from 1 to 6 GHz. This includes DCS (1.71-1.88 GHz), PCS (1.88-1.99 GHz), UMTS (1.92-2.17 GHz), LTE2300 (2.3-2.4 GHz), Bluetooth (2.4-2.485 GHz), WiMAX (3.3-3.7 GHz), and WLAN (5.15-5.35 GHz, 5.725-5.825 GHz) bands applications. Also, the comparative study of this proposed technique is done with the existing methods like knowledge based NN and support vector machine. The proposed method is found to be more accurate in terms of % error and root mean square % error and the results are in good accord with the measured values.
DEFF Research Database (Denmark)
Habib, Md Selim; Markos, Christos; Bang, Ole
2017-01-01
Hollow-core anti-resonant (HC-AR) fibers are perhaps the best platform for ultrafast nonlinear optics based on light-gas interactions because they offer broadband guidance and low-loss guidance. The main advantage of using gases inside HC fibers is that both the dispersion and nonlinearity can...... be tuned by simply changing the pressure of the gas [1]. The emission of efficient dispersive wave (DW) in the deep-UV has been already observed in a uniform Ar-filled hollow-core fiber with tunability from 200 to 320 nm by changing the gas pressure and pulse energy [2]. In the quest of optimizing...
International Nuclear Information System (INIS)
Marchenko, T; Carniato, S; Journel, L; Guillemin, R; Kawerk, E; Simon, M; Žitnik, M; Kavčič, M; Bučar, K; Bohinc, R; Petric, M; Da Cruz, V Vaz; Gel'mukhanov, F
2015-01-01
We present an experimental and theoretical study of resonant inelastic x-ray scattering (RIXS) in the CS 2 molecule near the S 1s edge. We show that localization of the S 1s core-hole occurs in CS 2 during the RIXS process due to the orientational dephasing of interference between the waves scattering on the two sulfur atoms. Strong evolution of the RIXS profile with the excitation energy far below the first absorption resonance reflects the onset of electron dynamics triggered by a coherent excitation of multiple electronic states. (paper)
Monitoring of biofilm growth using ATR-leaky mode spectroscopy
International Nuclear Information System (INIS)
Leitz, M.; Franke, H.; Grattan, K.T.V.; Tamachkiarow, A.
2002-01-01
An approach to the in situ monitoring of biofilm formation using the technique of ATR-leaky mode spectroscopy is given as an example for the case of Cytophaga. The biofilm growth was studied on an aluminium layer and on a bilayer of the hydrogel agarose on aluminium. This metal was chosen because of its chemical stability in aqueous systems. The spectra obtained have been recorded using a flow cell to contain the suspension and nutrients over a period of several days. In the case considered using a prism surface coated with agarose, the experiments were performed by breeding in an incubator. (author)
Isotope study on the Keuper sandstone aquifer with a leaky cover layer
International Nuclear Information System (INIS)
Geyh, M.A.; Backhaus, G.; Andres, G.; Rudolph, J.; Rath, H.K.
1984-01-01
Analyses of 14 C, 3 H, 39 Ar, delta 13 C and delta 18 O were performed on groundwater samples taken from the confined Keuper sandstone aquifer north of Nuremberg. The conventional 14 C data apparently contradict the hydrodynamic concept that the age of the deep groundwater flowing from east to west increases in the same direction. A two-dimensional dispersion model is used to convert the conventional 14 C groundwater ages to the regionally valid hydraulic conductivity coefficient of the leaky cover layer confining the aquifer. The basic assumption is that the deep groundwater has a water component which has percolated through the cover layer and which, on mixing, has changed the 14 C ages of the deep groundwater. Therefore, the ratio of the water from 'leaky' recharge to the water from the catchment area plays an important role. Values of delta 18 O and recharge temperatures derived from the noble-gas content of the deep water indicate mixing of Holocene and Pleistocene groundwaters and confirm the model. The considerable differences between the 39 Ar and 14 C groundwater ages may be plausibly explained by the hydrodynamic situation if 39 Ar production in the aquitard is assumed. (author)
Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin
2017-06-01
The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.
International Nuclear Information System (INIS)
Yamaoki, Rumi; Kimura, Shojiro; Ohta, Masatoshi
2011-01-01
Characteristics of free radical components of irradiated black pepper fruit (skin) and the pepper seed (core) were analyzed using electron spin resonance. A weak signal near g=2.005 was observed in black pepper before irradiation. Complex spectra near g=2.005 with three lines (the skin) or seven lines (the core) were observed in irradiated black pepper (both end line width; ca. 6.8 mT). The spectral intensities decreased considerably at 30 days after irradiation, and continued to decrease steadily thereafter. The spectra simulated on the basis of the content and the stability of radical components derived from plant constituents, including fiber, starch, polyphenol, mono- and disaccharide, were in good agreement with the observed spectra. Analysis showed that the signal intensities derived from fiber in the skin for an absorbed dose were higher, and the rates of decrease were lower, than that in the core. In particular, the cellulose radical component in the skin was highly stable. - Highlights: → We identified the radical components in irradiated black pepper skin and core. → The ESR spectra near g=2.005 with 3-7 lines were emerged after irradiation. → Spectra simulated basing on the content and the stability of radical from the plant constituents. → Cellulose radical component in black pepper skin was highly stable. → Single signal near g=2.005 was the most stable in black pepper core.
Federal Laboratory Consortium — The Animal Magnetic Resonance Imaging (MRI) Core develops and optimizes MRI methods for cardiovascular imaging of mice and rats. The Core provides imaging expertise,...
Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan
2018-04-01
Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.
Directory of Open Access Journals (Sweden)
Alfakih Khaled
2011-05-01
Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined
Directory of Open Access Journals (Sweden)
E. S. Ahmed
2012-06-01
Full Text Available A new class of dual mode microstrip fractal resonator is proposed and developed for miniaturization of the dual band bandpass filter. The perimeter of the proposed resonator is increased by employing fourth iteration T-square fractal shape. Consequently the lower resonant frequency of the filter is decreased without increasing the usable space. The self similarity of the usable structure enables it to produce the two degenerate modes which are coupled using the proper perturbation technique. The shorting pin is placed at the null in the surface current distribution at the center of the resonator. This shorting pin is coactively coupled to the resonant circuit of the resonator, effectively coupled to the lower degenerate mode and reduces the lower edge band resonant frequency. By adjusting the resonator dimensions and the size of the shorting pin, the resonant frequency and the out-of-band rejection around the transmission bands can be controlled to meet the design requirements. The simulated response of the designed filter has two transmission bands, the first band is from 2.34-3.65 GHz with resonant frequencies at 2.47GHz and 3.55GHz, the second band is from 4.37-5.324GHz with resonant frequencies at 4.5GHz and 5.13GHz. In the pass bands, the group delay is less than 0.65 ns. The proposed filter can be applied to WLAN (2.4 GHz and 5.2 GHz and WiMAX (3.5 GHz and Bluetooth and ZigBee (4.9 GHz.
Intrinsically radiolabelled [59Fe]-SPIONs for dual MRI/radionuclide detection
Hoffman, David; Sun, Minghao; Yang, Likun; McDonagh, Philip R; Corwin, Frank; Sundaresan, Gobalakrishnan; Wang, Li; Vijayaragavan, Vimalan; Thadigiri, Celina; Lamichhane, Narottam; Zweit, Jamal
2014-01-01
Towards the development of iron oxide nanoparticles with intrinsically incorporated radionuclides for dual Positron Emission Tomography/Magnetic Resonance Imaging (PET/MRI) and more recently of Single Photon Emission Computed Tomography/Magnetic Resonance Imaging (SPECT/MRI), we have developed intrinsically radiolabeled [59Fe]-superparamagnetic iron oxide nanoparticles ([59Fe]-SPIONs) as a proof of concept for an intrinsic dual probe strategy. 59Fe was incorporated into Fe3O4 nanoparticle cry...
Feasibility of graphene CRLH metamaterial waveguides and leaky wave antennas
Energy Technology Data Exchange (ETDEWEB)
Chu, Derrick A.; Itoh, Tatsuo [Department of Electrical Engineering, University of California, Los Angeles, California 90095 (United States); Hon, Philip W. C. [Department of Electrical Engineering, University of California, Los Angeles, California 90095 (United States); NG NEXT Nanophotonics and Plasmonics Laboratory, Northrop Grumman Aerospace Systems, Redondo Beach, California 90278 (United States); Williams, Benjamin S., E-mail: bswilliams@ucla.edu [Department of Electrical Engineering, University of California, Los Angeles, California 90095 (United States); California NanoSystems Institute (CNSI), University of California, Los Angeles, California 90095 (United States)
2016-07-07
The feasibility of composite right/left-handed (CRLH) metamaterial waveguides based upon graphene plasmons is demonstrated via numerical simulation. Designs are presented that operate in the terahertz frequency range along with their various dimensions. Dispersion relations, radiative and free-carrier losses, and free-carrier based tunability are characterized. Finally, the radiative characteristics are evaluated, along with its feasibility for use as a leaky-wave antenna. While CRLH waveguides are feasible in the terahertz range, their ultimate utility will require precise nanofabrication, and excellent quality graphene to mitigate free-carrier losses.
Resonant Raman scattering of ZnS, ZnO, and ZnS/ZnO core/shell quantum dots
Energy Technology Data Exchange (ETDEWEB)
Milekhin, A.G. [Institute of Semiconductor Physics, Novosibirsk (Russian Federation); Novosibirsk State University, Novosibirsk (Russian Federation); Yeryukov, N.A.; Sveshnikova, L.L.; Duda, T.A. [Institute of Semiconductor Physics, Novosibirsk (Russian Federation); Himcinschi, C. [TU Bergakademie Freiberg, Institut fuer Theoretische Physik, Freiberg (Germany); Zenkevich, E.I. [Belarussian National Technical University, Minsk (Belarus); Zahn, D.R.T. [Chemnitz University of Technology, Semiconductor Physics, Chemnitz (Germany)
2012-05-15
Resonant Raman scattering by optical phonon modes as well as their overtones was investigated in ZnS and ZnO quantum dots grown by the Langmuir-Blodgett technique. The in situ formation of ZnS/ZnO core/shell quantum dots was monitored by Raman spectroscopy during laser illumination. (orig.)
Liu, Xiao-Li; Liang, Shan; Nan, Fan; Pan, Yue-Yue; Shi, Jun-Jun; Zhou, Li; Jia, Shuang-Feng; Wang, Jian-Bo; Yu, Xue-Feng; Wang, Qu-Quan
2013-10-21
Cubic Au-AgCdS core-shell nanostructures were synthesized through cation exchange method assisted by tributylphosphine (TBP) as a phase-transfer agent. Among intermediate products, Au-Ag core-shell nanocubes exhibited many high-order plasmon resonance modes related to the special cubic shape, and these plasmon bands red-shifted along with the increasing of particle size. The plasmon band of Au core first red-shifted and broadened at the step of Au-Ag₂S and then blue-shifted and narrowed at the step of Au-AgCdS. Since TBP was very crucial for the efficient conversion from Ag₂S to CdS, we found that both absorption and fluorescence of the final products could be controlled by TBP.
Provino, Laurent; Taunay, Thierry
2018-02-01
Optimal suppression of higher-order modes (HOMs) in hollow-core antiresonant fibers comprising a single ring of thin-walled capillaries was previously studied, and can be achieved when the condition on the capillary-tocore diameter ratio is satisfied (d/D ≍ 0.68). Here we report on the conditions for maximizing the leakage losses of HOMs in hollow-core nested antiresonant node-less fibers, while preserving low confinement loss for the fundamental mode. Using an analytical model based on coupled capillary waveguides, as well as full-vector finite element modeling, we show that optimal d/D value leading to high leakage losses of HOMs, is strongly correlated to the size of nested capillaries. We also show that extremely high value of degree of HOM suppression (˜1200) at the resonant coupling is almost unchanged on a wide range of nested capillary diameter dN ested values. These results thus suggest the possibility of designing antiresonant fibers with nested elements, which show optimal guiding performances in terms of the HOM loss compared to that of the fundamental mode, for clearly defined paired values of the ratios dN ested/d and d/D. These can also tend towards a single-mode behavior only when the dimensionless parameter dN ested/d is less than 0.30, with identical wall thicknesses for all of the capillaries.
Integrated nanohole array surface plasmon resonance sensing device using a dual-wavelength source
International Nuclear Information System (INIS)
Escobedo, C; Vincent, S; Choudhury, A I K; Campbell, J; Gordon, R; Brolo, A G; Sinton, D
2011-01-01
In this paper, we demonstrate a compact integrated nanohole array-based surface plasmon resonance sensing device. The unit includes a LED light source, driving circuitry, CCD detector, microfluidic network and computer interface, all assembled from readily available commercial components. A dual-wavelength LED scheme was implemented to increase spectral diversity and isolate intensity variations to be expected in the field. The prototype shows bulk sensitivity of 266 pixel intensity units/RIU and a limit of detection of 6 × 10 −4 RIU. Surface binding tests were performed, demonstrating functionality as a surface-based sensing system. This work is particularly relevant for low-cost point-of-care applications, especially those involving multiple tests and field studies. While nanohole arrays have been applied to many sensing applications, and their suitability to device integration is well established, this is the first demonstration of a fully integrated nanohole array-based sensing device.
Directory of Open Access Journals (Sweden)
Chelsea N Wong
2015-08-01
Full Text Available Higher cardiorespiratory fitness is associated with better cognitive performance and enhanced brain activation. Yet, the extent to which cardiorespiratory fitness-related brain activation is associated with better cognitive performance is not well understood. In this cross-sectional study, we examined whether the association between cardiorespiratory fitness and executive function was mediated by greater prefrontal cortex activation in healthy older adults. Brain activation was measured during dual-task performance with functional magnetic resonance imaging in a sample of 128 healthy older adults (59-80 years. Higher cardiorespiratory fitness was associated with greater activation during dual-task processing in several brain areas including the anterior cingulate and supplementary motor cortex (ACC/SMA, thalamus and basal ganglia, right motor/somatosensory cortex and middle frontal gyrus, and left somatosensory cortex, controlling for age, sex, education, and gray matter volume. Of these regions, greater ACC/SMA activation mediated the association between cardiorespiratory fitness and dual-task performance. We provide novel evidence that cardiorespiratory fitness may support cognitive performance by facilitating brain activation in a core region critical for executive function.
Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L
This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.
Kamada, M.; Hideshima, T.; Azuma, J.; Yamamoto, I.; Imamura, M.; Takahashi, K.
2016-04-01
Unoccupied and occupied electronic structures of an L-cysteine film have been studied by absorption and resonant photoelectron spectroscopies. Core absorptions at S-L, C-K, N-K, and O-K levels indicate that the lower unoccupied states are predominantly composed of oxygen-2p, carbon-2p, and sulfur-4s+3d orbitals, while higher unoccupied states may be attributed dominantly to nitrogen-np (n ≥ 3), oxygen-np (n ≥ 3), and sulfur-ns+md (n ≥ 4, m ≥ 3) orbitals. Resonant photoelectron spectra at S-L23 and O-K levels indicate that the highest occupied state is originated from sulfur-3sp orbitals, while oxygen-2sp orbitals contribute to the deeper valence states. The delocalization lifetimes of the oxygen-1s and sulfur-2p excited states are estimated from a core-hole clock method to be about 9 ± 1 and 125 ± 25 fs, respectively.
Energy Technology Data Exchange (ETDEWEB)
Kamada, M., E-mail: kamada@cc.saga-u.ac.jp; Hideshima, T.; Azuma, J.; Yamamoto, I.; Imamura, M.; Takahashi, K. [Synchrotron Light Application Center, Saga University, Honjo 1, Saga 840-8502 (Japan)
2016-04-15
Unoccupied and occupied electronic structures of an L-cysteine film have been studied by absorption and resonant photoelectron spectroscopies. Core absorptions at S-L, C-K, N-K, and O-K levels indicate that the lower unoccupied states are predominantly composed of oxygen-2p, carbon-2p, and sulfur-4s+3d orbitals, while higher unoccupied states may be attributed dominantly to nitrogen-np (n ≥ 3), oxygen-np (n ≥ 3), and sulfur-ns+md (n ≥ 4, m ≥ 3) orbitals. Resonant photoelectron spectra at S-L{sub 23} and O-K levels indicate that the highest occupied state is originated from sulfur-3sp orbitals, while oxygen-2sp orbitals contribute to the deeper valence states. The delocalization lifetimes of the oxygen-1s and sulfur-2p excited states are estimated from a core-hole clock method to be about 9 ± 1 and 125 ± 25 fs, respectively.
Real-time biodetection using a smartphone-based dual-color surface plasmon resonance sensor
Liu, Qiang; Yuan, Huizhen; Liu, Yun; Wang, Jiabin; Jing, Zhenguo; Peng, Wei
2018-04-01
We proposed a compact and cost-effective red-green dual-color fiber optic surface plasmon resonance (SPR) sensor based on the smartphone. Inherent color selectivity of phone cameras was utilized for real-time monitoring of red and green color channels simultaneously, which can reduce the chance of false detection and improve the sensitivity. Because there are no external prisms, complex optical lenses, or diffraction grating, simple optical configuration is realized. It has a linear response in a refractive index range of 1.326 to 1.351 (R2 = 0.991) with a resolution of 2.3 × 10 - 4 RIU. We apply it for immunoglobulin G (IgG) concentration measurement. Experimental results demonstrate that a linear SPR response was achieved for IgG concentrations varying from 0.02 to 0.30 mg / ml with good repeatability. It may find promising applications in the fields of public health and environment monitoring owing to its simple optics design and applicability in real-time, label-free biodetection.
Zhang, Naiqian; Wang, Zefeng; Xi, Xiaoming
2017-10-01
In this paper, we demonstrate a novel method for the low-loss coupling between solid-core multi-mode fibers (MMFs) and anti-resonant hollow-core fibers (AR-HCFs). The core/cladding diameter of the MMF is 50/125μm and the mode field diameter of the AR-HCFs are 33.3μm and 71.2μm of the ice-cream type AR-HCFs and the non-node type ARHCFs, respectively. In order to match the mode field diameters of these two specific AR-HCFs, the mode field diameter of the MMFs is increased or decreased by up-tapering or down-tapering the MMFs. Then, according to the principle of coupled fiber mode matching, the optimal diameter of tapered fiber for low-loss coupling is calculated. Based on beam propagation method, the calculated coupling losses without tapering process are 0.31dB and 0.89dB, respectively for a MMF-HCF-MMF structure of the ice-cream type AR-HCFs and the non-node type AR-HCFs. These values can be reduced to 0.096dB and 0.047dB when the outer diameters of the MMF are down-tapered to 116μm and up-tapered to 269μm, respectively. What's more, these results can also be verified by existing experiments.
Analysis of resonance oscillation of the neutron flow in a BWR-core
International Nuclear Information System (INIS)
Storm, J.
1987-09-01
This is a thesis which has been made within the institution of automatic control in Lund. Two programs, 'Blackie' and 'Test' have been written in Fortran. These two programs are to be used for the evaluation of ASEA-ATOMs resonance test in different nuclear reactors. In these tests the condition of the reactor becomes more and more unstable because the coolant flow decreases at the same time as the power gradually increases. This leads to resonance in the neutron flow. This flow is measured by detectors placed in different parts of the reactor core. 'Blackie' receives and stores the values sampled by the detectors. The same program also carries out a Fourier analysis. Amplitudes and phase angles from the different oscillations are calculated. These results are then used as inputs for 'Test'. 'Test' is a plotting program. It draws the reactor and plots arrows where the detectors are situated. The size and direction of the arrows are measurements of the amplitudes and phase angles of the neutron flow oscillations. From these arrow diagrams you can come to conclusions about the oscillations in the neutron flow and how the affect the reactor. (author)
Energy Technology Data Exchange (ETDEWEB)
Park, Sang-Jin; Kim, Hoe-Woong; Joo, Young-Sang; Kim, Sung-Kyun; Kim, Jong-Bum [KAERI, Daejeon (Korea, Republic of)
2016-05-15
This paper introduces the 2-D FEM simulation of the propagation and radiation of the leaky Lamb wave in and from a plate-type ultrasonic waveguide sensor conducted for the radiation beam profile analysis. The FEM simulations are performed with three different excitation frequencies and the radiation beam profiles obtained from FEM simulations are compared with those obtained from corresponding experiments. This paper deals with the 2-D FEM simulation of the propagation and radiation of the leaky Lamb wave in and from a plate-type ultrasonic waveguide sensor conducted to analyze the radiation beam profiles. The radiation beam profile results obtained from the FEM simulation show good agreement with the ones obtained from the experiment. This result will be utilized to improve the performance of the developed waveguide sensor. The quality of the visualized image is mainly affected by beam profile characteristics of the leaky wave radiated from the waveguide sensor. However, the relationships between the radiation beam profile and many parameters of the waveguide sensor are not fully revealed yet. Therefore, further parametric studies are necessary to improve the performance of the sensor and the finite element method (FEM) is one of the most effective tools for the parametric study.
International Nuclear Information System (INIS)
Vershkov, V.A.; Shelukhin, D.A.; Soldatov, S.V.; Urazbaev, A.O.; Grashin, S.A.; Eliseev, L.G.; Melnikov, A.V.
2005-01-01
This report summarizes the results of experimental turbulence investigations carried out at T-10 for more than 10 years. The turbulence characteristics were investigated using correlation reflectometry, multipin Langmuir probe (MLP) and heavy ion beam probe diagnostics. The reflectometry capabilities were analysed using 2D full-wave simulations and verified by direct comparison using a MLP. The ohmic and electron cyclotron resonance heated discharges show the distinct transition from the core turbulence, having complex spectral structure, to the unstructured one in the scrape-off layer. The core turbulence includes 'broad band, quasi-coherent' features, arising due to the excitation of rational surfaces with high poloidal m-numbers, with a low frequency near zero and specific oscillations at 15-30 kHz. All experimentally measured properties of low frequency and high frequency quasi-coherent oscillations are in good agreement with predictions of linear theory for the ion temperature gradient/dissipative trapped electron mode instabilities. Significant local changes in the turbulence characteristics were observed at the edge velocity shear layer and in the core near q = 1 radius after switching off the electron cyclotron resonance heating (ECRH). The local decrease in the electron heat conductivity and decrease in the turbulence level could be evidence of the formation of an electron internal transport barrier. The dynamic behaviour of the core turbulence was also investigated for the case of fast edge cooling and the beginning phase of ECRH
XFEL resonant photo-pumping of dense plasmas and dynamic evolution of autoionizing core hole states
Rosmej, F. B.; Moinard, A.; Renner, O.; Galtier, E.; Lee, J. J.; Nagler, B.; Heimann, P. A.; Schlotter, W.; Turner, J. J.; Lee, R. W.; Makita, M.; Riley, D.; Seely, J.
2016-01-01
Similarly to the case of LIF (Laser-Induced Fluorescence), an equally revolutionary impact to science is expected from resonant X-ray photo-pumping. It will particularly contribute to a progress in high energy density science: pumped core hole states create X-ray transitions that can escape dense matter on a 10 fs-time scale without essential photoabsorption, thus providing a unique possibility to study matter under extreme conditions. In the first proof of principle experiment at the X-ray F...
Leaky electronic states for photovoltaic photodetectors based on asymmetric superlattices
Penello, Germano Maioli; Pereira, Pedro Henrique; Pires, Mauricio Pamplona; Sivco, Deborah; Gmachl, Claire; Souza, Patricia Lustoza
2018-01-01
The concept of leaky electronic states in the continuum is used to achieve room temperature operation of photovoltaic superlattice infrared photodetectors. A structural asymmetric InGaAs/InAlAs potential profile is designed to create states in the continuum with the preferential direction for electron extraction and, consequently, to obtain photovoltaic operation at room temperature. Due to the photovoltaic operation and virtual increase in the bandoffset, the device presents both low dark current and low noise. The Johnson noise limited specific detectivity reaches values as high as 1.4 × 1011 Jones at 80 K. At 300 K, the detectivity obtained is 7.0 × 105 Jones.
Carrying BioMath education in a Leaky Bucket.
Powell, James A; Kohler, Brynja R; Haefner, James W; Bodily, Janice
2012-09-01
In this paper, we describe a project-based mathematical lab implemented in our Applied Mathematics in Biology course. The Leaky Bucket Lab allows students to parameterize and test Torricelli's law and develop and compare their own alternative models to describe the dynamics of water draining from perforated containers. In the context of this lab students build facility in a variety of applied biomathematical tools and gain confidence in applying these tools in data-driven environments. We survey analytic approaches developed by students to illustrate the creativity this encourages as well as prepare other instructors to scaffold the student learning experience. Pedagogical results based on classroom videography support the notion that the Biology-Applied Math Instructional Model, the teaching framework encompassing the lab, is effective in encouraging and maintaining high-level cognition among students. Research-based pedagogical approaches that support the lab are discussed.
Performance of a Planar Leaky-Wave Slit Antenna for Different Values of Substrate Thickness
Directory of Open Access Journals (Sweden)
Niamat Hussain
2017-10-01
Full Text Available This paper presents the performance of a planar, low-profile, and wide-gain-bandwidth leaky-wave slit antenna in different thickness values of high-permittivity gallium arsenide substrates at terahertz frequencies. The proposed antenna designs consisted of a periodic array of 5 × 5 metallic square patches and a planar feeding structure. The patch array was printed on the top side of the substrate, and the feeding structure, which is an open-ended leaky-wave slot line, was etched on the bottom side of the substrate. The antenna performed as a Fabry-Perot cavity antenna at high thickness levels (H = 160 μm and H = 80 μm, thus exhibiting high gain but a narrow gain bandwidth. At low thickness levels (H = 40 μm and H = 20 μm, it performed as a metasurface antenna and showed wide-gain-bandwidth characteristics with a low gain value. Aside from the advantage of achieving useful characteristics for different antennas by just changing the substrate thickness, the proposed antenna design exhibited a low profile, easy integration into circuit boards, and excellent low-cost mass production suitability.
International Nuclear Information System (INIS)
Koll, C.S.; Palmerton, D.L. Jr.; Kunzel, R.G.
1994-01-01
The effectiveness of two light non-aqueous phase liquid (LNAPL) extraction systems is compared at a site in the Mid-New Jersey Atlantic Coastal Plains Region: an existing dual pump recovery system and a wellpoint vacuum pump system. Home heating oil was released to a shallow sand and gravel aquifer by a leaky underground distribution system in the early 1970s. Eight-inch-diameter dual pump recovery wells were used for the last nine years, to lower the water table and extract LNAPL at several spill sites located throughout a residential community of 1,500 homes. Several small LNAPL plumes still exist today with surface areas ranging from 400 ft 2 to over 28,000 ft 2 . LNAPL recovery peaked in 1985 using dual pump recovery systems, averaging 33 gallons per day (gpd). In 1987, four 24-inch wells were replaced by 11 8-inch-diameter recovery wells at six sites, and LNAPL recovery rates averaged 5 gpd. In recent years, the recovery of LNAPL has declined and when graphed, is asymptotic. In 1993, dual pump recovery of LNAPL averaged 0.3 gpd for all six sites
Block copolymer micelles with a dual-stimuli-responsive core for fast or slow degradation.
Han, Dehui; Tong, Xia; Zhao, Yue
2012-02-07
We report the design and demonstration of a dual-stimuli-responsive block copolymer (BCP) micelle with increased complexity and control. We have synthesized and studied a new amphiphilic ABA-type triblock copolymer whose hydrophobic middle block contains two types of stimuli-sensitive functionalities regularly and repeatedly positioned in the main chain. Using a two-step click chemistry approach, disulfide and o-nitrobenzyle methyl ester groups are inserted into the main chain, which react to reducing agents and light, respectively. With the end blocks being poly(ethylene oxide), micelles formed by this BCP possess a core that can be disintegrated either rapidly via photocleavage of o-nitrobenzyl methyl esters or slowly through cleavage of disulfide groups by a reducing agent in the micellar solution. This feature makes possible either burst release of an encapsulated hydrophobic species from disintegrated micelles by UV light, or slow release by the action of a reducing agent, or release with combined fast-slow rate profiles using the two stimuli.
Zabelina, Darya; Saporta, Arielle; Beeman, Mark
2016-04-01
Creativity has been putatively linked to distinct forms of attention, but which aspects of creativity and which components of attention remains unclear. Two experiments examined how divergent thinking and creative achievement relate to visual attention. In both experiments, participants identified target letters (S or H) within hierarchical stimuli (global letters made of local letters), after being cued to either the local or global level. In Experiment 1, participants identified the targets more quickly following valid cues (80% of trials) than following invalid cues. However, this smaller validity effect was associated with higher divergent thinking, suggesting that divergent thinking was related to quicker overcoming of invalid cues, and thus to flexible attention. Creative achievement was unrelated to the validity effect. Experiment 2 examined whether divergent thinking (or creative achievement) is related to "leaky attention," so that when cued to one level of a stimulus, some information is still processed, or leaks in, from the non-cued level. In this case, the cued stimulus level always contained a target, and the non-cued level was congruent, neutral, or incongruent with the target. Divergent thinking did not relate to stimulus congruency. In contrast, high creative achievement was related to quicker responses to the congruent than to the incongruent stimuli, suggesting that real-world creative achievement is indeed associated with leaky attention, whereas standard laboratory tests of divergent thinking are not. Together, these results elucidate distinct patterns of attention for different measures of creativity. Specifically, creative achievers may have leaky attention, as suggested by previous literature, whereas divergent thinkers have selective yet flexible attention.
International Nuclear Information System (INIS)
Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M.
2006-01-01
Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma
Energy Technology Data Exchange (ETDEWEB)
Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M. [Policlinico San Donato, San Donato Milanese, Milan (Italy). Depts. of Radiology, Arrhythmia and Electrophysiology Center
2006-02-15
Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma.
Ede, Christopher; Chen, Ximin; Lin, Meng-Yin; Chen, Yvonne Y.
2016-01-01
Inducible transcription systems play a crucial role in a wide array of synthetic biology circuits. However, the majority of inducible promoters are constructed from a limited set of tried-and-true promoter parts, which are susceptible to common shortcomings such as high basal expression levels (i.e., leakiness). To expand the toolbox for regulated mammalian gene expression and facilitate the construction of mammalian genetic circuits with precise functionality, we quantitatively characterized a panel of eight core promoters, including sequences with mammalian, viral, and synthetic origins. We demonstrate that this selection of core promoters can provide a wide range of basal gene expression levels and achieve a gradient of fold-inductions spanning two orders of magnitude. Furthermore, commonly used parts such as minimal CMV and minimal SV40 promoters were shown to achieve robust gene expression upon induction, but also suffer from high levels of leakiness. In contrast, a synthetic promoter, YB_TATA, was shown to combine low basal expression with high transcription rate in the induced state to achieve significantly higher fold-induction ratios compared to all other promoters tested. These behaviors remain consistent when the promoters are coupled to different genetic outputs and different response elements, as well as across different host-cell types and DNA copy numbers. We apply this quantitative understanding of core promoter properties to the successful engineering of human T cells that respond to antigen stimulation via chimeric antigen receptor signaling specifically under hypoxic environments. Results presented in this study can facilitate the design and calibration of future mammalian synthetic biology systems capable of precisely programmed functionality. PMID:26883397
The Gamma renewal process as an output of the diffusion leaky integrate-and-fire neuronal model
Czech Academy of Sciences Publication Activity Database
Lánský, Petr; Sacerdote, L.; Zucca, C.
2016-01-01
Roč. 110, 2-3 (2016), s. 193-200 ISSN 0340-1200 R&D Projects: GA ČR(CZ) GA15-08066S Institutional support: RVO:67985823 Keywords : first-passage-time problem * leaky integrate-and-fire * Stein's neuronal model Subject RIV: BD - Theory of Information Impact factor: 1.716, year: 2016
International Nuclear Information System (INIS)
Xiang Xing-Ye; Wang Kui-Ru; Yuan Jin-Hui; Jin Bo-Yuan; Sang Xin-Zhu; Yu Chong-Xiu
2014-01-01
We propose a novel high-performance digital optical sensor based on the Mach—Zehnder interferential effect and the dual-microring resonators with the waveguide-coupled feedback. The simulation results show that the sensitivity of the sensor can be orders of magnitude higher than that of a conventional sensor, and high quality factor is not critical in it. Moreover, by optimizing the length of the feedback waveguide to be equal to the perimeter of the ring, the measurement range of the proposed sensor is twice as much as that of the conventional sensor in the weak coupling case
First order study for an iron core OH system for TNS
International Nuclear Information System (INIS)
Ballou, J.K.; Schultz, J.
1977-01-01
A simple comparison has been made between an air core and an iron core ohmic heating system for a particular device, and it was shown that the peak power requirements can be substantially reduced by the use of an iron core to power levels handled by industry today. It was also shown that for an ohmic heating system initiated plasma that the cost of the iron core ohmic heating power system (iron core, dual rectifier, and DC switch) is less than the cost for a subset of the power system for an air core system (dual rectifier and DC switch). There is considerable work being done on other methods of initiating the plasma none of which seem to be incompatible with the use of an iron core system
Tuned Chamber Core Panel Acoustic Test Results
Schiller, Noah H.; Allen, Albert R.
2016-01-01
This report documents acoustic testing of tuned chamber core panels, which can be used to supplement the low-frequency performance of conventional acoustic treatment. The tuned chamber core concept incorporates low-frequency noise control directly within the primary structure and is applicable to sandwich constructions with a directional core, including corrugated-, truss-, and fluted-core designs. These types of sandwich structures have long, hollow channels (or chambers) in the core. By adding small holes through one of the facesheets, the hollow chambers can be utilized as an array of low-frequency acoustic resonators. These resonators can then be used to attenuate low-frequency noise (below 400 Hz) inside a vehicle compartment without increasing the weight or size of the structure. The results of this test program demonstrate that the tuned chamber core concept is effective when used in isolation or combined with acoustic foam treatments. Specifically, an array of acoustic resonators integrated within the core of the panels was shown to improve both the low-frequency absorption and transmission loss of the structure in targeted one-third octave bands.
Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency
Directory of Open Access Journals (Sweden)
C. Baccouch
2016-11-01
Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.
Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors
Deen, David A.; Osinsky, Andrei; Miller, Ross
2014-03-01
A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection.
Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors
International Nuclear Information System (INIS)
Deen, David A.; Osinsky, Andrei; Miller, Ross
2014-01-01
A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection
Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors
Energy Technology Data Exchange (ETDEWEB)
Deen, David A.; Osinsky, Andrei; Miller, Ross [Agnitron Technology Incorporated, Eden Prairie, Minnesota 55346 (United States)
2014-03-03
A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection.
Directory of Open Access Journals (Sweden)
Gao X
2012-07-01
Full Text Available Xin Gao,1,* Yun Luo,1,* Yuanyuan Wang,1,* Jun Pang,1 Chengde Liao,2 Hanlun Lu,3 Youqiang Fang11Department of Urology, The Third Affiliated Hospital, 2Department of Radiology, The Second Affiliated Hospital, Sun Yat-Sen University, 3Materials Science Institute of Zhongshan University, Guangzhou, China*These authors contributed equally to this workBackground: We designed dual-functional nanoparticles for in vivo application using a modified electrostatic and covalent layer-by-layer assembly strategy to address the challenge of assessment and treatment of hormone-refractory prostate cancer.Methods: Core-shell nanoparticles were formulated by integrating three distinct functional components, ie, a core constituted by poly(D,L-lactic-co-glycolic acid, docetaxel, and hydrophobic superparamagnetic iron oxide nanocrystals (SPIONs, a multilayer shell formed by poly(allylamine hydrochloride and two different sized poly(ethylene glycol molecules, and a single-chain prostate stem cell antigen antibody conjugated to the nanoparticle surface for targeted delivery.Results: Drug release profiles indicated that the dual-function nanoparticles had a sustained release pattern over 764 hours, and SPIONs could facilitate the controlled release of the drug in vitro. The nanoparticles showed increased antitumor efficiency and enhanced magnetic resonance imaging in vitro through targeted delivery of docetaxel and SPIONs to PC3M cells. Moreover, in nude mice bearing PC3M xenografts, the nanoparticles provided MRI negative contrast enhancement, as well as halting and even reversing tumor growth during the 76-day study duration, and without significant systemic toxicity. The lifespan of the mice treated with these targeted dual-function nanoparticles was significantly increased (Chi-square = 22.514, P < 0.0001.Conclusion: This dual-function nanomedical platform may be a promising candidate for tumor imaging and targeted delivery of chemotherapeutic agents in vivo
Entropic lattice Boltzmann model for charged leaky dielectric multiphase fluids in electrified jets.
Lauricella, Marco; Melchionna, Simone; Montessori, Andrea; Pisignano, Dario; Pontrelli, Giuseppe; Succi, Sauro
2018-03-01
We present a lattice Boltzmann model for charged leaky dielectric multiphase fluids in the context of electrified jet simulations, which are of interest for a number of production technologies including electrospinning. The role of nonlinear rheology on the dynamics of electrified jets is considered by exploiting the Carreau model for pseudoplastic fluids. We report exploratory simulations of charged droplets at rest and under a constant electric field, and we provide results for charged jet formation under electrospinning conditions.
Directory of Open Access Journals (Sweden)
Yonghua Zhan
2017-12-01
Full Text Available Multifunctional manganese oxide nanoparticles (NPs with impressive enhanced T1 contrast ability show great promise in biomedical diagnosis. Herein, we developed a dual-modality imaging agent system based on polyethylene glycol (PEG-coated manganese oxide NPs conjugated with organic dye (Cy7.5, which functions as a fluorescence imaging (FI agent as well as a magnetic resonance imaging (MRI imaging agent. The formed Mn3O4@PEG-Cy7.5 NPs with the size of ~10 nm exhibit good colloidal stability in different physiological media. Serial FI and MRI studies that non-invasively assessed the bio-distribution pattern and the feasibility for in vivo dual-modality imaging-guided lymph node mapping have been investigated. In addition, histological and biochemical analyses exhibited low toxicity even at a dose of 20 mg/kg in vivo. Since Mn3O4@PEG-Cy7.5 NPs exhibited desirable properties as imaging agents and good biocompatibility, this work offers a robust, safe, and accurate diagnostic platform based on manganese oxide NPs for tumor metastasis diagnosis.
A Novel Dual-Stage Hydrothermal Flow Reactor
DEFF Research Database (Denmark)
Hellstern, Henrik Christian; Becker, Jacob; Hald, Peter
2015-01-01
The dual-stage reactor is a novel continuous flow reactor with two reactors connected in series. It is designed for hydrothermal flow synthesis of nanocomposites, in which a single particle consists of multiple materials. The secondary material may protect the core nanoparticle from oxidation....... The dual-stage reactor combines the ability to produce advanced materials with an upscaled capacity in excess of 10 g/hour (dry mass). TiO2 was synthesized in the primary reactor and reproduced previous results. The dual-stage capability was succesfully demonstrated with a series of nanocomposites incl. Ti...
On-chip dual comb source for spectroscopy
Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L.; Lipson, Michal
2016-01-01
Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high-quality-factor microcavities has hindered the development of an on-chip dual comb source. Here, we report the first simultaneous generation of two microresonator comb...
Magnetic motion capture system using LC resonant magnetic marker composed of Ni-Zn ferrite core
International Nuclear Information System (INIS)
Hashi, S.; Toyoda, M.; Ohya, M.; Okazaki, Y.; Yabukami, S.; Ishiyama, K.; Arai, K. I.
2006-01-01
We have proposed a magnetic motion capture system using an LC resonant magnetic marker. The proposed system is composed of an exciting coil, an LC marker, and a 5x5-matrix search coil array (25 search coils). The LC marker is small and has a minimal circuit with no battery and can be driven wirelessly by the action of electromagnetic induction. It consists of a Ni-Zn ferrite core (3 mmφx10 mm) with a wound coil and a chip capacitor, forming an LC series circuit with a resonant frequency of 186 kHz. The relative position accuracy of the system is less than 1 mm within the area of 100 mm 3 up to 150 mm from the search coil array. Compared with dc magnetic systems, the proposed system is applicable for precision motion capture in optically isolated spaces without magnetic shielding because the system is not greatly influenced by earth field noise
Saeidpour, S; Lohan, S B; Anske, M; Unbehauen, M; Fleige, E; Haag, R; Meinke, M C; Bittl, R; Teutloff, C
2017-07-01
The skin and especially the stratum corneum (SC) act as a barrier and protect epidermal cells and thus the whole body against xenobiotica of the external environment. Topical skin treatment requires an efficient drug delivery system (DDS). Polymer-based nanocarriers represent novel transport vehicles for dermal application of drugs. In this study dendritic core-multishell (CMS) nanoparticles were investigated as promising candidates. CMS nanoparticles were loaded with a drug (analogue) and were applied to penetration studies of skin. We determined by dual-frequency electron paramagnetic resonance (EPR) how dexamethasone (Dx) labelled with 3-carboxy-2,2,5,5-tetramethyl-1-pyrrolidinyloxy (PCA) is associated with the CMS. The micro-environment of the drug loaded to CMS nanoparticles was investigated by pulsed high-field EPR at cryogenic temperature, making use of the fact that magnetic parameters (g-, A-matrices, and spin-lattice relaxation time) represent specific probes for the micro-environment. Additionally, the rotational correlation time of spin-labelled Dx was probed by continuous wave EPR at ambient temperature, which provides independent information on the drug environment. Furthermore, the penetration depth of Dx into the stratum corneum of porcine skin after different topical applications was investigated. The location of Dx in the CMS nanoparticles is revealed and the function of CMS as penetration enhancers for topical application is shown. Copyright © 2016 Elsevier B.V. All rights reserved.
Edlefsen, Paul T
2014-01-01
"Leaky" vaccines are those for which vaccine-induced protection reduces infection rates on a per-exposure basis, as opposed to "all-or-none" vaccines, which reduce infection rates to zero for some fraction of subjects, independent of the number of exposures. Leaky vaccines therefore protect subjects with fewer exposures at a higher effective rate than subjects with more exposures. This simple observation has serious implications for analysis methodologies that rely on the assumption that the vaccine effect is homogeneous across subjects. We argue and show through examples that this heterogeneous vaccine effect leads to a violation of the proportional hazards assumption, to incomparability of infected cases across treatment groups, and to nonindependence of the distributions of the competing failure processes in a competing risks setting. We discuss implications for vaccine efficacy estimation, correlates of protection analysis, and mark-specific efficacy analysis (also known as sieve analysis).
Impact of Dual-Link Failures on Impairment-Aware Routed Networks
DEFF Research Database (Denmark)
Georgakilas, Konstantinos N; Katrinis, Kostas; Tzanakaki, Anna
2010-01-01
This paper evaluates the impact of dual-link failures on single-link failure resilient networks, while physical layer constraints are taken into consideration during demand routing, as dual link failures and equivalent situations appear to be quite probable in core optical networks. In particular...
Osman, Kariman I.; Joshi, Amitabh
2017-01-01
The optical trapping phenomenon is investigated in the probe absorptive susceptibility spectra, during the interaction of four-level N-type atomic system with three transverse Gaussian fields, in a Doppler broadened medium. The system was studied under different temperature settings of 87Rb atomic vapor as well as different non-radiative decay rate. The system exhibits a combination of dual electromagnetically induced transparency with electromagnetically induced absorption (EIA) or transparency (EIT) resonances simultaneously in near/far field. Also, the optical trapping phenomenon is considerably affected by the non-radiative decay rate.
Chen, Po-Chia; Chuang, Mo-Hsiung; Tan, Yih-Chi
2014-05-01
In recent years the urban and industrial developments near the coastal area are rapid and therefore the associated population grows dramatically. More and more water demand for human activities, agriculture irrigation, and aquaculture relies on heavy pumping in coastal area. The decline of groundwater table may result in the problems of seawater intrusion and/or land subsidence. Since the 1950s, numerous studies focused on the effect of tidal fluctuation on the groundwater flow in the coastal area. Many studies concentrated on the developments of one-dimensional (1D) and two-dimensional (2D) analytical solutions describing the tide-induced head fluctuations. For example, Jacob (1950) derived an analytical solution of 1D groundwater flow in a confined aquifer with a boundary condition subject to sinusoidal oscillation. Jiao and Tang (1999) derived a 1D analytical solution of a leaky confined aquifer by considered a constant groundwater head in the overlying unconfined aquifer. Jeng et al. (2002) studied the tidal propagation in a coupled unconfined and confined costal aquifer system. Sun (1997) presented a 2D solution for groundwater response to tidal loading in an estuary. Tang and Jiao (2001) derived a 2D analytical solution in a leaky confined aquifer system near open tidal water. This study aims at developing a general analytical solution describing the head fluctuations in a 2D estuarine aquifer system consisted of an unconfined aquifer, a confined aquifer, and an aquitard between them. Both the confined and unconfined aquifers are considered to be anisotropic. The predicted head fluctuations from this solution will compare with the simulation results from the MODFLOW program. In addition, the solutions mentioned above will be shown to be special cases of the present solution. Some hypothetical cases regarding the head fluctuation in costal aquifers will be made to investigate the dynamic effects of water table fluctuation, hydrogeological conditions, and
Synthesis and Plasmonic Understanding of Core/Satellite and Core Shell Nanostructures
Ruan, Qifeng
Localized surface plasmon resonance, which stems from the collective oscillations of conduction-band electrons, endows Au nanocrystals with unique optical properties. Au nanocrystals possess extremely large scattering/absorption cross-sections and enhanced local electromagnetic field, both of which are synthetically tunable. Moreover, when Au nanocrystals are closely placed or hybridized with semiconductors, the coupling and interaction between the individual components bring about more fascinating phenomena and promising applications, including plasmon-enhanced spectroscopies, solar energy harvesting, and cancer therapy. The continuous development in the field of plasmonics calls for further advancements in the preparation of high-quality plasmonic nanocrystals, the facile construction of hybrid plasmonic nanostructures with desired functionalities, as well as deeper understanding and efficient utilization of the interaction between plasmonic nanocrystals and semiconductor components. In this thesis, I developed a seed-mediated growth method for producing size-controlled Au nanospheres with high monodispersity and assembled Au nanospheres of different sizes into core/satellite nanostructures for enhancing Raman signals. For investigating the interactions between Au nanocrystals and semiconductors, I first prepared (Au core) (TiO2 shell) nanostructures, and then studied their synthetically controlled plasmonic properties and light-harvesting applications. Au nanocrystals with spherical shapes are desirable in plasmon-coupled systems owing to their high geometrical symmetry, which facilitates the analysis of electrodynamic responses in a classical electromagnetic framework and the investigation of quantum tunneling and nonlocal effects. I prepared remarkably uniform Au nanospheres with diameters ranging from 20 nm to 220 nm using a simple seed-mediated growth method associated with mild oxidation. Core/satellite nanostructures were assembled out of differently sized
The Role of Magnetic Resonance Imaging in Athletic Pubalgia and Core Muscle Injury.
Coker, Dana J; Zoga, Adam C
2015-08-01
Magnetic resonance imaging (MRI) has become the standard of care imaging modality for a difficult, often misunderstood spectrum of musculoskeletal injury termed athletic pubalgia or core muscle injury. Armed with a dedicated noncontrast athletic pubalgia protocol and a late model phased array receiver coil, the musculoskeletal imager can play a great role in effective diagnosis and treatment planning for lesions, including osteitis pubis, midline pubic plate lesions, and rectus abdominis/adductor aponeurosis injury. Beyond these established patterns of MRI findings, there are many confounders and contributing pathologies about the pelvis in patients with activity related groin pain, including internal and periarticular derangements of the hip. The MRI is ideally suited to delineate the extent of expected injury and to identify the unexpected visceral and musculoskeletal lesions.
International Nuclear Information System (INIS)
Zhang, Song; Qi, Yueyong; Yang, Hua; Gong, Mingfu; Zhang, Dong; Zou, Liguang
2013-01-01
Bimetallic core/shell Fe 2 O 3 /Au nanoparticles are promising candidate dual-mode contrast agents for magnetic resonance imaging (MRI) and computed tomography (CT) imaging. However, the gold coating on the hybrid nanoparticles (hybrids) affects the MRI and CT imaging quality. A thick gold nanoshell increases the X-ray attenuation effect but decreases the magnetic saturation of the hybrids. Therefore, we studied the effect of the Fe 2 O 3 and Au composition on these properties to find a suitable hybrid for MRI and CT imaging. Water-soluble, Au-coated magnetic nanoparticles were synthesized by iteratively reducing Au 3+ onto the Fe 2 O 3 surface via hydroxylamine seeding. The properties of the hybrids obtained after different numbers of Au seeding cycles were studied using transmission electron microscopy, UV–Vis spectrophotometry, a vibrating swatch gaussmeter, MRI, CT, and an MTT assay. The hybrids obtained after three Au seeding cycles had an Fe 2 O 3 :Au molar ratio of 7.2:26.8, a mean diameter of 48.3 nm, a UV–Vis absorbance peak of 550 nm, a saturation magnetization of 49.0 emu/g, and no cytotoxicity at a concentration of 500 μg/mL after incubation with RAW 264.7 cells for up to 72 h. The hybrids obtained after three Au seeding cycles are the preferred candidates for MRI and CT applications because of their relatively high R2 relaxivity (95 mM −1 s −1 ) and X-ray attenuation (1.87 times that of iodine) compared to those of the other hybrids investigated in this study
Integrated refractive index optical ring resonator detector for capillary electrophoresis.
Zhu, Hongying; White, Ian M; Suter, Jonathan D; Zourob, Mohammed; Fan, Xudong
2007-02-01
We developed a novel miniaturized and multiplexed, on-capillary, refractive index (RI) detector using liquid core optical ring resonators (LCORRs) for future development of capillary electrophoresis (CE) devices. The LCORR employs a glass capillary with a diameter of approximately 100 mum and a wall thickness of a few micrometers. The circular cross section of the capillary forms a ring resonator along which the light circulates in the form of the whispering gallery modes (WGMs). The WGM has an evanescent field extending into the capillary core and responds to the RI change due to the analyte conducted in the capillary, thus permitting label-free measurement. The resonating nature of the WGM enables repetitive light-analyte interaction, significantly enhancing the LCORR sensitivity. This LCORR architecture achieves dual use of the capillary as a sensor head and a CE fluidic channel, allowing for integrated, multiplexed, and noninvasive on-capillary detection at any location along the capillary. In this work, we used electro-osmotic flow and glycerol as a model system to demonstrate the fluid transport capability of the LCORRs. In addition, we performed flow speed measurement on the LCORR to demonstrate its flow analysis capability. Finally, using the LCORR's label-free sensing mechanism, we accurately deduced the analyte concentration in real time at a given point on the capillary. A sensitivity of 20 nm/RIU (refractive index units) was observed, leading to an RI detection limit of 10-6 RIU. The LCORR marries photonic technology with microfluidics and enables rapid on-capillary sample analysis and flow profile monitoring. The investigation in this regard will open a door to novel high-throughput CE devices and lab-on-a-chip sensors in the future.
Chen, Ning; Shao, Chen; Li, Shuai; Wang, Zihao; Qu, Yanming; Gu, Wei; Yu, Chunjiang; Ye, Ling
2015-11-01
The fusion of molecular and anatomical modalities facilitates more reliable and accurate detection of tumors. Herein, we prepared the PEG-Cy5.5 conjugated MnO nanoparticles (MnO-PEG-Cy5.5 NPs) with magnetic resonance (MR) and near-infrared fluorescence (NIRF) imaging modalities. The applicability of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe for the detection of brain gliomas was investigated. In vivo MR contrast enhancement of the MnO-PEG-Cy5.5 nanoprobe in the tumor region was demonstrated. Meanwhile, whole-body NIRF imaging of glioma bearing nude mouse exhibited distinct tumor localization upon injection of MnO-PEG-Cy5.5 NPs. Moreover, ex vivo CLSM imaging of the brain slice hosting glioma indicated the preferential accumulation of MnO-PEG-Cy5.5 NPs in the glioma region. Our results therefore demonstrated the potential of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe in improving the diagnostic efficacy by simultaneously providing anatomical information from deep inside the body and more sensitive information at the cellular level. Copyright © 2015 Elsevier Inc. All rights reserved.
Extreme IR absorption in group IV-SiGeSn core-shell nanowires
Attiaoui, Anis; Wirth, Stephan; Blanchard-Dionne, André-Pierre; Meunier, Michel; Hartmann, J. M.; Buca, Dan; Moutanabbir, Oussama
2018-06-01
Sn-containing Si and Ge (Ge1-y-xSixSny) alloys are an emerging family of semiconductors with the potential to impact group IV material-based devices. These semiconductors provide the ability to independently engineer both the lattice parameter and bandgap, which holds the premise to develop enhanced or novel photonic and electronic devices. With this perspective, we present detailed investigations of the influence of Ge1-y-xSixSny layers on the optical properties of Si and Ge based heterostructures and nanowires. We found that by adding a thin Ge1-y-xSixSny capping layer on Si or Ge greatly enhances light absorption especially in the near infrared range, leading to an increase in short-circuit current density. For the Ge1-y-xSixSny structure at thicknesses below 30 nm, a 14-fold increase in the short-circuit current is observed with respect to bare Si. This enhancement decreases by reducing the capping layer thickness. Conversely, decreasing the shell thickness was found to improve the short-circuit current in Si/Ge1-y-xSixSny and Ge/Ge1-y-xSixSny core/shell nanowires. The optical absorption becomes very important by increasing the Sn content. Moreover, by exploiting an optical antenna effect, these nanowires show extreme light absorption, reaching an enhancement factor, with respect to Si or Ge nanowires, on the order of 104 in Si/Ge0.84Si0.04Sn0.12 and 12 in Ge/Ge0.84Si0.04Sn0.12. Furthermore, we analyzed the optical response after the addition of a dielectric layer of Si3N4 to the Si/Ge1-y-xSixSny core-shell nanowire and found approximatively a 50% increase in the short-circuit current density for a dielectric layer of thickness equal to 45 nm and both a core radius and a shell thickness greater than 40 nm. The core-shell optical antenna benefits from a multiplication of enhancements contributed by leaky mode resonances in the semiconductor part and antireflection effects in the dielectric part.
International Nuclear Information System (INIS)
Lim, Chang Hyun; Jung Yeon Sang; Joo Han Gyu
2012-01-01
It was generally known that the Doppler feedback effect computed by most industrial reactor analysis codes is underestimated than the actual values. Part of the underestimation was attributed to the neglect of the resonance upscattering during the slowing down calculation. On the contrary, the edge peaked power profile noted in burned fuel pins due to more plutonium buildup at the periphery of fuel pellets might lead to smaller power defects than the predicted values obtained with a flat profile. This work is to mitigate these problems with a direct whole core calculation code nTRACER which is capable of handling ringwise depletion as well as incorporating nonuniform power profiles inside a fuel pellet
International Nuclear Information System (INIS)
Tsukamoto, O.; Kokubun, Y.; Toyama, T.
1986-01-01
We performed an experiment to detect a temperature rise at cryogenic temperature using a dual-core optical fiber. This fiber has two single-mode optical cores in one fiber. We demonstrated that a temperature rise of 4 K was detectable at 4.2 K. The sensitivity of this method can be improved using a longer fiber. This method may be applicable as a quench detector for superconducting magnets. A quench detector using this optical method is immune from electromagnetic noise, free from troubles caused by break-down of electrical insulator, and has many advantages over a conventional quench detector measuring voltages of a magnet
Chuang, Mo-Hsiung; Hung, Chi-Tung; -Yen Lin, Wen; Ma, Kuo-chen
2017-04-01
In recent years, cities and industries in the vicinity of the estuarine region have developed rapidly, resulting in a sharp increase in the population concerned. The increasing demand for human activities, agriculture irrigation, and aquaculture relies on massive pumping of water in estuarine area. Since the 1950s, numerous studies have focused on the effects of tidal fluctuations on groundwater flow in the estuarine area. Tide-induced head fluctuation in a two-dimensional estuarine aquifer system is complicated and rather important in dealing with many groundwater management or remediation problems. The conceptual model of the aquifer system considered is multi-layered with estuarine bank and the leaky aquifer extend finite distance under the estuary. The solution of the model describing the groundwater head distribution in such an estuarine aquifer system and subject to the tidal fluctuation effects from estuarine river is developed based on the method of separation of variables along with river boundary. The solutions by Sun (Sun H. A two-dimensional analytical solution of groundwater response to tidal loading in an estuary, Water Resour. Res. 1997; 33:1429-35) as well as Tang and Jiao (Tang Z. and J. J. Jiao, A two-dimensional analytical solution for groundwater flow in a leaky confined aquifer system near open tidal water, Hydrological Processes, 2001; 15: 573-585) can be shown to be special cases of the present solution. On the basis of the analytical solution, the groundwater head distribution in response to estuarine boundary is examined and the influences of leakage, hydraulic parameters, and loading effect on the groundwater head fluctuation due to tide are investigated and discussed. KEYWORDS: analytical model, estuarine river, groundwater fluctuation, leaky aquifer.
Multi-Core Processor Memory Contention Benchmark Analysis Case Study
Simon, Tyler; McGalliard, James
2009-01-01
Multi-core processors dominate current mainframe, server, and high performance computing (HPC) systems. This paper provides synthetic kernel and natural benchmark results from an HPC system at the NASA Goddard Space Flight Center that illustrate the performance impacts of multi-core (dual- and quad-core) vs. single core processor systems. Analysis of processor design, application source code, and synthetic and natural test results all indicate that multi-core processors can suffer from significant memory subsystem contention compared to similar single-core processors.
DEFF Research Database (Denmark)
Jensen, J S; Borch-Johnsen, K; Jensen, G
1995-01-01
1. In epidemiological studies microalbuminuria, i.e. slightly elevated urinary albumin excretion rate, predicts increased atherosclerotic vascular morbidity and mortality. This study aimed to test the hypothesis that microalbuminuria in clinically healthy subjects is associated with a systemic...... transvascular albumin leakiness. In animal experiments the outflux of albumin and lipids to the arterial wall are highly correlated, and both are elevated in atherosclerosis. 2. All participants were recruited at random from a population-based epidemiological study, where the upper decile of urinary albumin...... excretion rate was 6.6 micrograms/min. Twenty-seven patients with persistent microalbuminuria (urinary albumin excretion rate 6.6-150 micrograms/min), and 56 age- and sex-matched control subjects with persistent normoalbuminuria (UAER
Development of expanded type plugging technique for leaky tubes of steam generators of Indian PHWRs
International Nuclear Information System (INIS)
Das, Nirupam; Samuel, K.A.; Joemon, V.; Rupani, B.B.
2006-01-01
Steam generators are very important component of Nuclear Power Plant (NPP), as they are part of Primary Heat Transport (PHT) system of Pressurised Heavy Water Reactors (PHWRs). A nuclear power plant of 220 MWe capacity has four mushroom type steam generators, each consisting of 1830 U-tubes (16 mm outside diameter and 1 mm wall thickness) made of Incoloy-800 material. The tubes of 'tube and shell type steam generator' act as the pressure boundary of PHT System. Any structural failure of these tubes may lead to release of radioactivity along with plant outage and significant economic loss. Hence, it is necessary to plug the leaky tubes for continued and safe operation of a steam generator. An expanded type plugging technique has been developed at Reactor Engineering Division to plug the leaky tubes. This plugging technique is selected because of low residual stress imparted in the adjacent 'tube to tube-sheet' joints. This plug meets the various codal requirements of steam generator. A number of qualification trials have been carried out with such plugs in the mock up facility. The expanded plugs meet the design requirements for pull out strength and leak-tightness. This paper describes the design concept of the plug, developmental aspects and qualification of the plugging technique. (author)
Resonance treatment methodology in DeCART
Energy Technology Data Exchange (ETDEWEB)
Kim, Kang Seog; Joo, Han Gyu; Lee, Chung Chan; Chang, Moon Hee
2003-12-01
The typical nuclear design procedure consists of two steps which are the transport lattice calculation for the fuel assembly and the nodal diffusion calculation for the reactor core. DeCART (Deterministic Core Analysis based on Ray Tracing) code has been developed to perform the 3-dimensional whole-core transport calculation removing some of the approximations in the 2-step procedure. This code employs the synthesis of 1- and 2-dimensional characteristics methods in the framework of the 3-dimensional CMFD (Coarse Mesh Finite Difference) formulation. The subgroup method is used for the resonance treatment. HELIOS library is used for the multi-group neutron cross section and the resonance data without any modification. This report includes the methodology of the resonance treatment in DeCART. And this report also includes the Monte Carlo resonance treatment under development for the generation of the resonance integral table and the subgroup data. The interpolation method of the equivalence cross section is reviewed for the efficient resonance transport calculation with thermal-hydraulic feedback, and the new method to consider the temperature distribution explicitly in the subgroup method is also introduced.
Design of high power solid-state pulsed laser resonators
International Nuclear Information System (INIS)
Narro, R.; Ponce, L.; Arronte, M.
2009-01-01
Methods and configurations for the design of high power solid-state pulsed laser resonators, operating in free running, are presented. For fundamental mode high power resonators, a method is proposed for the design of a resonator with joined stability zones. In the case of multimode resonators, two configurations are introduced for maximizing the laser overall efficiency due to the compensation of the astigmatism induced by the excitation. The first configuration consists in a triangular ring resonator. The results for this configuration are discussed theoretically, showing that it is possible to compensate the astigmatism of the thermal lens virtually in a 100%; however this is only possible for a specific pumping power. The second configuration proposes a dual-active medium resonator, rotated 90 degree one from the other around the optical axis, where each active medium acts as an astigmatic lens of the same dioptric power. The reliability of this configuration is corroborated experimentally using a Nd:YAG dual-active medium resonator. It is found that in the pumping power range where the astigmatism compensation is possible, the overall efficiency is constant, even when increasing the excitation power with the consequent increase of the thermal lens dioptric power. (Author)
Generating broadband vortex modes in ring-core fiber by using a plasmonic q-plate.
Ye, Jingfu; Li, Yan; Han, Yanhua; Deng, Duo; Su, Xiaoya; Song, He; Gao, Jianmin; Qu, Shiliang
2017-08-15
A mode convertor was proposed and investigated for generating vortex modes in a ring-core fiber based on a plasmonic q-plate (PQP), which is composed of specially organized L-shaped resonator (LSR) arrays. A multicore fiber was used to transmit fundamental modes, and the LSR arrays were used to modulate phases of these fundamental modes. Behind the PQP, the transmitted fundamental modes with gradient phase distribution can be considered as the incident lights for generating broadband vortex modes in the ring-core fiber filter. The topological charges of generated vortex modes can be various by using an optical PQP with different q, and the chirality of the generated vortex mode can be controlled by the sign of q and handedness of the incident circularly polarized light. The operation bandwidth is 800 nm in the range of 1200-2000 nm, which covers six communication bands from the O band to the U band. The separation of vortex modes also was addressed by using a dual ring-core fiber. The mode convertor is of potential interest for connecting a traditional network and vortex communication network.
International Nuclear Information System (INIS)
Brown, B M; Eastham, M S P; Wood, I G
2009-01-01
We consider a quantum (or leaky) wire in the plane, and the wire supports a singular attraction which becomes large at distant points on the wire. An analogous regular potential arises from the motion of a hydrogen atom in an electric field. We prove that, as in the regular case, the spectrum is the whole of (-∞, ∞)
Energy Technology Data Exchange (ETDEWEB)
Brown, B M; Eastham, M S P [Department of Computer Science, Cardiff University, Cardiff, CF24 3XF (United Kingdom); Wood, I G [Institute of Mathematics and Physics, Aberystwyth University, Penglais, Aberystwyth, Ceredigion, SY23 3BZ (United Kingdom)], E-mail: malcolm@cs.cf.ac.uk, E-mail: mandh@chesilhay.fsnet.co.uk, E-mail: iww@aber.ac.uk
2009-02-06
We consider a quantum (or leaky) wire in the plane, and the wire supports a singular attraction which becomes large at distant points on the wire. An analogous regular potential arises from the motion of a hydrogen atom in an electric field. We prove that, as in the regular case, the spectrum is the whole of (-{infinity}, {infinity})
Kobayashi, T.; Kobayashi, S.; Lu, X. X.; Kenmochi, N.; Ida, K.; Ohshima, S.; Yamamoto, S.; Kado, S.; Kokubu, D.; Nagasaki, K.; Okada, H.; Minami, T.; Otani, Y.; Mizuuchi, T.
2018-01-01
We report properties of a coherent density oscillation observed in the core region and its response to electron cyclotron resonance heating (ECH) in Heliotron J plasma. The measurement was performed using a multi-channel beam emission spectroscopy system. The density oscillation is observed in a radial region between the core and the half radius. The poloidal mode number is found to be 1 (or 2). By modulating the ECH power with 100 Hz, repetition of formation and deformation of a strong electron temperature gradient, which is likely ascribed to be an electron internal transport barrier, is realized. Amplitude and rotation frequency of the coherent density oscillation sitting at the strong electron temperature gradient location are modulated by the ECH, while the poloidal mode structure remains almost unchanged. The change in the rotation velocity in the laboratory frame is derived. Assuming that the change of the rotation velocity is given by the background E × B velocity, a possible time evolution of the radial electric field was deduced.
Intrinsically radiolabelled [(59)Fe]-SPIONs for dual MRI/radionuclide detection.
Hoffman, David; Sun, Minghao; Yang, Likun; McDonagh, Philip R; Corwin, Frank; Sundaresan, Gobalakrishnan; Wang, Li; Vijayaragavan, Vimalan; Thadigiri, Celina; Lamichhane, Narottam; Zweit, Jamal
2014-01-01
Towards the development of iron oxide nanoparticles with intrinsically incorporated radionuclides for dual Positron Emission Tomography/Magnetic Resonance Imaging (PET/MRI) and more recently of Single Photon Emission Computed Tomography/Magnetic Resonance Imaging (SPECT/MRI), we have developed intrinsically radiolabeled [(59)Fe]-superparamagnetic iron oxide nanoparticles ([(59)Fe]-SPIONs) as a proof of concept for an intrinsic dual probe strategy. (59)Fe was incorporated into Fe3O4 nanoparticle crystal lattice with 92±3% efficiency in thermal decomposition synthesis. Multidentate poly(acrylic acid)-dopamine-poly(ethylene-glycol-2000) (PAA-DOP-PEG) ligands were designed and synthesized based on facile EDC chemistry and utilized to functionalize the [(59)Fe]-SPIONs. The transverse relaxivity of [(59)Fe]-SPIONs (97±3 s(-1)mM(-1)) was characterized and found to be similar to non-radioactive SPIONs (72±10 s(-1)mM(-1)), indicating that (59)Fe incorporation does not alter the SPIONs' MRI contrast properties. [(59)Fe]-SPIONs were used to evaluate the nanoparticle biodistribution by ex vivo gamma counting and MRI. Nude mice (n=15) were injected with [(59)Fe]-SPIONs and imaged at various time points with 7T small animal MRI scanner. Ex vivo biodistribution was evaluated by tissue-based gamma counting. MRI signal contrast qualitatively correlates with the %ID/g of [(59)Fe]-SPIONs, with high contrast in liver (45±6%), medium contrast in kidneys (21±5%), and low contrast in brain (4±6%) at 24 hours. This work demonstrates the synthesis and in vivo application of intrinsically radiolabeled [(59)Fe]-SPIONs for bimodal detection and provides a proof of concept for incorporation of both gamma- and positron-emitting inorganic radionuclides into the core of metal based MRI contrast agent nanoparticles.
Development of 600 kV triple resonance pulse transformer.
Li, Mingjia; Zhang, Faqiang; Liang, Chuan; Xu, Zhou
2015-06-01
In this paper, a triple-resonance pulse transformer based on an air-core transformer is introduced. The voltage across the high-voltage winding of the air-core transformer is significantly less than the output voltage; instead, the full output voltage appears across the tuning inductor. The maximum ratio of peak load voltage to peak transformer voltage is 2.77 in theory. By analyzing pulse transformer's lossless circuit, the analytical expression for the output voltage and the characteristic equation of the triple-resonance circuit are presented. Design method for the triple-resonance pulse transformer (iterated simulation method) is presented, and a triple-resonance pulse transformer is developed based on the existing air-core transformer. The experimental results indicate that the maximum ratio of peak voltage across the load to peak voltage across the high-voltage winding of the air-core transformer is approximately 2.0 and the peak output voltage of the triple-resonance pulse transformer is approximately 600 kV.
International Nuclear Information System (INIS)
Yuan Zugui
2008-01-01
The hydrogen atoms in oil and water are able to resonate and generate signals in the magnetic field, which is used by the NMR (nuclear magnetic resonance) technology in petroleum engineering to research and evaluate rock characteristics. NMR well logging was used to measure the physical property parameters of the strata in well bore, whereas NMR mud logging was used to analyze (while drilling) the physical property parameters of cores, cuttings and sidewall coring samples on surface (drilling site). Based on the comparative analysis of the porosity and permeability parameters obtained by NMR well logging and those from analysis of the cores, cuttings and sidewall coring samples by NMR mud logging in the same depth of 13 wells, these two methods are of certain difference, but their integral tendency is relatively good. (authors)
Method of allowing for resonances in calculating reactivity values
International Nuclear Information System (INIS)
Kumpf, H.
1985-01-01
On the basis of the integral transport equation for the source density an expression has been derived for calculating reactivity values taking resonances in the core and in the sample into account. The model has been used for evaluating reactivities measured in the Rossendorf SEG IV configuration. It is shown that the influence of resonances in the core can be kept tolerable, if a sufficiently thick buffer zone of only slightly absorbing non-resonant material is arranged between the sample and the core. (author)
Analysis of a basic core performance for FBR core nuclear design. 3
International Nuclear Information System (INIS)
Kaneko, Kunio
1999-03-01
The spatial distribution of reaction rates in the ZPPR-13A, having an axially heterogeneous core, has been analyzed. The ZPPR-13A core is treated as a 2-dimensional RZ configuration consisting of a homogeneous core. The analysis is performed by utilizing both probabilistic and deterministic treatments. The probabilistic treatment is performed with the Monte Carlo Code MVP running with continuous energy variable. By comparing the results obtained by both treatments and reviewing the calculation method of effective resonance cross sections, for deterministic treatment, utilized for the reaction rate distributions, it is revealed that the present treatment of effective resonance cross sections is not accurate, since there are observed effects due to dependence on energy group number or energy group width, and on anisotropic scattering. To utilize multi-band method for calculating effective resonance cross sections, widely used by the European researchers, the computer code GROUPIE is installed and the performance of the code is confirmed. Although, in order to improve effective resonance cross sections accuracy, the thermal neutron reactor standard code system SRAC-95 was introduced last year in which the ultra-fine group spectrum calculation module PEACO worked specially under the restriction that number of nuclei having resonance cross section, in any zone, should be less than three, because collision probabilities were obtained by an interpolation method. This year, the module is improved so that these collision probabilities are directly calculated, and by this improvement the highly accurate effective resonance cross sections below the energy of 40.868 keV can be calculated for whole geometrical configurations considered. To extend the application range of the module PEACO, the cross sections of sodium and structure material nuclei are prepared so that they are also represented as ultra-fine group cross sections. By such modifications of cross section library
Yu, Kun
2016-01-01
Based on both resource allocation theory (Becker, 1965; Bergeron, 2007) and role theory (Katz and Kahn, 1978), the current study aims to uncover the relationship between core self-evaluation (CSE) and three dimensions of work interference with family (WIF). A dual-process model was proposed, in which both work stress and career resilience mediate the CSE-WIF relationship. The mediation model was tested with a sample of employees from various organizations ( N = 561). The results first showed that CSE was negatively related to time-based and strain-based WIF and positively related to behavior-based WIF via the mediation of work stress. Moreover, CSE was positively associated with behavior-based and strain-based WIF via the mediation of career resilience, suggesting that CSE may also have its "dark-side."
Directory of Open Access Journals (Sweden)
Kun Yu
2016-10-01
Full Text Available Based on both resource allocation theory (Becker, 1965; Bergeron, 2007 and role theory (Katz & Kahn, 1978, the current study aims to uncover the relationship between core self-evaluation (CSE and three dimensions of work interference with family (WIF. A dual-process model was proposed, in which both work stress and career resilience mediate the CSE-WIF relationship. The mediation model was tested with a sample of employees from various organizations (N = 561. The results first showed that CSE was negatively related to time-based and strain-based WIF and positively related to behavior-based WIF via the mediation of work stress. Moreover, CSE was positively associated with behavior-based and strain-based WIF via the mediation of career resilience, suggesting that CSE may also have its dark-side.
Wireline coring/open center reaming: Technical problems and solutions
International Nuclear Information System (INIS)
Fehr, G.
1996-01-01
At the 1993 ASME Energy Technology Conference, a paper, ''Field Experience with Wireline Coring through a Dual Wall Drilling System'', was presented. It described the initial scientific drilling which started in the spring of 1992 using wireline coring within a 9 5/8 inch dual wall drill pipe through an open center reaming bit, and some of the improvements made since the prototype drilling tests. New and as yet unsolved problems were identified. This follow-on work brings the industry up-to-date with a survey of how these difficulties have been solved, or, if not solved, the status of the effort made for each of the air coring/reaming technical challenges on the Yucca Mountain Site Characterization Project at the US Department of Energy Nevada Test Site
Fiebag, Johannes
1989-12-01
Present SETI projects are described, emphasizing search methods alternative to investigations in the radio range. The possibility that the human race is being studied by alien presences within the solar system is addressed in the context of the 'zoo hypothesis' and the 'leaky embargo' hypothesis. In the former, the aliens prevent any contact with humans, while in the latter occasional contact is permitted.
Dual circularly polarized broadside beam antenna based on metasurfaces
Tellechea, A.; Caminita, F.; Martini, E.; Ederra, I.; Teniente, J.; Iriarte, J. C.; Gonzalo, R.; Maci, S.
2018-02-01
Design details of a Ku band metasurface (MTS) antenna with dual circularly polarized (CP) broadside radiation is shown in this work. By means of the surface impedance tensor modulation, synchronized propagation of two transversal magnetic (TM) and transverse electric (TE) surface waves (SWs) is ensured in the structure, which contribute to the radiation in broadside direction by the generation of a CP leaky wave. The structure is implemented by elliptical subwavelength metallic elements with a cross-shaped aperture in the center, printed on top of a thin substrate with high permittivity (AD1000 with a thickness of λ0/17). For the experimental validation, the MTS prototype has been excited employing an orthomode transducer composed by a metallic stepped septum inside an air-filled waveguide. Two orthogonal TE11 modes excited with ±90° phase shift in the feed couple with the TM and TE SWs supported by the MTS and generate RHCP or LHCP broadside beam. Experimental results are compared with the simulation predictions. Finally, conclusions are drawn.
Directory of Open Access Journals (Sweden)
Kahori Shimizu
2014-01-01
Full Text Available Leaky expression of adenovirus (Ad genes occurs following transduction with a conventional replication-incompetent Ad vector, leading to an induction of cellular immunity against Ad proteins and Ad protein-induced toxicity, especially in the late phase following administration. To suppress the leaky expression of Ad genes, we developed novel Ad vectors by incorporating four tandem copies of sequences with perfect complementarity to miR-122a or miR-142-3p into the 3′-untranslated region (UTR of the E2A, E4, or pIX gene, which were mainly expressed from the Ad vector genome after transduction. These Ad vectors easily grew to high titers comparable to those of a conventional Ad vector in conventional 293 cells. The leaky expression of these Ad genes in mouse organs was significantly suppressed by 2- to 100-fold, compared with a conventional Ad vector, by insertion of the miRNA-targeted sequences. Notably, the Ad vector carrying the miR-122a–targeted sequences into the 3′-UTR of the E4 gene expressed higher and longer-term transgene expression and more than 20-fold lower levels of all the Ad early and late genes examined in the liver than a conventional Ad vector. miR-122a–mediated suppression of the E4 gene expression in the liver significantly reduced the hepatotoxicity which an Ad vector causes via both adaptive and non-adaptive immune responses.
A Block Iterative Finite Element Model for Nonlinear Leaky Aquifer Systems
Gambolati, Giuseppe; Teatini, Pietro
1996-01-01
A new quasi three-dimensional finite element model of groundwater flow is developed for highly compressible multiaquifer systems where aquitard permeability and elastic storage are dependent on hydraulic drawdown. The model is solved by a block iterative strategy, which is naturally suggested by the geological structure of the porous medium and can be shown to be mathematically equivalent to a block Gauss-Seidel procedure. As such it can be generalized into a block overrelaxation procedure and greatly accelerated by the use of the optimum overrelaxation factor. Results for both linear and nonlinear multiaquifer systems emphasize the excellent computational performance of the model and indicate that convergence in leaky systems can be improved up to as much as one order of magnitude.
Bardhan, Rizia; Grady, Nathaniel K; Ali, Tamer; Halas, Naomi J
2010-10-26
It is well-known that the geometry of a nanoshell controls the resonance frequencies of its plasmon modes; however, the properties of the core material also strongly influence its optical properties. Here we report the synthesis of Au nanoshells with semiconductor cores of cuprous oxide and examine their optical characteristics. This material system allows us to systematically examine the role of core material on nanoshell optical properties, comparing Cu(2)O core nanoshells (ε(c) ∼ 7) to lower core dielectric constant SiO(2) core nanoshells (ε(c) = 2) and higher dielectric constant mixed valency iron oxide nanoshells (ε(c) = 12). Increasing the core dielectric constant increases nanoparticle absorption efficiency, reduces plasmon line width, and modifies plasmon energies. Modifying the core medium provides an additional means of tailoring both the near- and far-field optical properties in this unique nanoparticle system.
Hu, Lingzhi; Hockett, Frank D; Chen, Junjie; Zhang, Lei; Caruthers, Shelton D; Lanza, Gregory M; Wickline, Samuel A
2011-07-01
To propose and test a universal strategy for building (19) F/(1) H dual-frequency RF coil that permits multiple coil geometries. The feasibility to design (19) F/(1) H dual-frequency RF coil based on coupled resonator model was investigated. A series capacitive matching network enables robust impedance matching for both harmonic oscillating modes of the coupled resonator. Two typical designs of (19) F/(1) H volume coils (birdcage and saddle) at 4.7T were implemented and evaluated with electrical bench test and in vivo (19) F/(1) H dual-nuclei imaging. For various combinations of internal resistances of the sample coil and secondary resonator, numerical solutions for the tunable capacitors to optimize impedance matching were obtained using a root-seeking program. Identical and homogeneous B1 field distribution at (19) F and (1) H frequencies were observed in bench test and phantom image. Finally, in vivo mouse imaging confirmed the sensitivity and homogeneity of the (19) F/(1) H dual-frequency coil design. A generalized strategy for designing (19) F/(1) H dual-frequency coils based on the coupled resonator approach was developed and validated. A unique feature of this design is that it preserves the B1 field homogeneity of the RF coil at both resonant frequencies. Thus it minimizes the susceptibility effect on image co-registration. Copyright © 2011 Wiley-Liss, Inc.
DEFF Research Database (Denmark)
Chen, Yuntian; Gregersen, Niels; Nielsen, Torben Roland
2010-01-01
in which the metallic slot waveguide is embedded. Compared to the ideal case of a homogenous dielectric environment, the coupling efficiency of an emitter to a metallic slot waveguide is significantly reduced. We attribute the reduction to the coupling to leaky plasmonic modes. By increasing the refractive...
Energy Technology Data Exchange (ETDEWEB)
Nichols, R.A.; Smith, W.W.
1976-06-30
The three-volume report describes a dual-mode nuclear space power and propulsion system concept that employs an advanced solid-core nuclear fission reactor coupled via heat pipes to one of several electric power conversion systems. The second volume describes the computer code and users' guide for the preliminary analysis of the system.
Chemical Sensors Based on Optical Ring Resonators
Homer, Margie; Manfreda, Allison; Mansour, Kamjou; Lin, Ying; Ksendzov, Alexander
2005-01-01
Chemical sensors based on optical ring resonators are undergoing development. A ring resonator according to this concept is a closed-circuit dielectric optical waveguide. The outermost layer of this waveguide, analogous to the optical cladding layer on an optical fiber, is a made of a polymer that (1) has an index of refraction lower than that of the waveguide core and (2) absorbs chemicals from the surrounding air. The index of refraction of the polymer changes with the concentration of absorbed chemical( s). The resonator is designed to operate with relatively strong evanescent-wave coupling between the outer polymer layer and the electromagnetic field propagating along the waveguide core. By virtue of this coupling, the chemically induced change in index of refraction of the polymer causes a measurable shift in the resonance peaks of the ring. In a prototype that has been used to demonstrate the feasibility of this sensor concept, the ring resonator is a dielectric optical waveguide laid out along a closed path resembling a racetrack (see Figure 1). The prototype was fabricated on a silicon substrate by use of standard techniques of thermal oxidation, chemical vapor deposition, photolithography, etching, and spin coating. The prototype resonator waveguide features an inner cladding of SiO2, a core of SixNy, and a chemical-sensing outer cladding of ethyl cellulose. In addition to the ring Chemical sensors based on optical ring resonators are undergoing development. A ring resonator according to this concept is a closed-circuit dielectric optical waveguide. The outermost layer of this waveguide, analogous to the optical cladding layer on an optical fiber, is a made of a polymer that (1) has an index of refraction lower than that of the waveguide core and (2) absorbs chemicals from the surrounding air. The index of refraction of the polymer changes with the concentration of absorbed chemical( s). The resonator is designed to operate with relatively strong
Refurbishment of Cirus in-core components
International Nuclear Information System (INIS)
Bhatnagar, A.; Sahu, A.K.; Rathore, K.K.; Subudhi, D.; Kharpate, A.V.; Tikku, A.C.
2006-01-01
Circus is a 40- MWt vertical tank type research reactor with natural uranium as fuel, demineralised light water as coolant, heavy water as moderator and graphite as reflector. The reactor was commissioned in the year 1960 and operated at an overage availability factor of over 70% till early nineties, when various systems, structures and components (SSCs) started showing signs of ageing. Detailed ageing studies were therefore carried out to assess the condition of various SSCs and refurbishing requirements were finalized towards extending the life of the reactor. In-core components, being non-replaceable generally, were critically examined to the extent possible. Detailed visual examination of a few reactor vessel (RV) tubes, made of aluminium, was carried out using micro video camera and in addition all the RV tubes were inspected using eddy current testing method. RV shell, also made of aluminium, was similarly visually inspected with micro video camera. To assess the effect of irradiation on the RV material, samples of similar tubes irradiated to comparable neutron fluence were tested. Towards assessment of fatigue life of RV expansion joint, made of aluminium, a finite element analysis using NISA computer code was performed. Theoretical assessment for stored Wigner energy in graphite reflector was carried out. Graphite block samples were also removed from the reactor and stored energy levels were measured to plan for any in-situ graphite annealing, if required. Visual inspection of approachable portions of steel and aluminium thermal shields was also carried out. These water-cooled thermal shields provided above and below the RV were hydro tested. The weld joint between coolant inlet pipe and top plate of upper aluminium shield showed minor leakage. A special metallic hollow plug was developed and remotely installed in the leaky pipe to isolate the leaky portion while maintaining the coolant flow in the pipe. Helium leak was found from flange joints located on
Wang, Shui-Hua; Phillips, Preetha; Sui, Yuxiu; Liu, Bin; Yang, Ming; Cheng, Hong
2018-03-26
Alzheimer's disease (AD) is a progressive brain disease. The goal of this study is to provide a new computer-vision based technique to detect it in an efficient way. The brain-imaging data of 98 AD patients and 98 healthy controls was collected using data augmentation method. Then, convolutional neural network (CNN) was used, CNN is the most successful tool in deep learning. An 8-layer CNN was created with optimal structure obtained by experiences. Three activation functions (AFs): sigmoid, rectified linear unit (ReLU), and leaky ReLU. The three pooling-functions were also tested: average pooling, max pooling, and stochastic pooling. The numerical experiments demonstrated that leaky ReLU and max pooling gave the greatest result in terms of performance. It achieved a sensitivity of 97.96%, a specificity of 97.35%, and an accuracy of 97.65%, respectively. In addition, the proposed approach was compared with eight state-of-the-art approaches. The method increased the classification accuracy by approximately 5% compared to state-of-the-art methods.
Sub-10 nm Fe3O4@Cu2-xS core-shell nanoparticles for dual-modal imaging and photothermal therapy
Tian, Qiwei
2013-06-12
Photothermal nanomaterials have recently attracted significant research interest due to their potential applications in biological imaging and therapeutics. However, the development of small-sized photothermal nanomaterials with high thermal stability remains a formidable challenge. Here, we report the rational design and synthesis of ultrasmall (<10 nm) Fe3O 4@Cu2-xS core-shell nanoparticles, which offer both high photothermal stability and superparamagnetic properties. Specifically, these core-shell nanoparticles have proven effective as probes for T 2-weighted magnetic resonance imaging and infrared thermal imaging because of their strong absorption at the near-infrared region centered around 960 nm. Importantly, the photothermal effect of the nanoparticles can be precisely controlled by varying the Cu content in the core-shell structure. Furthermore, we demonstrate in vitro and in vivo photothermal ablation of cancer cells using these multifunctional nanoparticles. The results should provide improved understanding of synergistic effect resulting from the integration of magnetism with photothermal phenomenon, important for developing multimode nanoparticle probes for biomedical applications. © 2013 American Chemical Society.
Sub-10 nm Fe3O4@Cu2-xS core-shell nanoparticles for dual-modal imaging and photothermal therapy
Tian, Qiwei; Hu, Junqing; Zhu, Yihan; Zou, Rujia; Chen, Zhigang; Yang, Shiping; Li, Runwei; Su, Qianqian; Han, Yu; Liu, Xiaogang
2013-01-01
Photothermal nanomaterials have recently attracted significant research interest due to their potential applications in biological imaging and therapeutics. However, the development of small-sized photothermal nanomaterials with high thermal stability remains a formidable challenge. Here, we report the rational design and synthesis of ultrasmall (<10 nm) Fe3O 4@Cu2-xS core-shell nanoparticles, which offer both high photothermal stability and superparamagnetic properties. Specifically, these core-shell nanoparticles have proven effective as probes for T 2-weighted magnetic resonance imaging and infrared thermal imaging because of their strong absorption at the near-infrared region centered around 960 nm. Importantly, the photothermal effect of the nanoparticles can be precisely controlled by varying the Cu content in the core-shell structure. Furthermore, we demonstrate in vitro and in vivo photothermal ablation of cancer cells using these multifunctional nanoparticles. The results should provide improved understanding of synergistic effect resulting from the integration of magnetism with photothermal phenomenon, important for developing multimode nanoparticle probes for biomedical applications. © 2013 American Chemical Society.
Research on communication system of underground safety management based on leaky feeder cable
Institute of Scientific and Technical Information of China (English)
CHEN Jian-hong; ZHANG Tao; CHENG Yun-cai; ZHANG Han
2007-01-01
According to the current working status of underground safety management and production scheduling, the importance and existed problem of underground mine radio communication were summarized, and the basic principle and classification of leaky feeder cable were introduced and the characteristics of cable were analyzed specifically in depth, and the application model of radio communication system for underground mine safety management was put forward. Meanwhile, the research explanation of the system component, function and evaluation was provided. The discussion result indicates that communication system of underground mine safety management which is integrated two-way relay amplifier and other equipment has many communication functions, and underground mine mobile communication can be achieved well.
Dc to ac field conversion due to leaky-wave excitation in a plasma slab behind an ionization front
International Nuclear Information System (INIS)
Kostin, V A; Vvedenskii, N V
2015-01-01
We present a way for generating coherent tunable electromagnetic radiation through dc to ac field conversion by an ionization front. The conversion is caused by the excitation of leaky waves behind the transversely limited ionization front propagating in a uniform electrostatic field. This differs significantly from the well-known dc-to-ac-radiation-converter models which consider Doppler-like frequency conversion by a transversely unlimited ionization front propagating in a spatially periodic electric field. We explore the dispersion properties and excitation of these leaky waves radiated through the transverse plasma boundary at the Cherenkov angle to the direction of propagation of a superluminal ionization front as dependent on the parameters of the plasma produced and on the speed of the ionization front. It is shown that not only the center frequency but also the duration and waveform of the generated pulse may significantly depend on the speed of the ionization front. The results indicate the possibility of using such converters based on planar photoconductive antennas to create sources of microwave and terahertz radiation with controllable waveforms that are transformed from video to radio pulse when the angle of incident ionizing radiation is tuned. (paper)
Design and experimental verification of a dual-band metamaterial filter
Zhu, Hong-Yang; Yao, Ai-Qin; Zhong, Min
2016-10-01
In this paper, we present the design, simulation, and experimental verification of a dual-band free-standing metamaterial filter operating in a frequency range of 1 THz-30 THz. The proposed structure consists of periodically arranged composite air holes, and exhibits two broad and flat transmission bands. To clarify the effects of the structural parameters on both resonant transmission bands, three sets of experiments are performed. The first resonant transmission band shows a shift towards higher frequency when the side width w 1 of the main air hole is increased. In contrast, the second resonant transmission band displays a shift towards lower frequency when the side width w 2 of the sub-holes is increased, while the first resonant transmission band is unchanged. The measured results indicate that these resonant bands can be modulated individually by simply optimizing the relevant structural parameters (w 1 or w 2) for the required band. In addition, these resonant bands merge into a single resonant band with a bandwidth of 7.7 THz when w 1 and w 2 are optimized simultaneously. The structure proposed in this paper adopts different resonant mechanisms for transmission at different frequencies and thus offers a method to achieve a dual-band and low-loss filter. Project supported by the Doctorate Scientific Research Foundation of Hezhou University, China (Grant No. HZUBS201503), the Promotion of the Basic Ability of Young and Middle-aged Teachers in Universities Project of Guangxi Zhuang Autonomous Region, China (Grant No. KY2016YB453), the Guangxi Colleges and Universities Key Laboratory Symbolic Computation, China, Engineering Data Processing and Mathematical Support Autonomous Discipline Project of Hezhou University, China (Grant No. 2016HZXYSX01).
Jogiya, Roy; Schuster, Andreas; Zaman, Arshad; Motwani, Manish; Kouwenhoven, Marc; Nagel, Eike; Kozerke, Sebastian; Plein, Sven
2014-11-28
The purpose of this study was to establish the feasibility of three-dimensional (3D) balanced steady-state-free-precession (bSSFP) myocardial perfusion cardiovascular magnetic resonance (CMR) at 3T using local RF shimming with dual-source RF transmission, and to compare it with spoiled gradient echo (TGRE) acquisition. Dynamic contrast-enhanced 3D bSSFP perfusion imaging was performed on a 3T MRI scanner equipped with dual-source RF transmission technology. Images were reconstructed using k-space and time broad-use linear acquisition speed-up technique (k-t BLAST) and compartment based principle component analysis (k-t PCA). In phantoms and volunteers, local RF shimming with dual source RF transmission significantly improved B1 field homogeneity compared with single source transmission (P=0.01). 3D bSSFP showed improved signal-to-noise, contrast-to-noise and signal homogeneity compared with 3D TGRE (29.8 vs 26.9, P=0.045; 23.2 vs 21.6, P=0.049; 14.9% vs 12.4%, p=0.002, respectively). Image quality was similar between bSSFP and TGRE but there were more dark rim artefacts with bSSFP. k-t PCA reconstruction reduced artefacts for both sequences compared with k-t BLAST. In a subset of five patients, both methods correctly identified those with coronary artery disease. Three-dimensional bSSFP myocardial perfusion CMR using local RF shimming with dual source parallel RF transmission at 3T is feasible and improves signal characteristics compared with TGRE. Image artefact remains an important limitation of bSSFP imaging at 3T but can be reduced with k-t PCA.
Directory of Open Access Journals (Sweden)
Christoph B Geier
Full Text Available Loss of function mutations in the recombination activating genes RAG1 and RAG2 have been reported to cause a T-B-NK+ type of severe combined immunodeficiency. In addition identification of hypomorphic mutations in RAG1 and RAG2 has led to an expansion of the spectrum of disease to include Omenn syndrome, early onset autoimmunity, granuloma, chronic cytomegalovirus- or EBV-infection with expansion of gamma/delta T-cells, idiophatic CD4 lymphopenia and a phenotype resembling common variable immunodeficiency. Herein we describe a novel presentation of leaky RAG1 and RAG2 deficiency in two unrelated adult patients with impaired antibody production against bacterial polysaccharide antigens. Clinical manifestation included recurrent pneumonia, sinusitis, otitis media and in one patient recurrent cutaneous vasculitis. Both patients harbored a combination of a null mutation on one allele with a novel hypomorphic RAG1/2 mutation on the other allele. One of these novel mutations affected the start codon of RAG1 and resulted in an aberrant gene and protein expression. The second novel RAG2 mutation leads to a truncated RAG2 protein, lacking the C-terminus with intact core RAG2 and reduced VDJ recombination capacity as previously described in a mouse model. Both patients presented with severely decreased numbers of naïve CD4+ T cells and defective T independent IgG responses to bacterial polysaccharide antigens, while T cell-dependent IgG antibody formation e.g. after tetanus or TBEV vaccination was intact. In conclusion, hypomorphic mutations in genes responsible for SCID should be considered in adults with predominantly antibody deficiency.
A photo-excited broadband to dual-band tunable terahertz prefect metamaterial polarization converter
Zhu, Jianfeng; Yang, Yang; Li, Shufang
2018-04-01
A new and simple design of photo-excited broadband to dual-band tunable terahertz (THz) metamaterial cross polarization converter is proposed in this paper. The tunable converter is a sandwich structure with the center-cut cross-shaped metallic patterned structure as a resonator, the middle dielectric layer as a spacer and the bottom metallic film as the ground. The conductivity of the photoconductive semiconductor (Silicon) filled in the gap of the cross-shaped metallic resonator can be tuned by the incident pump power, leading to an easy modulation of the electromagnetic response of the proposed converter. The results show that the proposed cross-polarization converter can be tuned from a broadband with polarization conversion ratio (PCR) beyond 95% (1.86-2.94 THz) to dual frequency bands (fl = 1 . 46 THz &fh = 2 . 9 THz). The conversion peaks can reach 99.9% for the broadband and, 99.5% (fl) and 99.7% (fh) for the dual-band, respectively. Most importantly, numerical simulations demonstrate that the broadband/dual-band polarization conversion mechanism of the converter originates from the localized surface plasmon modes, which make the design simple and different from previous designs. With these good features, the proposed broadband to dual-band tunable polarization converter is expected to be used in widespread applications.
Energy Technology Data Exchange (ETDEWEB)
Radke, S.; Kirschner, S.; Seipel, V.; Rader, C.; Eulert, J. [Department of Orthopaedic Surgery, Koenig-Ludwig-Haus, Julius-Maximilians University, Wuerzburg, Brettreichstr.11, 97074, Wuerzburg (Germany)
2004-09-01
To identify imaging criteria that determine the outcome of core decompression (CD) in femoral-head avascular necrosis (AVN). Radiographs and magnetic resonance imaging (MRI) of 65 hips with early stage AVN treated by core decompression between January 1990 and December 2000 for AVN were reviewed. All hips were categorized into two groups according to the result of CD using total hip arthroplasty (THA) as an end point. Hips that had no THA at follow-up were allocated to group I; those treated with a THA were allocated to group II. CD results were calculated for each group using THA as an end point. The parameters analyzed were the presence or absence of edema associated with the double-line sign on the preoperative MRI, the type of epiphyseal scar (ES) according to Jing, and the type of necrosis according to Mitchell. On follow-up, 45 hips had no THA (group I); 20 patients had a THA (group II). Patients with a radiographic crescent sign and those with edema associated with the double-line sign progressed to THA significantly more frequently. The extent of the necrosis had less discriminatory effect between the two groups. ES and necrotic tissue types had no prognostic value. In regard to the success of CD, it is important to differentiate on MRI between a double line sign plus bone marrow edema and a double-line sign only. (orig.)
International Nuclear Information System (INIS)
Radke, S.; Kirschner, S.; Seipel, V.; Rader, C.; Eulert, J.
2004-01-01
To identify imaging criteria that determine the outcome of core decompression (CD) in femoral-head avascular necrosis (AVN). Radiographs and magnetic resonance imaging (MRI) of 65 hips with early stage AVN treated by core decompression between January 1990 and December 2000 for AVN were reviewed. All hips were categorized into two groups according to the result of CD using total hip arthroplasty (THA) as an end point. Hips that had no THA at follow-up were allocated to group I; those treated with a THA were allocated to group II. CD results were calculated for each group using THA as an end point. The parameters analyzed were the presence or absence of edema associated with the double-line sign on the preoperative MRI, the type of epiphyseal scar (ES) according to Jing, and the type of necrosis according to Mitchell. On follow-up, 45 hips had no THA (group I); 20 patients had a THA (group II). Patients with a radiographic crescent sign and those with edema associated with the double-line sign progressed to THA significantly more frequently. The extent of the necrosis had less discriminatory effect between the two groups. ES and necrotic tissue types had no prognostic value. In regard to the success of CD, it is important to differentiate on MRI between a double line sign plus bone marrow edema and a double-line sign only. (orig.)
DEFF Research Database (Denmark)
Kok-Jensen, A; Henriksen, Jens Henrik Sahl
1984-01-01
The overall extravasation rate of albumin, TER (i.e. the fraction of the intravascular albumin mass (IVM) passing into, and during steady state returning from, the extravascular space per unit time) was determined from the disappearance of i.v. injected radioiodinated serum albumin in seven...... controls 6.0% IVM/h (range 4.3-7.4), indicating that no significant change in microvascular leakiness to albumin could be found in patients with COLD. Thus, the results bring no support to a generally increased microvascular permeability to proteins in patients with COLD....
Parametric resonance in neutrino oscillations in matter
Indian Academy of Sciences (India)
Neutrino oscillations in matter can exhibit a specific resonance enhancement - parametric resonance, which is different from the MSW resonance. Oscillations of atmospheric and solar neutrinos inside the earth can undergo parametric enhancement when neutrino trajectories cross the core of the earth. In this paper we ...
Multiple Fano resonances in single-layer nonconcentric core-shell nanostructures
DEFF Research Database (Denmark)
Zhang, Jingjing; Zayats, Anatoly
2013-01-01
where the multiple dark modes appear due to the geometrical symmetry breaking induced by axial offset of the core. Both dielectric-core-metal-shell (DCMS) and metal-core-dielectric-shell (MCDS) configurations have been studied. Compared to the MCDS structure, the DCMS configuration provides higher...
Energy Technology Data Exchange (ETDEWEB)
Grey, J.; Chow, S.
1976-06-30
The three-volume report describes a dual-mode nuclear space power and propulsion system concept that employs an advanced solid-core nuclear fission reactor coupled via heat pipes to one of several electric power conversion systems. Such a concept could be particularly useful for missions which require both relatively high acceleration (e.g., for planetocentric maneuvers) and high performance at low acceleration (e.g., on heliocentric trajectories or for trajectory shaping). The first volume develops the mathematical model of the system.
Energy Technology Data Exchange (ETDEWEB)
Chhipa, Mayur Kumar, E-mail: mayurchhipa1@gmail.com [Deptt. of Electronics and Communication Engineering, Government Engineering College Ajmer Rajasthan INDIA (India); Dusad, Lalit Kumar [Rajasthan Technical University Kota, Rajasthan (India)
2016-05-06
In this paper channel drop filter (CDF) is designed using dual curved photonic crystal ring resonator (PCRR). The photonic band gap (PBG) is calculated by plane wave expansion (PWE) method and the photonic crystal (PhC) based on two dimensional (2D) square lattice periodic arrays of silicon (Si) rods in air structure have been investigated using finite difference time domain (FDTD) method. The number of rods in Z and X directions is 21 and 20 respectively with lattice constant 0.540 nm and rod radius r = 0.1 µm. The channel drop filter has been optimized for telecommunication wavelengths λ = 1.591 µm with refractive indices 3.533. In the designed structure further analysis is also done by changing whole rods refractive index and it has been observed that this filter may be used for filtering several other channels also. The designed structure is useful for CWDM systems. This device may serve as a key component in photonic integrated circuits. The device is ultra compact with the overall size around 123 µm{sup 2}.
Jiansen Li; Jianqi Sun; Ying Song; Yanran Xu; Jun Zhao
2014-01-01
An effective way to improve the data acquisition speed of magnetic resonance imaging (MRI) is using under-sampled k-space data, and dictionary learning method can be used to maintain the reconstruction quality. Three-dimensional dictionary trains the atoms in dictionary in the form of blocks, which can utilize the spatial correlation among slices. Dual-dictionary learning method includes a low-resolution dictionary and a high-resolution dictionary, for sparse coding and image updating respectively. However, the amount of data is huge for three-dimensional reconstruction, especially when the number of slices is large. Thus, the procedure is time-consuming. In this paper, we first utilize the NVIDIA Corporation's compute unified device architecture (CUDA) programming model to design the parallel algorithms on graphics processing unit (GPU) to accelerate the reconstruction procedure. The main optimizations operate in the dictionary learning algorithm and the image updating part, such as the orthogonal matching pursuit (OMP) algorithm and the k-singular value decomposition (K-SVD) algorithm. Then we develop another version of CUDA code with algorithmic optimization. Experimental results show that more than 324 times of speedup is achieved compared with the CPU-only codes when the number of MRI slices is 24.
Falzone, S.; Slater, L. D.; Day-Lewis, F. D.; Parker, B. L.; Keating, K.; Robinson, J.
2017-12-01
Mass transfer is the process by which solute is retained in less-mobile porosity domains, and later released into the mobile porosity domain. This process is often responsible for the slow arrival and gradual release of contaminants and solute tracers. Recent studies have outlined methods using dual-domain mass transfer (DDMT) models for characterizing this phenomenon. These models use the non-linear relationship of bulk (σb) and fluid (σf) conductivity, collected from electrical methods during tracer experiments, to characterize the less-mobile/mobile porosity ratio (β) and the mass-transfer rate coefficient (α). DDMT models use the hysteretic σb-σf relationship observed while solute tracers are injected and then flushed from a sample media. Due to limitations in observing the hysteretic σb-σf relationship, this method has not been used to characterize low permeability samples. We have developed an experimental method for testing porous rock cores that allows us to develop a fundamental understanding of contaminant storage and release in consolidated rock. We test the approach on cores from sedimentary rock sites where mass transfer is expected to occur between hydraulically connected fractures and the adjacent low permeability rock matrix. Our method uses a Hassler-type core holder, designed to apply confining pressure around the outside of a sample core, which hydraulically isolates the sample core, allowing water to be injected into it at increased pressures. The experimental apparatus was also designed to measure σb with spectral induced polarization (SIP) measurements, and σf from a sampling port located at the center of the core. Cores were initially saturated with a solution with high electrical conductivity ( 80000 μS/cm). DI water was then injected into the cores at elevated pressures (>60 psi) and the saturating solution was flushed from the cores, in order to generate flow rates fast enough to capture the non-linear σb-σf relationship
Energy Technology Data Exchange (ETDEWEB)
Zhang, Song; Qi, Yueyong; Yang, Hua; Gong, Mingfu; Zhang, Dong; Zou, Liguang, E-mail: zlgxqyy@163.com [Third Military Medical University, Department of Radiology, Xinqiao Hospital (China)
2013-11-15
Bimetallic core/shell Fe{sub 2}O{sub 3}/Au nanoparticles are promising candidate dual-mode contrast agents for magnetic resonance imaging (MRI) and computed tomography (CT) imaging. However, the gold coating on the hybrid nanoparticles (hybrids) affects the MRI and CT imaging quality. A thick gold nanoshell increases the X-ray attenuation effect but decreases the magnetic saturation of the hybrids. Therefore, we studied the effect of the Fe{sub 2}O{sub 3} and Au composition on these properties to find a suitable hybrid for MRI and CT imaging. Water-soluble, Au-coated magnetic nanoparticles were synthesized by iteratively reducing Au{sup 3+} onto the Fe{sub 2}O{sub 3} surface via hydroxylamine seeding. The properties of the hybrids obtained after different numbers of Au seeding cycles were studied using transmission electron microscopy, UV–Vis spectrophotometry, a vibrating swatch gaussmeter, MRI, CT, and an MTT assay. The hybrids obtained after three Au seeding cycles had an Fe{sub 2}O{sub 3}:Au molar ratio of 7.2:26.8, a mean diameter of 48.3 nm, a UV–Vis absorbance peak of 550 nm, a saturation magnetization of 49.0 emu/g, and no cytotoxicity at a concentration of 500 μg/mL after incubation with RAW 264.7 cells for up to 72 h. The hybrids obtained after three Au seeding cycles are the preferred candidates for MRI and CT applications because of their relatively high R2 relaxivity (95 mM{sup −1 }s{sup −1}) and X-ray attenuation (1.87 times that of iodine) compared to those of the other hybrids investigated in this study.
Fast response double series resonant high-voltage DC-DC converter
International Nuclear Information System (INIS)
Lee, S S; Iqbal, S; Kamarol, M
2012-01-01
In this paper, a novel double series resonant high-voltage dc-dc converter with dual-mode pulse frequency modulation (PFM) control scheme is proposed. The proposed topology consists of two series resonant tanks and hence two resonant currents flow in each switching period. Moreover, it consists of two high-voltage transformer with the leakage inductances are absorbed as resonant inductor in the series resonant tanks. The secondary output of both transformers are rectified and mixed before supplying to load. In the resonant mode operation, the series resonant tanks are energized alternately by controlling two Insulated Gate Bipolar Transistor (IGBT) switches with pulse frequency modulation (PFM). This topology operates in discontinuous conduction mode (DCM) with all IGBT switches operating in zero current switching (ZCS) condition and hence no switching loss occurs. To achieve fast rise in output voltage, a dual-mode PFM control during start-up of the converter is proposed. In this operation, the inverter is started at a high switching frequency and as the output voltage reaches 90% of the target value, the switching frequency is reduced to a value which corresponds to the target output voltage. This can effectively reduce the rise time of the output voltage and prevent overshoot. Experimental results collected from a 100-W laboratory prototype are presented to verify the effectiveness of the proposed system.
Metal-in-metal localized surface plasmon resonance
Energy Technology Data Exchange (ETDEWEB)
Smith, G B; Earp, A A, E-mail: g.smith@uts.edu.au [Department of Physics and Advanced Materials and Institute of Nanoscale Technology, University of Technology, Sydney, PO Box 123, Broadway NSW 2007 (Australia)
2010-01-08
Anomalous strong resonances in silver and gold nanoporous thin films which conduct are found to arise from isolated metal nano-islands separated from the surrounding percolating metal network by a thin loop of insulator. This observed resonant optical response is modelled. The observed peak position is in agreement with the observed average dimensions of the silver core and insulator shell. As the insulating ring thickness shrinks, the resonance moves to longer wavelengths and strengthens. This structure is the Babinet's principle counterpart of dielectric core-metal shell nanoparticles embedded in dielectric. Like for the latter, tuning of resonant absorption is possible, but here the matrix reflects rather than transmits, and tuning to longer wavelengths is more practical. A new class of metal mirror occurring as a single thin layer is identified using the same resonances in dense metal mirrors. Narrow band deep localized dips in reflectance result.
Metal-in-metal localized surface plasmon resonance
Smith, G. B.; Earp, A. A.
2010-01-01
Anomalous strong resonances in silver and gold nanoporous thin films which conduct are found to arise from isolated metal nano-islands separated from the surrounding percolating metal network by a thin loop of insulator. This observed resonant optical response is modelled. The observed peak position is in agreement with the observed average dimensions of the silver core and insulator shell. As the insulating ring thickness shrinks, the resonance moves to longer wavelengths and strengthens. This structure is the Babinet's principle counterpart of dielectric core-metal shell nanoparticles embedded in dielectric. Like for the latter, tuning of resonant absorption is possible, but here the matrix reflects rather than transmits, and tuning to longer wavelengths is more practical. A new class of metal mirror occurring as a single thin layer is identified using the same resonances in dense metal mirrors. Narrow band deep localized dips in reflectance result.
Energy Technology Data Exchange (ETDEWEB)
Wu, Chao, E-mail: wuchao27@126.com [Department of Pharmaceutics, Liaoning Medical University, 40 Songpo Road, Linghe District, Jinzhou, Liaoning Province 121001 (China); Sun, Xiaohu [Management Center for Experiments, Bohai University, 19 Keji Road, Songshan District, Jinzhou, Liaoning Province 121000 (China); Zhao, Zongzhe; Zhao, Ying; Hao, Yanna; Liu, Ying [Department of Pharmaceutics, Liaoning Medical University, 40 Songpo Road, Linghe District, Jinzhou, Liaoning Province 121001 (China); Gao, Yu, E-mail: gaoyu_1116@163.com [Department of Medical Oncology, First Affiliated Hospital of Liaoning Medical University, 40 Songpo Road, Linghe District, Jinzhou, Liaoning Province 121001 (China)
2014-11-01
Novel core-shell dual-mesoporous silica nanospheres (DMSS) with a tunable pore size were synthesized successfully using a styrene monomer as a channel template for the core and cetyltrimethyl ammonium bromide (CTAB) as a channel template for the shell in order to improve the dissolution rate of poorly water-soluble drugs. Simvastatin was used as a model drug and loaded into DMSS and the mesoporous core without the shell (MSC) by the solvent evaporation method. The drug loading efficiency of DMSS and MSC were determined by thermogravimetric analysis (TGA) and ultraviolet spectroscopy (UV). Characterization, using scanning electron microscopy (SEM), transmission electron microscopy (TEM), nitrogen adsorption, powder X-ray diffraction (XRD), differential scanning calorimetry (DSC), and Fourier transform infrared spectroscopy (FTIR) showed that simvastatin adsorbed in DMSS and MSC was in an amorphous state, and in vitro release test results demonstrated that both DMSS and MSC increased the water solubility and dissolution rate of simvastatin. The shell structure of DMSS was able to regulate the release of simvastatin compared with MSC. It is worth noting that DMSS has significant potential as a carrier for improving the dissolution of poorly water-soluble drugs and reducing the rapid release. - Highlights: • A novel core-shell DMSS is prepared for improving the dissolution rate of simvastatin. • The diffusional resistance of the mesoporous shell can delay and regulate drug release. • Simvastatin absorbed in DMSS exists in amorphous form due to spatial confinement.
International Nuclear Information System (INIS)
Wu, Chao; Sun, Xiaohu; Zhao, Zongzhe; Zhao, Ying; Hao, Yanna; Liu, Ying; Gao, Yu
2014-01-01
Novel core-shell dual-mesoporous silica nanospheres (DMSS) with a tunable pore size were synthesized successfully using a styrene monomer as a channel template for the core and cetyltrimethyl ammonium bromide (CTAB) as a channel template for the shell in order to improve the dissolution rate of poorly water-soluble drugs. Simvastatin was used as a model drug and loaded into DMSS and the mesoporous core without the shell (MSC) by the solvent evaporation method. The drug loading efficiency of DMSS and MSC were determined by thermogravimetric analysis (TGA) and ultraviolet spectroscopy (UV). Characterization, using scanning electron microscopy (SEM), transmission electron microscopy (TEM), nitrogen adsorption, powder X-ray diffraction (XRD), differential scanning calorimetry (DSC), and Fourier transform infrared spectroscopy (FTIR) showed that simvastatin adsorbed in DMSS and MSC was in an amorphous state, and in vitro release test results demonstrated that both DMSS and MSC increased the water solubility and dissolution rate of simvastatin. The shell structure of DMSS was able to regulate the release of simvastatin compared with MSC. It is worth noting that DMSS has significant potential as a carrier for improving the dissolution of poorly water-soluble drugs and reducing the rapid release. - Highlights: • A novel core-shell DMSS is prepared for improving the dissolution rate of simvastatin. • The diffusional resistance of the mesoporous shell can delay and regulate drug release. • Simvastatin absorbed in DMSS exists in amorphous form due to spatial confinement
Alqadami, Abdulrahman Shueai Mohsen; Jamlos, Mohd Faizal; Soh, Ping Jack; Rahim, Sharul Kamal Abdul; Vandenbosch, Guy A. E.; Narbudowicz, Adam
2017-01-01
A miniaturized dual-band antenna array using a negative index metamaterial is presented for WiMAX, LTE, and WLAN applications. This left-handed metamaterial plane is located behind the antenna array, and its unit cell is a combination of split-ring resonator, square electric ring resonator, and rectangular electrical coupled resonator. This enables the achievement of a metamaterial structure exhibiting both negative permittivity and permeability, which results in antenna size miniaturization, efficiency, and gain enhancement. Moreover, the proposed metamaterial antenna has realized dual-band operating frequencies compared to a single frequency for normal antenna. The measured reflection coefficient (S11) shows a 50.25% bandwidth in the lower band (from 2.119 to 3.058 GHz) and 4.27% in the upper band (from 5.058 to 5.276 GHz). Radiation efficiency obtained in the lower and upper band are >95 and 80%, respectively.
Miao, Luyang; Zhu, Chengzhou; Jiao, Lei; Li, He; Du, Dan; Lin, Yuehe; Wei, Qin
2018-02-06
Numerous analytical techniques have been undertaken for the detection of protein biomarkers because of their extensive and significant applications in clinical diagnosis, whereas there are few strategies to develop dual-readout immunosensors to achieve more accurate results. To the best of our knowledge, inspired by smart drug delivery system (DDS), a novel pH-responsive modified enzyme-linked immunosorbent assay (ELISA) was innovatively developed for the first time, realizing dual-modal colorimetric and fluorescent detection of cardiac troponin I (cTnI). Curcumin (CUR) was elaborately selected as a reporter molecule, which played the same role of drugs in DDS based on the following considerations: (1) CUR can be used as a kind of pH indicator by the inherited allochroic effect induced by basic pH value; (2) the fluorescence of CUR can be quenched by certain nanocarriers as the acceptor because of the occurrence of fluorescence resonance energy transfer (FRET), while recovered by the stimuli of basic pH value, which can produce "signal-on" fluorescence detection. Three-dimensional MoS 2 nanoflowers (3D-MoS 2 NFs) were employed in immobilizing CUR to constitute a nanoprobe for the determination of cTnI by virtue of good biocompatibility, high absorption capacity, and fluorescence quench efficiency toward CUR. The proposed DDS-inspired ELISA offered dual-modal colorimetric and fluorescent detection of cTnI, thereby meeting the reliable and precise analysis requirements. We believe that the developed dual-readout ELISA will create a new avenue and bring innovative inspirations for biological detections.
Compact Microstrip Triple-Mode Bandpass Filters Using Dual-Stub-Loaded Spiral Resonators
Directory of Open Access Journals (Sweden)
K. D. Xu
2017-04-01
Full Text Available Two new microstrip triple-mode resonators loaded with T-shaped open stubs using axially and centrally symmetric spiral structures, respectively, are presented. Spiraled for circuit size reduction, these two half-wavelength resonators can both generate three resonant modes over a wide frequency band by loading two T-stubs with different lengths. Due to the structural symmetry, they can be analyzed by odd- and even-mode method. To validate the design concept, two compact bandpass filters (BPFs using these two novel resonators with center frequencies of 1.76 GHz and 2.44 GHz for the GSM1800 and WLAN/Zigbee applications, respectively, have been designed, fabricated and tested. The center frequencies and bandwidths can be tunable through the analysis of resonant frequency responses, fractional bandwidths and external quality factor versus the resonator parameters. The final measured results have achieved good consistence with the simulations of these two BPFs.
Kiaalhosseini, Saeed
In modern contaminant hydrology, management of contaminated sites requires a holistic characterization of subsurface conditions. Delineation of contaminant distribution in all phases (i.e., aqueous, non-aqueous liquid, sorbed, and gas), as well as associated biogeochemical processes in a complex heterogeneous subsurface, is central to selecting effective remedies. Arguably, a factor contributing to the lack of success of managing contaminated sites effectively has been the limitations of site characterization methods that rely on monitoring wells and grab sediment samples. The overarching objective of this research is to advance a set of third-generation (3G) site characterization methods to overcome shortcomings of current site characterization techniques. 3G methods include 1) cryogenic core collection (C3) from unconsolidated geological subsurface to improve recovery of sediments and preserving key attributes, 2) high-throughput analysis (HTA) of frozen core in the laboratory to provide high-resolution, depth discrete data of subsurface conditions and processes, 3) resolution of non-aqueous phase liquid (NAPL) distribution within the porous media using a nuclear magnetic resonance (NMR) method, and 4) application of a complex resistivity method to track NAPL depletion in shallow geological formation over time. A series of controlled experiments were conducted to develop the C 3 tools and methods. The critical aspects of C3 are downhole circulation of liquid nitrogen via a cooling system, the strategic use of thermal insulation to focus cooling into the core, and the use of back pressure to optimize cooling. The C3 methods were applied at two contaminated sites: 1) F.E. Warren (FEW) Air Force Base near Cheyenne, WY and 2) a former refinery in the western U.S. The results indicated that the rate of core collection using the C3 methods is on the order of 30 foot/day. The C3 methods also improve core recovery and limits potential biases associated with flowing sands
Intestinal CYP2E1: A mediator of alcohol-induced gut leakiness
Directory of Open Access Journals (Sweden)
Christopher B. Forsyth
2014-01-01
Full Text Available Chronic alcohol use can result in many pathological effects including alcoholic liver disease (ALD. While alcohol is necessary for the development of ALD, only 20–30% of alcoholics develop alcoholic steatohepatitis (ASH with progressive liver disease leading to cirrhosis and liver failure (ALD. This suggests that while chronic alcohol consumption is necessary it is not sufficient to induce clinically relevant liver damage in the absence of a secondary risk factor. Studies in rodent models and alcoholic patients show that increased intestinal permeability to microbial products like endotoxin play a critical role in promoting liver inflammation in ALD pathogenesis. Therefore identifying mechanisms of alcohol-induced intestinal permeability is important in identifying mechanisms of ALD and for designing new avenues for therapy. Cyp2e1 is a cytochrome P450 enzyme that metabolizes alcohol has been shown to be upregulated by chronic alcohol use and to be a major source of oxidative stress and liver injury in alcoholics and in animal and in vitro models of chronic alcohol use. Because Cyp2e1 is also expressed in the intestine and is upregulated by chronic alcohol use, we hypothesized it could play a role in alcohol-induced intestinal hyperpermeability. Our in vitro studies with intestinal Caco-2 cells and in mice fed alcohol showed that circadian clock proteins CLOCK and PER2 are required for alcohol-induced permeability. We also showed that alcohol increases Cyp2e1 protein and activity but not mRNA in Caco-2 cells and that an inhibitor of oxidative stress or siRNA knockdown of Cyp2e1 prevents the increase in CLOCK or PER2 proteins and prevents alcohol-induced hyperpermeability. With our collaborators we have also shown that Cyp2e1 knockout mice are resistant to alcohol-induced gut leakiness and liver inflammation. Taken together our data support a novel Cyp2e1-circadian clock protein mechanism for alcohol-induced gut leakiness that could provide new
Computer supervision of the core outlet sodium temperatures of FBTR
International Nuclear Information System (INIS)
Boopathy, C.
1976-01-01
Safety monitoring of the fast breeder test reactor at Kalpakkam (India) is achieved by a CDPS-on-line dual computer system which is dedicated to plant supervision. The on-line subsystem scans and supervises all the 170 core thermocouple signals every second. Organisation of the reactor core instruments, supervision of mean sodium outlet temperature and mean temperature drop across the core, detection of plugging of a fuel assembly are explained. (A.K.)
Shahamat, Yadollah; Vahedi, Mohammad
2017-06-01
An ultracompact double eight-shaped plasmonic structure for the realization of plasmon-induced transparency (PIT) in the terahertz (THz) region has been studied. The device consists of a semiconductor-insulator-semiconductor bus waveguide coupled to the dual-disk resonators. Indium antimonide is employed to excite SPP in the THz region. The transmission characteristics of the proposed device are simulated numerically by the finite-difference time-domain method. In addition, a theoretical analysis based on the coupled-mode theory for transmission features is presented and compared with the numerical results. Results are in good agreement. Also, the dependence of PIT frequency characteristics on the radius of the outer disk is discussed in detail. In addition, by removing one of the outer disk resonators, double-PIT peaks can be observed in the transmission spectrum, and the physical mechanism of the appeared peaks is investigated. Finally, an application of the proposed structure for distinguishing different states of DNA molecules is discussed. Results show that the maximum sensitivity with 654 GHz/RIU-1 could be obtained for a single PIT structure. The frequency shifts equal to 37 and 99 GHz could be observed for the denatured and the hybridized DNA states, respectively.
Dual-axis resonance testing of wind turbine blades
Hughes, Scott; Musial, Walter; White, Darris
2014-01-07
An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.
Çelebi, Mehmet
2016-01-01
Responses of a dual core shear-wall and outrigger-framed 58-story building recorded during the Mw6.0 Napa earthquake of 24 August 2014 and the Mw3.8 Berkeley earthquake of 20 October 2011 are used to identify its dynamic characteristics and behavior. Fundamental frequencies are 0.28 Hz (NS), 0.25 Hz (EW), and 0.43 Hz (torsional). Rigid body motions due to rocking are not significant. Average drift ratios are small. Outrigger frames do not affect average drift ratios or mode shapes. Local site effects do not affect the response; however, response associated with deeper structure may be substantial. A beating effect is observed from data of both earthquakes but beating periods are not consistent. Low critical damping ratios may have contributed to the beating effect. Torsion is relatively larger above outriggers as indicated by the time-histories of motions at the roof, possibly due to the discontinuity of the stiffer shear walls above level 47.
Directory of Open Access Journals (Sweden)
Keiichi YOSHIDA
2014-01-01
Full Text Available Objective: The purpose of this study was to evaluate the Knoop hardness number (KHN of dual-cured core build-up resin composites (DCBRCs at 6 depths of cavity after 3 post-irradiation times by 4 light-exposure methods. Material and Methods: Five specimens each of DCBRCs (Clearfil DC Core Plus [DCP] and Unifil Core EM [UCE] were filled in acrylic resin blocks with a semi-cylindrical cavity and light-cured using an LED light unit (power density: 1,000 mW/cm2at the top surface by irradiation for 20 seconds (20 s, 40 seconds (40 s, bonding agent plus 20 seconds (B+20 s, or 40 seconds plus light irradiation of both sides of each acrylic resin block for 40 seconds each (120 s. KHN was measured at depths of 0.5, 2.0, 4.0, 6.0, 8.0, and 10.0 mm at 0.5 hours, 24 hours, and 7 days post-irradiation. Statistical analysis was performed using repeated measures ANOVA and Tukey's compromise post-hoc test with a significance level of p0.05. In DCP, and not UCE, at 24 hours and 7 days post-irradiation, the B+20 s method showed significantly higher KHN at all depths of cavity, except the depth of 0.5 mm (p<0.05. Conclusion: KHN depends on the light-exposure method, use of bonding agent, depth of cavity, post-irradiation time, and material brand. Based on the microhardness behavior, DCBRCs are preferably prepared by the effective exposure method, when used for a greater depth of cavity.
Wang, Zhongxian; Liu, Yiping; Wei, Yonggeng; Song, Yilin
2018-01-01
The resonant coil design is taken as the core technology in the magnetic coupling resonant wireless power transmission system, which achieves energy transmission by the coupling of the resonant coil. This paper studies the effect of the resonant coil on energy transmission and the efficiency of the system. Combining a two-coil with a three-coil system, the optimum design method for the resonant coil is given to propose a novel coil structure. First, the co-simulation methods of Pspice and Maxwell are used. When the coupling coefficient of the resonant coil is different, the relationship between system transmission efficiency, output power, and frequency is analyzed. When the self-inductance of the resonant coil is different, the relationship between the performance and frequency of the system transmission is analyzed. Then, two-coil and three-coil structure models are built, and the parameters of the magnetic field of the coils are calculated and analyzed using the finite element method. In the end, a dual E-type simulation circuit model is used to optimize the design of the novel resonance coil. The co-simulation results show that the coupling coefficients of the two-coil, three-coil, and novel coil systems are 0.017, 0.17 and 0.0126, respectively. The power loss of the novel coil is 16.4 mW. There is an obvious improvement in the three-coil system, which shows that the magnetic leakage of the field and the energy coupling are relatively small. The new structure coil has better performance, and the load loss is lower; it can improve the system output power and transmission efficiency.
Zhu, Guangtun Ben; Barrera-Ballesteros, Jorge K.; Heckman, Timothy M.; Zakamska, Nadia L.; Sánchez, Sebastian F.; Yan, Renbin; Brinkmann, Jonathan
2017-07-01
We revisit the relation between the stellar surface density, the gas surface density and the gas-phase metallicity of typical disc galaxies in the local Universe with the SDSS-IV/MaNGA survey, using the star formation rate surface density as an indicator for the gas surface density. We show that these three local parameters form a tight relationship, confirming previous works (e.g. by the PINGS and CALIFA surveys), but with a larger sample. We present a new local leaky-box model, assuming star-formation history and chemical evolution is localized except for outflowing materials. We derive closed-form solutions for the evolution of stellar surface density, gas surface density and gas-phase metallicity, and show that these parameters form a tight relation independent of initial gas density and time. We show that, with canonical values of model parameters, this predicted relation match the observed one well. In addition, we briefly describe a pathway to improving the current semi-analytic models of galaxy formation by incorporating the local leaky-box model in the cosmological context, which can potentially explain simultaneously multiple properties of Milky Way-type disc galaxies, such as the size growth and the global stellar mass-gas metallicity relation.
Sepulveda, N.; Rohrer, K.
2008-05-01
The permeability of the semiconfining layers of the highly productive Floridan Aquifer System may be large enough to invalidate the assumptions of the leaky aquifer theory. These layers are the intermediate confining and the middle semiconfining units. The analysis of aquifer-test data with analytical solutions of the ground-water flow equation developed with the approximation of a low hydraulic conductivity ratio between the semiconfining layer and the aquifer may lead to inaccurate hydraulic parameters. An analytical solution is presented here for the flow in a confined leaky aquifer, the overlying storative semiconfining layer, and the unconfined aquifer, generated by a partially penetrating well in a two-aquifer system, and allowing vertical and lateral flow components to occur in the semiconfining layer. The equations describing flow caused by a partially penetrating production well are solved analytically to provide a method to accurately determine the hydraulic parameters in the confined aquifer, semiconfining layer, and unconfined aquifer from aquifer-test data. Analysis of the drawdown data from an aquifer test performed in central Florida showed that the flow solution presented here for the semiconfining layer provides a better match and a more unique identification of the hydraulic parameters than an analytical solution that considers only vertical flow in the semiconfining layer.
Bock, Michael; Schmitt, Jochen; Beck, Jonas; Seth, Barbara; Chappellaz, Jérôme; Fischer, Hubertus
2017-07-01
Atmospheric methane (CH4) records reconstructed from polar ice cores represent an integrated view on processes predominantly taking place in the terrestrial biogeosphere. Here, we present dual stable isotopic methane records [δ13CH4 and δD(CH4)] from four Antarctic ice cores, which provide improved constraints on past changes in natural methane sources. Our isotope data show that tropical wetlands and seasonally inundated floodplains are most likely the controlling sources of atmospheric methane variations for the current and two older interglacials and their preceding glacial maxima. The changes in these sources are steered by variations in temperature, precipitation, and the water table as modulated by insolation, (local) sea level, and monsoon intensity. Based on our δD(CH4) constraint, it seems that geologic emissions of methane may play a steady but only minor role in atmospheric CH4 changes and that the glacial budget is not dominated by these sources. Superimposed on the glacial/interglacial variations is a marked difference in both isotope records, with systematically higher values during the last 25,000 y compared with older time periods. This shift cannot be explained by climatic changes. Rather, our isotopic methane budget points to a marked increase in fire activity, possibly caused by biome changes and accumulation of fuel related to the late Pleistocene megafauna extinction, which took place in the course of the last glacial.
Cui, Zhiping; Hu, Xiaoli; Liu, Shaopu; Liu, Zhongfang
2011-12-01
A dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) method was developed to detect chondroitin sulfate (CS) with nile blue sulfate (NBS). At pH 3.0-4.0 Britton-Robinson (BR) buffer medium, CS interacted with NBS to form an ion-association complex. As a result, the new spectra of resonance Rayleigh scattering (RRS), second order scattering (SOS) and frequence doubling scattering (FDS) appeared and their intensities were enhanced greatly. Their maximum wavelengths were located at 303 nm (RRS), 362 nm (RRS), 588 nm (SOS) and 350 nm (FDS), respectively. The scattering intensities of the three methods were proportional to the concentration of CS in certain ranges. The methods had high sensitivity and the detection limits were between 1.5 and 7.1 ng mL -1. The DWO-RRS method had the highest sensitivity with the detection limit being 1.5 ng mL -1. The characteristics of the spectra and optimal reaction conditions of RRS method were investigated. The effects of coexistent substances on the determination of CS were evaluated. Owing to the high sensitivity, RRS method had been applied to the determination of CS in eye drops with satisfactory results. The recovery range was between 99.4% and 104.6% and the relative standard deviation (RSD) was between 0.4% and 0.8%. In addition, the reasons for RRS enhancement were discussed and the shape of ion-association complex was characterized by atomic force microscopy (AFM).
DUAL TIMELIKE NORMAL AND DUAL TIMELIKE SPHERICAL CURVES IN DUAL MINKOWSKI SPACE
ÖNDER, Mehmet
2009-01-01
Abstract: In this paper, we give characterizations of dual timelike normal and dual timelike spherical curves in the dual Minkowski 3-space and we show that every dual timelike normal curve is also a dual timelike spherical curve. Keywords: Normal curves, Dual Minkowski 3-Space, Dual Timelike curves. Mathematics Subject Classifications (2000): 53C50, 53C40. DUAL MINKOWSKI UZAYINDA DUAL TIMELIKE NORMAL VE DUAL TIMELIKE KÜRESEL EĞRİLER Özet: Bu çalışmada, dual Minkowski 3-...
On-chip dual-comb source for spectroscopy.
Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L; Lipson, Michal
2018-03-01
Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra, which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high quality-factor microcavities has hindered the development of on-chip dual combs. We report the simultaneous generation of two microresonator combs on the same chip from a single laser, drastically reducing experimental complexity. We demonstrate broadband optical spectra spanning 51 THz and low-noise operation of both combs by deterministically tuning into soliton mode-locked states using integrated microheaters, resulting in narrow (lasers or microwave oscillators. We demonstrate high signal-to-noise ratio absorption spectroscopy spanning 170 nm using the dual-comb source over a 20-μs acquisition time. Our device paves the way for compact and robust spectrometers at nanosecond time scales enabled by large beat-note spacings (>1 GHz).
Yoshida, Keiichi; Meng, Xiangfeng
2014-06-01
The optimal luting material for fiber-reinforced posts to ensure the longevity of foundation restorations remains undetermined. The purpose of this study was to evaluate the suitability of 3 dual-polymerizing resin cements and 2 dual-polymerizing foundation composite resins for luting fiber-reinforced posts by assessing their Knoop hardness number. Five specimens of dual-polymerizing resin cements (SA Cement Automix, G-Cem LincAce, and Panavia F2.0) and 5 specimens of dual-polymerizing foundation composite resins (Clearfil DC Core Plus and Unifil Core EM) were polymerized from the top by irradiation for 40 seconds. Knoop hardness numbers were measured at depths of 0.5, 2.0, 4.0, 6.0, 8.0, and 10.0 mm at 0.5 hours and 7 days after irradiation. Data were statistically analyzed by repeated measures ANOVA, 1-way ANOVA, and the Tukey compromise post hoc test (α=.05). At both times after irradiation, the 5 resins materials showed the highest Knoop hardness numbers at the 0.5-mm depth. At 7 days after irradiation, the Knoop hardness numbers of the resin materials did not differ significantly between the 8.0-mm and 10.0-mm depths (P>.05). For all materials, the Knoop hardness numbers at 7 days after irradiation were significantly higher than those at 0.5 hours after irradiation at all depths (Presin materials were found to decrease in the following order: DC Core Plus, Unifil Core EM, Panavia F2.0, SA Cement Automix, and G-Cem LincAce (Pcomposite resins were higher than those of the 3 dual-polymerizing resin cements, notable differences were seen among the 5 materials at all depths and at both times after irradiation. Copyright © 2014 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.
Song, Zhuonan; Qiu, Fen; Zaia, Edmond W; Wang, Zhongying; Kunz, Martin; Guo, Jinghua; Brady, Michael; Mi, Baoxia; Urban, Jeffrey J
2017-11-08
dual-channel molecular sieving core/shell porous crystals in hybrid membranes thus provides a promising means for CO 2 capture from flue gas.
Yang, Lingang; Cui, Chuanfeng; Wang, Lingzhi; Lei, Juying; Zhang, Jinlong
2016-07-27
The rational design and controlled synthesis of a smart device with flexibly tailored response ability is all along desirable for bioapplication but long remains a considerable challenge. Here, a pH-stimulated valve system with a visualized "on-off" mode is constructed through a dual-shell fluorescence resonance energy transfer (FRET) strategy. The dual shells refer to carbon dots and fluorescent molecules embedded polymethacrylic acid (F-PMAA) layers successively coating around a SiO2 core (ca. 120 nm), which play the roles as energy donor and acceptor, respectively. The total thickness of the dual-shell in the solid composite is ca. 10 nm. The priorities of this dual-shell FRET nanovalve stem from three facts: (1) the thin shell allows the formation of efficient FRET system without chemical bonding between energy donor and acceptor; (2) the maximum emission wavelength of CD layer is tunable in the range of 400-600 nm, thus providing a flexible energy donor for a wide variety of energy acceptors; (3) the outer F-PMAA shell with a pH-sensitive swelling-shrinking (on-off) behavior functions as a valve for regulating the FRET process. As such, a sensitive and stable pH ratiometric sensor with a working pH range of 3-6 has been built by simply encapsulating pH-responsive fluorescein isothiocyanate (FITC) into PMAA; a pH-dependent swelling-shrinking shuttle carrier with a finely controllable molecule-release behavior has been further fabricated using rhodamine B isothiocyanate (RBITC) as the energy donor and model guest molecule. Significantly, the controlled releasing process is visually self-monitorable.
Dual-temperature acoustic levitation and sample transport apparatus
Trinh, E.; Robey, J.; Jacobi, N.; Wang, T.
1986-01-01
The properties of a dual-temperature resonant chamber to be used for acoustical levitation and positioning have been theoretically and experimentally studied. The predictions of a first-order dissipationless treatment of the generalized wave equation for an inhomogeneous medium are in close agreement with experimental results for the temperature dependence of the resonant mode spectrum and the acoustic pressure distribution, although the measured magnitude of the pressure variations does not correlate well with the calculated one. Ground-based levitation of low-density samples has been demonstrated at 800 C, where steady-state forces up to 700 dyn were generated.
Dual-wavelength erbium-doped fiber laser with asymmetric fiber Bragg grating Fabry-Perot cavity
Chen, Cong; Xu, Zhi-wei; Wang, Meng; Chen, Hai-yan
2014-11-01
A novel dual-wavelength fiber laser with asymmetric fiber Bragg grating (FBG) Fabry-Perot (FP) cavity is proposed and experimentally demonstrated. A couple of uniform FBGs are used as the cavity mirrors, and the third FBG is used as intracavity wavelength selector by changing its operation temperature. Experimental results show that by adjusting the operation temperature of the intracavity wavelength selector, a tunable dual-wavelength laser emission can be achieved. The results demonstrate the new concept of dual-wavelength lasing with asymmetric FBG FP resonator and its technical feasibility.
International Nuclear Information System (INIS)
Budak, M.G.; Karadag, M.; Yuecel, H.
2010-01-01
The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r
Detection of vortex-core dynamics using current-induced self-bistable rectifying effect
International Nuclear Information System (INIS)
Goto, M; Hata, H; Yamaguchi, A; Miyajima, H; Nozaki, Y; Nakatani, Y; Yamaoka, T
2011-01-01
A magnetic vortex core confined in a micron-scale magnetic disk is resonantly excited by spin-polarized radio-frequency (rf) current and rf field. We show that rectifying voltage spectra caused by the vortex core resonance is dependent on the core polarity. Rectifying voltage spectra are given by the superposition of the polarity-dependent term and the polarity-independent term. The sign of the polarity-dependent rectifying voltage reverses when the sign of polarity P or external field H is reversed. This experimental result can be explained by the anisotropic magnetoresistance effect caused by the vortex core motion.
Leaky Integrate-and-Fire Neuron Circuit Based on Floating-Gate Integrator
Kornijcuk, Vladimir; Lim, Hyungkwang; Seok, Jun Yeong; Kim, Guhyun; Kim, Seong Keun; Kim, Inho; Choi, Byung Joon; Jeong, Doo Seok
2016-01-01
The artificial spiking neural network (SNN) is promising and has been brought to the notice of the theoretical neuroscience and neuromorphic engineering research communities. In this light, we propose a new type of artificial spiking neuron based on leaky integrate-and-fire (LIF) behavior. A distinctive feature of the proposed FG-LIF neuron is the use of a floating-gate (FG) integrator rather than a capacitor-based one. The relaxation time of the charge on the FG relies mainly on the tunnel barrier profile, e.g., barrier height and thickness (rather than the area). This opens up the possibility of large-scale integration of neurons. The circuit simulation results offered biologically plausible spiking activity (circuit was subject to possible types of noise, e.g., thermal noise and burst noise. The simulation results indicated remarkable distributional features of interspike intervals that are fitted to Gamma distribution functions, similar to biological neurons in the neocortex. PMID:27242416
Atomic dynamics with photon-dressed core states
International Nuclear Information System (INIS)
Robicheaux, F.
1993-01-01
This paper describes the atomic dynamics when a Rydberg atom is in a laser field which is resonant with a dipole-allowed core transition. The main approximation is to completely ignore the (short-range, direct) interaction of the outer electron with the resonant laser which is the same approximation used with great success in calculating the spectrum due to isolated core excitations (ICE). The atom autoionizes when the core absorbs a photon, because the electron can then inelastically scatter from the excited core state, gaining enough energy to escape the atom. Despite neglecting the direct interaction between the outermost electron and the laser, the laser profoundly affects the autoionization dynamics. This effect is incorporated through a frame transformation between the dressed and undressed core states which only utilizes the field free atomic scattering parameters. A two-color experiment is proposed which might be able to measure nonperturbative effects arising from the dressed core states. The usual ICE transition rate is obtained through a perturbative expansion. Generic effects are examined through a model problem. A calculation of the Mg spectrum when the driving laser is tuned to the 3s 1/2- 3p 1/2 or the 3s 1/2- 3p 3/2 transition is presented
Common window resonance features in K and heavier alkaline atoms Rb and Cs
International Nuclear Information System (INIS)
Koide, Michi; Koike, Fumihiro; Nagata, Tetsuo
2002-01-01
A previous study of subvalence s-shell photoionization of potassium [Koide et al.: J. Phys. Soc. Jpn. 71 (2002) 1676] has been extended to the cases of heavier alkaline atoms Rb and Cs. We have measured the photoion time-of-flight spectra using monochromatized synchrotron radiation. Dual windows resonance structure previously observed in K was also found in Rb and Cs, suggesting that those structure are general features in alkaline atoms. We have observed also the Rydberg series of resonances that appear in dual windows. Our data analysis shows that the resonance widths are broad when compared with its rare gas neighbors. Based on multiconfiguration Dirac-Fock calculations, the Rydberg series of resonances were assigned to the 4s 1 4p 6 5s5p excitations embedded in the 4p 5 5s continua for Rb and to the 5s 1 5p 6 6s6p excitations embedded in the 5p 5 6s continua for Cs. (author)
Characteristics of a betatron core for extraction in a proton-ion medical synchrotron
Badano, L
1997-01-01
Medical synchrotrons for radiation therapy require a very stable extraction of the beam over a period of about one second. The techniques for applying resonant extraction to achieve this long spill can be classified into two groups, those that move the resonance and those that move the beam. The latter has the great advantage of keeping all lattice functions, and hence the resonance conditions, constant. The present report examines the possibility of using a betatron core to accelerate the waiting ion beam by induction into the resonance. The working principle, the proposed characteristics and the expected performances of this device are discussed. The betatron core is a smooth high-inductance device compared to the small quadrupole lenses that are normally used to move the resonance and is therefore better suited to delivering a very smooth spill. The large stored energy in a betatron core compared to a small quadrupole is also a safety feature since it responds less quickly to transients that could send lar...
Directory of Open Access Journals (Sweden)
Li Guo
2018-06-01
Full Text Available In this paper, a circular polarizer comprising dual semicircular split-rings (DSSRs is presented. By placing it above an elliptical radiator that radiates linearly polarized (LP waves, dual-layer patch antennas capable of radiating right-hand (RH or left-hand (LH circularly polarized (CP waves are achieved in terms of the different offset direction of the bottom splits of the DSSRs. Because of both the capacitive coupling to the radiator and the degenerate modes existing in the excited DSSRs, the DSSRs collaboratively result in a circularly polarized radiation, successfully converting incident LP waves into CP ones. Simulated results show that the impedance, axial ratio (AR, and gain frequency response of both proposed CP antennas are identical, with a simulated 3-dB AR bandwidth of 72 MHz covering 2.402–2.474 GHz and a gain enhanced by 3.9 dB. The proposed antennas were fabricated and measured, revealing an operational bandwidth of 65 MHz (2.345–2.41 GHz and a peak gain up to 9 dBi. Moreover, a low profile of 0.063λ0 is maintained. The proposed CP antennas could be as a candidate for wireless target detection applications in terms of their identical frequency response property.
Hardware concepts for a large low-energetics LMFBR core. Final report
International Nuclear Information System (INIS)
Hutter, E.; Batch, R.V.
1980-12-01
A design study was made to identify a practical set of hardware configurations that would embody the requirements developed in the numerical study of a low-energetics core and blanket for a prototype large breeder reactor. Dimensioned drawings are presented for fuel, blanket, reflector/shield, and control rod subassemblies. A horizontal cross section drawing shows how these subassemblies are arranged in the total core/blanket assembly. A core support is illustrated showing a dual plenums arrangement
Resonances in the potential scattering and decay of metastable states
International Nuclear Information System (INIS)
Batsch, J.
1975-04-01
The analytic properties of the S-matrix in the complex energy plane are reviewed for potential scattering with particular attention to resonance scattering and decay of metastable states. For a one dimensional model potential with a potential barrier and a repulsive core exact formulas are derived for the energy and width of a resonance in terms of the scattering amplitudes of the barrier and the repulsive core alone. For narrow resonances simple and intuitive results are obtained, which are applied to semiclassical cases where the WKB approximation is valid. (orig.) [de
International Nuclear Information System (INIS)
Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong
2015-01-01
A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)
Yu, Mengqun; Wang, Hong; Fu, Fei; Li, Linyao; Li, Jing; Li, Gan; Song, Yang; Swihart, Mark T; Song, Erqun
2017-04-04
The effective monitoring, identification, and quantification of pathogenic bacteria is essential for addressing serious public health issues. In this study, we present a universal and facile one-step strategy for sensitive and selective detection of pathogenic bacteria using a dual-molecular affinity-based Förster (fluorescence) resonance energy transfer (FRET) platform based on the recognition of bacterial cell walls by antibiotic and aptamer molecules, respectively. As a proof of concept, Vancomycin (Van) and a nucleic acid aptamer were employed in a model dual-recognition scheme for detecting Staphylococcus aureus (Staph. aureus). Within 30 min, by using Van-functionalized gold nanoclusters and aptamer-modified gold nanoparticles as the energy donor and acceptor, respectively, the FRET signal shows a linear variation with the concentration of Staph. aureus in the range from 20 to 10 8 cfu/mL with a detection limit of 10 cfu/mL. Other nontarget bacteria showed negative results, demonstrating the good specificity of the approach. When employed to assay Staph. aureus in real samples, the dual-recognition FRET strategy showed recoveries from 99.00% to the 109.75% with relative standard derivations (RSDs) less than 4%. This establishes a universal detection platform for sensitive, specific, and simple pathogenic bacteria detection, which could have great impact in the fields of food/public safety monitoring and infectious disease diagnosis.
Lee Jae Won; Choi Jin Ho; Jin Dae Ho
2014-01-01
In this paper, we give the explicit determinations of dual plane curves, general dual helices and dual slant helices in terms of its dual curvature and dual torsion as a fundamental theory of dual curves in a dual 3-space
Competitive resonance interference models in direct whole core transport code nTRACER
Energy Technology Data Exchange (ETDEWEB)
Bacha, Meer; Joo, Han Gyu [Seoul National Univ., Seoul (Korea, Republic of)
2015-05-15
The capability of nTRACER was enhanced with WIMS IAEA library using the equivalence theory and Dancoff correction method based on the resonance integral data. The background XSs, for the heterogeneous system, incorporating the shadowing effects, are evaluated by the enhanced neutron current method. The effective XSs are generated using the Resonance Integral (RI) data by interpolating for background XSs and temperatures. The conventional method, which augments the background XS with average absorption XSs of all other resonant isotopes in the mixture, is used for treating the resonance interference in mixed resonant absorbers. A lot of methods are being developed for the resonance self-shielding in mixed absorbers, but still there exists some inadequacy in the XSs evaluation. The most accurate method is solving the UFG slowing down equation, but at the cost of huge computational burden. On the other hand, the conventional method is the simplest and easy to implement, but it has drawback, that it can't correctly estimate the cross sections in mixed absorbers because it adds the absorption XS. The resonance interference treatment methods are studied and implemented in nTRACER and checked the capacity to improve the overlap effects for multiple resonant isotopes. In XST method, the XSs are improved a lot as compared to conventional method, but still there exists discrepancy in the lower energy range. This method is very fast having no burden during execution.
Radiation quality factor of spherical antennas with material cores
DEFF Research Database (Denmark)
Hansen, Troels Vejle; Kim, Oleksiy S.; Breinbjerg, Olav
2011-01-01
This paper gives a description of the radiation quality factor and resonances of spherical antennas with material cores. Conditions for cavity and radiating resonances are given, and a theoretical description of the radiation quality factor, as well as simple expressions describing the relative...
Compatibility between dental adhesive systems and dual-polymerizing composite resins.
Michaud, Pierre-Luc; MacKenzie, Alexandra
2016-10-01
Information is lacking about incompatibilities between certain types of adhesive systems and dual-polymerizing composite resins, and universal adhesives have yet to be tested with these resins. The purpose of this in vitro study was to investigate the bonding outcome of dual-polymerizing foundation composite resins by using different categories of adhesive solutions and to determine whether incompatibilities were present. One hundred and eighty caries-free, extracted third molar teeth were allocated to 9 groups (n=20), in which 3 different bonding agents (Single Bond Plus [SB]), Scotchbond Multi-purpose [MP], and Scotchbond Universal [SU]) were used to bond 3 different composite resins (CompCore AF [CC], Core Paste XP [CP], and Filtek Supreme Ultra [FS]). After restorations had been fabricated using an Ultradent device, the specimens were stored in water at 37°C for 24 hours. The specimens were tested under shear force at a rate of 0.5 mm/min. The data were analyzed with Kruskal-Wallis tests and post hoc pairwise comparisons (α=.05). All 3 composite resins produced comparable shear bond strengths when used with MP (P=.076). However, when either SB or SU was used, the light-polymerized composite resin (FS) and 1 dual-polymerized foundation composite resin (CC) bonded significantly better than the other dual-polymerized foundation composite resin (CP) (Pincompatibilities exist between different products. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.
Recognition of chromatin by the plant alkaloid, ellipticine as a dual binder
Energy Technology Data Exchange (ETDEWEB)
Banerjee, Amrita; Sanyal, Sulagna; Majumder, Parijat [Biophysics & Structural Genomics Division, Saha Institute of Nuclear Physics, Block-AF, Sector-1, Bidhan Nagar, Kolkata 700064, West Bengal (India); Chakraborty, Payal [Bionivid Technology Pvt Ltd, Kasturi Nagar, Bangalore 560043 (India); Jana, Kuladip [Division of Molecular Medicine, Centre for Translational Animal Research, Bose Institute, P-1/12 C.I.T. Scheme VIIM, Kolkata 700054, West Bengal (India); Das, Chandrima, E-mail: chandrima.das@saha.ac.in [Biophysics & Structural Genomics Division, Saha Institute of Nuclear Physics, Block-AF, Sector-1, Bidhan Nagar, Kolkata 700064, West Bengal (India); Dasgupta, Dipak, E-mail: dipak.dasgupta@saha.ac.in [Biophysics & Structural Genomics Division, Saha Institute of Nuclear Physics, Block-AF, Sector-1, Bidhan Nagar, Kolkata 700064, West Bengal (India)
2015-07-10
Recognition of core histone components of chromatin along with chromosomal DNA by a class of small molecule modulators is worth examining to evaluate their intracellular mode of action. A plant alkaloid ellipticine (ELP) which is a putative anticancer agent has so far been reported to function via DNA intercalation, association with topoisomerase II and binding to telomere region. However, its effect upon the potential intracellular target, chromatin is hitherto unreported. Here we have characterized the biomolecular recognition between ELP and different hierarchical levels of chromatin. The significant result is that in addition to DNA, it binds to core histone(s) and can be categorized as a ‘dual binder’. As a sequel to binding with histone(s) and core octamer, it alters post-translational histone acetylation marks. We have further demonstrated that it has the potential to modulate gene expression thereby regulating several key biological processes such as nuclear organization, transcription, translation and histone modifications. - Highlights: • Ellipticine acts a dual binder binding to both DNA and core histone(s). • It induces structural perturbations in chromatin, chromatosome and histone octamer. • It alters histones acetylation and affects global gene expression.
Recognition of chromatin by the plant alkaloid, ellipticine as a dual binder
International Nuclear Information System (INIS)
Banerjee, Amrita; Sanyal, Sulagna; Majumder, Parijat; Chakraborty, Payal; Jana, Kuladip; Das, Chandrima; Dasgupta, Dipak
2015-01-01
Recognition of core histone components of chromatin along with chromosomal DNA by a class of small molecule modulators is worth examining to evaluate their intracellular mode of action. A plant alkaloid ellipticine (ELP) which is a putative anticancer agent has so far been reported to function via DNA intercalation, association with topoisomerase II and binding to telomere region. However, its effect upon the potential intracellular target, chromatin is hitherto unreported. Here we have characterized the biomolecular recognition between ELP and different hierarchical levels of chromatin. The significant result is that in addition to DNA, it binds to core histone(s) and can be categorized as a ‘dual binder’. As a sequel to binding with histone(s) and core octamer, it alters post-translational histone acetylation marks. We have further demonstrated that it has the potential to modulate gene expression thereby regulating several key biological processes such as nuclear organization, transcription, translation and histone modifications. - Highlights: • Ellipticine acts a dual binder binding to both DNA and core histone(s). • It induces structural perturbations in chromatin, chromatosome and histone octamer. • It alters histones acetylation and affects global gene expression
A Superconducting Dual-Channel Photonic Switch.
Srivastava, Yogesh Kumar; Manjappa, Manukumara; Cong, Longqing; Krishnamoorthy, Harish N S; Savinov, Vassili; Pitchappa, Prakash; Singh, Ranjan
2018-06-05
The mechanism of Cooper pair formation and its underlying physics has long occupied the investigation into high temperature (high-T c ) cuprate superconductors. One of the ways to unravel this is to observe the ultrafast response present in the charge carrier dynamics of a photoexcited specimen. This results in an interesting approach to exploit the dissipation-less dynamic features of superconductors to be utilized for designing high-performance active subwavelength photonic devices with extremely low-loss operation. Here, dual-channel, ultrafast, all-optical switching and modulation between the resistive and the superconducting quantum mechanical phase is experimentally demonstrated. The ultrafast phase switching is demonstrated via modulation of sharp Fano resonance of a high-T c yttrium barium copper oxide (YBCO) superconducting metamaterial device. Upon photoexcitation by femtosecond light pulses, the ultrasensitive cuprate superconductor undergoes dual dissociation-relaxation dynamics, with restoration of superconductivity within a cycle, and thereby establishes the existence of dual switching windows within a timescale of 80 ps. Pathways are explored to engineer the secondary dissociation channel which provides unprecedented control over the switching speed. Most importantly, the results envision new ways to accomplish low-loss, ultrafast, and ultrasensitive dual-channel switching applications that are inaccessible through conventional metallic and dielectric based metamaterials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Capacitance of circular patch resonator
International Nuclear Information System (INIS)
Miano, G.; Verolino, L.; Naples Univ.; Panariello, G.; Vaccaro, V.G.; Naples Univ.
1995-11-01
In this paper the capacitance of the circular microstrip patch resonator is computed. It is shown that the electrostatic problem can be formulated as a system of dual integral equations, and the most interesting techniques of solutions of these systems are reviewed. Some useful approximated formulas for the capacitance are derived and plots of the capacitance are finally given in a wide range of dielectric constants
High Selectivity Dual-Band Bandpass Filter with Tunable Lower Passband
Directory of Open Access Journals (Sweden)
Wei-Qiang Pan
2015-01-01
Full Text Available This paper presents a novel method to design dual-band bandpass filters with tunable lower passband and fixed upper passband. It utilizes a trimode resonator with three controllable resonant modes. Discriminating coupling is used to suppress the unwanted mode to avoid the interference. Varactors are utilized to realize tunable responses. The bandwidth of the two bands can be controlled individually. Transmission zeros are generated near the passband edges, resulting in high selectivity. For demonstration, a tunable bandpass filter is implemented. Good agreement between the prediction and measurement validates the proposed method.
Design comparisons of TRU burner cores with similar sodium void worth
International Nuclear Information System (INIS)
Sang Ji, Kim; Young Il, Kim; Young Jin, Kim; Nam Zin, Cho
2001-01-01
This study summarizes the neutronic performance and fuel cycle behavior of five geometrically-different transuranic (TRU) burner cores with similar low sodium void reactivity. The conceptual cores encompass core geometries for annular, two-region homogeneous, dual pin type, pan-shaped and H-shaped cores. They have been designed with the same assembly specifications and managed to have similar end-of-cycle sodium void reactivities and beginning-of-cycle peak power densities through the changes in the core size and configuration. The requirement of low sodium void reactivity is shown to lead each design concept to characteristic neutronics performance and fuel cycle behavior. The H-/pan-shaped cores allow the core compaction as well as higher rate of TRU burning. (author)
Wei, Kuo-Chen; Lin, Feng-Wei; Huang, Chiung-Yin; Ma, Chen-Chi M; Chen, Ju-Yu; Feng, Li-Ying; Yang, Hung-Wei
To date, knowing how to identify the location of chemotherapeutic agents in the human body after injection is still a challenge. Therefore, it is urgent to develop a drug delivery system with molecular imaging tracking ability to accurately understand the distribution, location, and concentration of a drug in living organisms. In this study, we developed bovine serum albumin (BSA)-based nanoparticles (NPs) with dual magnetic resonance (MR) and fluorescence imaging modalities (fluorescein isothiocyanate [FITC]-BSA-Gd/1,3-bis(2-chloroethyl)-1-nitrosourea [BCNU] NPs) to deliver BCNU for inhibition of brain tumor cells (MBR 261-2). These BSA-based NPs are water dispersible, stable, and biocompatible as confirmed by XTT cell viability assay. In vitro phantoms and in vivo MR and fluorescence imaging experiments show that the developed FITC-BSA-Gd/BCNU NPs enable dual MR and fluorescence imaging for monitoring cellular uptake and distribution in tumors. The T1 relaxivity (R1) of FITC-BSA-Gd/BCNU NPs was 3.25 mM(-1) s(-1), which was similar to that of the commercial T1 contrast agent (R1 =3.36 mM(-1) s(-1)). The results indicate that this multifunctional drug delivery system has potential bioimaging tracking of chemotherapeutic agents ability in vitro and in vivo for cancer therapy.
Vacuum transitions in dual models
International Nuclear Information System (INIS)
Pashnev, A.I.; Volkov, D.V.; Zheltukhin, A.A.
1976-01-01
The investigation is continued of the spontaneous vacuum transition problem in the Neview-Schwartz dual model (NSDM). It is shown that vacuum transitions allow disclosing of supplementary degeneration in the resonance state spectrum. The dual amplitudes possess an internal structure corresponding to the presence of an infinite number of quarks with increasing masses and retained charges. The Adler principle holds. Analytic continuation on the constant of induced vacuum transitions makes it possible to establish the existence of spontaneous vacuum transitions in the NSDM. The consequence of this fact is the exact SU(2) symmetry of π, rho meson trajectories and the Higgs mechanism in the model. In this case the ratios of masses of particles leading trajectories are analogous to those obtained in the current algebra. It is shown that in the NSDM there arises chiral SU(2) x SU(2) x U(1) x U(1) x ... symmetry resulting from spontaneous vacuum transitions
Core rotational dynamics and geological events
Greff-Lefftz; Legros
1999-11-26
A study of Earth's fluid core oscillations induced by lunar-solar tidal forces, together with tidal secular deceleration of Earth's axial rotation, shows that the rotational eigenfrequency of the fluid core and some solar tidal waves were in resonance around 3.0 x 10(9), 1.8 x 10(9), and 3 x 10(8) years ago. The associated viscomagnetic frictional power at the core boundaries may be converted into heat and would destabilize the D" thermal layer, leading to the generation of deep-mantle plumes, and would also increase the temperature at the fluid core boundaries, perturbing the core dynamo process. Such phenomena could account for large-scale episodes of continental crust formation, the generation of flood basalts, and abrupt changes in geomagnetic reversal frequency.
Liu, Yingchao; Chen, Hailiang; Ma, Mingjian; Zhang, Wenxun; Wang, Yujun; Li, Shuguang
2018-03-01
We propose a tunable ultra-broadband polarization filter based on three-core resonance of the fluid-infiltrated and gold-coated high birefringent photonic crystal fiber (HB-PCF). Gold film was applied to the inner walls of two cladding air holes and surface plasmon polaritons were generated on its surface. The two gold-coated cladding air holes acted as two defective cores. As the phase matching condition was satisfied, light transmitted in the fiber core and coupled to the two defective cores. The three-core PCF supported three super modes in two orthogonal polarization directions. The coupling characteristics among these modes were investigated using the finite-element method. We found that the coupling wavelengths and strength between these guided modes can be tuned by altering the structural parameters of the designed HB-PCF, such as the size of the voids, thickness of the gold-films and liquid infilling pattern. Under the optimized structural parameters, a tunable broadband polarization filter was realized. For one liquid infilling pattern, we obtained a broadband polarization filter which filtered out the light in y-polarization direction at the wavelength of 1550 nm. For another liquid infilling pattern, we filtered out light in the x-polarization direction at the wavelength of 1310 nm. Our studies on the designed HB-PCF made contributions to the further devising of tunable broadband polarization filters, which are extensively used in telecommunication and sensor systems. Project supported by the National Natural Science Foundation of China (Grant Nos. 61505175 and 61475134) and the Natural Science Foundation of Hebei Province (Grant Nos. F2017203110 and F2017203193).
Directory of Open Access Journals (Sweden)
Zhang Y
2013-12-01
Full Text Available Yue Zhang,1 Bin Zhang,1 Fei Liu,1,2 Jianwen Luo,1,3 Jing Bai1 1Department of Biomedical Engineering, School of Medicine, 2Tsinghua-Peking Center for Life Sciences, 3Center for Biomedical Imaging Research, Tsinghua University, Beijing, People's Republic of China Abstract: Dual-modality imaging combines the complementary advantages of different modalities, and offers the prospect of improved preclinical research. The combination of fluorescence imaging and magnetic resonance imaging (MRI provides cross-validated information and direct comparison between these modalities. Here, we report on the application of a novel tumor-targeted, dual-labeled nanoparticle (NP, utilizing iron oxide as the MRI contrast agent and near infrared (NIR dye Cy5.5 as the fluorescent agent. Results of in vitro experiments verified the specificity of the NP to tumor cells. In vivo tumor targeting and uptake of the NPs in a mouse model were visualized by fluorescence and MR imaging collected at different time points. Quantitative analysis was carried out to evaluate the efficacy of MRI contrast enhancement. Furthermore, tomographic images were also acquired using both imaging modalities and cross-validated information of tumor location and size between these two modalities was revealed. The results demonstrate that the use of dual-labeled NPs can facilitate the dual-modal detection of tumors, information cross-validation, and direct comparison by combing fluorescence molecular tomography (FMT and MRI. Keywords: dual-modality, fluorescence molecular tomography (FMT, magnetic resonance imaging (MRI, nanoparticle
2012-01-01
Background Real-time cardiovascular magnetic resonance (rtCMR) is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI) using the nitinol-based Medtronic CoreValve bioprosthesis. Methods rtCMR-guided transfemoral (n = 2) and transsubclavian (n = 6) TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. Results rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Conclusions Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media. PMID:22453050
Kahlert, Philipp; Parohl, Nina; Albert, Juliane; Schäfer, Lena; Reinhardt, Renate; Kaiser, Gernot M; McDougall, Ian; Decker, Brad; Plicht, Björn; Erbel, Raimund; Eggebrecht, Holger; Ladd, Mark E; Quick, Harald H
2012-03-27
Real-time cardiovascular magnetic resonance (rtCMR) is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI) using the nitinol-based Medtronic CoreValve bioprosthesis. rtCMR-guided transfemoral (n = 2) and transsubclavian (n = 6) TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media.
Directory of Open Access Journals (Sweden)
Kahlert Philipp
2012-03-01
Full Text Available Abstract Background Real-time cardiovascular magnetic resonance (rtCMR is considered attractive for guiding TAVI. Owing to an unlimited scan plane orientation and an unsurpassed soft-tissue contrast with simultaneous device visualization, rtCMR is presumed to allow safe device navigation and to offer optimal orientation for precise axial positioning. We sought to evaluate the preclinical feasibility of rtCMR-guided transarterial aortic valve implatation (TAVI using the nitinol-based Medtronic CoreValve bioprosthesis. Methods rtCMR-guided transfemoral (n = 2 and transsubclavian (n = 6 TAVI was performed in 8 swine using the original CoreValve prosthesis and a modified, CMR-compatible delivery catheter without ferromagnetic components. Results rtCMR using TrueFISP sequences provided reliable imaging guidance during TAVI, which was successful in 6 swine. One transfemoral attempt failed due to unsuccessful aortic arch passage and one pericardial tamponade with subsequent death occurred as a result of ventricular perforation by the device tip due to an operating error, this complication being detected without delay by rtCMR. rtCMR allowed for a detailed, simultaneous visualization of the delivery system with the mounted stent-valve and the surrounding anatomy, resulting in improved visualization during navigation through the vasculature, passage of the aortic valve, and during placement and deployment of the stent-valve. Post-interventional success could be confirmed using ECG-triggered time-resolved cine-TrueFISP and flow-sensitive phase-contrast sequences. Intended valve position was confirmed by ex-vivo histology. Conclusions Our study shows that rtCMR-guided TAVI using the commercial CoreValve prosthesis in conjunction with a modified delivery system is feasible in swine, allowing improved procedural guidance including immediate detection of complications and direct functional assessment with reduction of radiation and omission of contrast media.
International Nuclear Information System (INIS)
Moreno-Bote, Ruben; Parga, Nestor
2006-01-01
An analytical description of the response properties of simple but realistic neuron models in the presence of noise is still lacking. We determine completely up to the second order the firing statistics of a single and a pair of leaky integrate-and-fire neurons receiving some common slowly filtered white noise. In particular, the auto- and cross-correlation functions of the output spike trains of pairs of cells are obtained from an improvement of the adiabatic approximation introduced previously by Moreno-Bote and Parga [Phys. Rev. Lett. 92, 028102 (2004)]. These two functions define the firing variability and firing synchronization between neurons, and are of much importance for understanding neuron communication
Nonlinear Resonance Benchmarking Experiment at the CERN Proton Synchrotron
Hofmann, I; Giovannozzi, Massimo; Martini, M; Métral, Elias
2003-01-01
As a first step of a space charge - nonlinear resonance benchmarking experiment over a large number of turns, beam loss and emittance evolution were measured over 1 s on a 1.4 GeV kinetic energy flat-bottom in the presence of a single octupole. By lowering the working point towards the resonance a gradual transition from a loss-free core emittance blow-up to a regime dominated by continuous loss was found. Our 3D simulations with analytical space charge show that trapping on the resonance due to synchrotron oscillation causes the observed core emittance growth as well as halo formation, where the latter is explained as the source of the observed loss.
Song, Xinyue; Yue, Zihong; Zhang, Jiayu; Jiang, Yanxialei; Wang, Zonghua; Zhang, Shusheng
2018-04-25
Intracellular [Ca 2+ ] i and pH i have a close relationship, and their abnormal levels can result in cell dysfunction and accompanying diseases. Thus, simultaneous determination of [Ca 2+ ] i and pH i can more accurately investigate complex biological processes in an integrated platform. Herein, multicolor upconversion nanoparticles (UCNPs) were prepared with the advantages of no spectral overlapping, single NIR excitation wavelengths, and greater tissue penetration depth. The upconversion nanoprobes were easily prepared by the attachment of two fluorescent dyes, Fluo-4 and SNARF-4F. Based on the dual luminescence resonance energy transfer (LRET) process, the blue and green fluorescence of the UCNPs were specially quenched and selectively recovered after the detachment and/or absorbance change of the attached fluorescent dyes, enabling dual detection. Importantly, the developed nanoprobe could successfully be applied for the detection of [Ca 2+ ] i and pH i change in adenosine triphosphate (ATP) and ethylene glycol tetraacetic acid (EGTA) stimulation in living cells. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Vera-Otarola, Jorge; Solis, Loretto; Soto-Rifo, Ricardo; Ricci, Emiliano P; Pino, Karla; Tischler, Nicole D; Ohlmann, Théophile; Darlix, Jean-Luc; López-Lastra, Marcelo
2012-02-01
The small mRNA (SmRNA) of all Bunyaviridae encodes the nucleocapsid (N) protein. In 4 out of 5 genera in the Bunyaviridae, the smRNA encodes an additional nonstructural protein denominated NSs. In this study, we show that Andes hantavirus (ANDV) SmRNA encodes an NSs protein. Data show that the NSs protein is expressed in the context of an ANDV infection. Additionally, our results suggest that translation initiation from the NSs initiation codon is mediated by ribosomal subunits that have bypassed the upstream N protein initiation codon through a leaky scanning mechanism.
Dual Band Parasitic Element Patch Antenna for LTE/WLAN Applications
Directory of Open Access Journals (Sweden)
BAG Biplab
2017-05-01
Full Text Available In this paper, a single layer coaxial fed dual band slotted microstrip antenna is proposed. The proposed antenna consists of two direct couple parasitic elements and L-shape slots on the main resonating element. Two resonant modes are excited and it covers 4G LTE and WLAN middle band. The -10dB impedance bandwidth for resonant frequency of 2.35GHz and 5.28GHz are 140MHz (2.25-2.39GHz and 570MHz (5.18-5.75GHz, respectively. The measured VSWR at 2.35GHz is 1.27 and at 5.28GHz is 1.41. The proposed antenna is simple in design and compact in size. The simulated and measured results are in good agreement.
Furukawa, K.; Nio, T.; Oki, R.; Kubota, T.; Iguchi, T.
2017-09-01
The Dual-frequency Precipitation Radar (DPR) on the Global Precipitation Measurement (GPM) core satellite was developed by Japan Aerospace Exploration Agency (JAXA) and National Institute of Information and Communications Technology (NICT). The objective of the GPM mission is to observe global precipitation more frequently and accurately. The GPM core satellite is a joint product of National Aeronautics and Space Administration (NASA), JAXA and NICT. NASA developed the satellite bus and the GPM Microwave Imager (GMI), and JAXA and NICT developed the DPR. The inclination of the GPM core satellite is 65 degrees, and the nominal flight altitude is 407 km. The non-sunsynchronous circular orbit is necessary for measuring the diurnal change of rainfall. The DPR consists of two radars, which are Ku-band precipitation radar (KuPR) and Ka-band precipitation radar (KaPR). GPM core observatory was successfully launched by H2A launch vehicle on Feb. 28, 2014. DPR orbital check out was completed in May 2014. DPR products were released to the public on Sep. 2, 2014 and Normal Observation Operation period was started. JAXA is continuing DPR trend monitoring, calibration and validation operations to confirm that DPR keeps its function and performance on orbit. The results of DPR trend monitoring, calibration and validation show that DPR kept its function and performance on orbit during the 3 years and 2 months prime mission period. The DPR Prime mission period was completed in May 2017. The version 5 GPM products were released to the public in 2017. JAXA confirmed that GPM/DPR total system performance and the GPM version 5 products achieved the success criteria and the performance indicators that were defined for the JAXA GPM/DPR mission.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 10. What Can the Answer be? Reciprocal Basis and Dual Vectors. V Balakrishnan. Series Article Volume 1 Issue 10 October 1996 pp 6-13. Fulltext. Click here to view fulltext PDF. Permanent link:
Carrascosa, Patricia; Deviggiano, Alejandro; Rodriguez-Granillo, Gastón
2017-06-01
Conventional single energy CT suffers from technical limitations related to the polychromatic nature of X-rays. Dual energy cardiac CT (DECT) shows promise to attenuate and even overcome some of these limitations, and might broaden the scope of patients eligible for cardiac CT towards the inclusion of higher risk patients. This might be achieved as a result of both safety (contrast reduction) and physiopathological (myocardial perfusion and characterization) issues. In this article, we will review the main clinical cardiac applications of DECT, that can be summarized in two core aspects: coronary artery evaluation, and myocardial evaluation.
Passive Resonant Bidirectional Converter with Galvanic Barrier
Rosenblad, Nathan S. (Inventor)
2014-01-01
A passive resonant bidirectional converter system that transports energy across a galvanic barrier includes a converter using at least first and second converter sections, each section including a pair of transfer terminals, a center tapped winding; a chopper circuit interconnected between the center tapped winding and one of the transfer terminals; an inductance feed winding interconnected between the other of the transfer terminals and the center tap and a resonant tank circuit including at least the inductance of the center tap winding and the parasitic capacitance of the chopper circuit for operating the converter section at resonance; the center tapped windings of the first and second converter sections being disposed on a first common winding core and the inductance feed windings of the first and second converter sections being disposed on a second common winding core for automatically synchronizing the resonant oscillation of the first and second converter sections and transferring energy between the converter sections until the voltage across the pairs of transfer terminals achieves the turns ratio of the center tapped windings.
Dual-energy contrast-enhanced spectral mammography (CESM).
Daniaux, Martin; De Zordo, Tobias; Santner, Wolfram; Amort, Birgit; Koppelstätter, Florian; Jaschke, Werner; Dromain, Clarisse; Oberaigner, Willi; Hubalek, Michael; Marth, Christian
2015-10-01
Dual-energy contrast-enhanced mammography is one of the latest developments in breast care. Imaging with contrast agents in breast cancer was already known from previous magnetic resonance imaging and computed tomography studies. However, high costs, limited availability-or high radiation dose-led to the development of contrast-enhanced spectral mammography (CESM). We reviewed the current literature, present our experience, discuss the advantages and drawbacks of CESM and look at the future of this innovative technique.
El-Naggar, Mehrez E; Shaheen, Tharwat I; Fouda, Moustafa M G; Hebeish, Ali A
2016-01-20
Herein, we present a new approach for the synthesis of gold nanoparticles (AuNPs) individually and as bimetallic core-shell nanoparticles (AgNPs-AuNPs). The novelty of the approach is further maximized by using curdlan (CRD) biopolymer to perform the dual role of reducing and capping agents and microwave-aided technology for affecting the said nanoparticles with varying concentrations in addition to those affected by precursor concentrations. Thus, for preparation of AuNPs, curdlan was solubilized in alkali solution followed by an addition of tetrachloroauric acid (HAuCl4). The curdlan solution containing HAuCl4 was then subjected to microwave radiation for up to 10 min. The optimum conditions obtained with the synthesis of AuNPs were employed for preparation of core-shell silver-gold nanoparticles by replacing definite portion of HAuCl4 with an equivalent portion of silver nitrate (AgNO3). The portion of AgNO3 was added initially and allowed to be reduced by virtue of the dual role of curdlan under microwave radiation. The corresponding portion of HAuCl4 was then added and allowed to complete the reaction. Characterization of AuNPs and AgNPs-AuNPs core-shell were made using UV-vis spectra, TEM, FTIR, XRD, zeta potential, and AFM analysis. Accordingly, strong peaks of the colloidal particles show surface plasmon resonance (SPR) at maximum wavelength of 540 nm, proving the formation of well-stabilized gold nanoparticles. TEM investigations reveal that the major size of AuNPs formed at different Au(+3)concentration lie below 20 nm with narrow size distribution. Whilst, the SPR bands of AgNPs-AuNPs core-shell differ than those obtained from original AgNPs (420 nm) and AuNPs (540 nm). Such shifting due to SPR of Au nanoshell deposited onto AgNPs core was significantly affected by the variation of bimetallic ratios applied. TEM micrographs show variation in contrast between dark silver core and the lighter gold shell. Increasing the ratio of silver ions leads to
Millan, Mark J
2009-01-01
The past decade of efforts to find improved treatment for major depression has been dominated by genome-driven programs of rational drug discovery directed toward highly selective ligands for nonmonoaminergic agents. Selective drugs may prove beneficial for specific symptoms, for certain patient subpopulations, or both. However, network analyses of the brain and its dysfunction suggest that agents with multiple and complementary modes of action are more likely to show broad-based efficacy against core and comorbid symptoms of depression. Strategies for improved multitarget exploitation of monoaminergic mechanisms include triple inhibitors of dopamine, serotonin (5-HT) and noradrenaline reuptake, and drugs interfering with feedback actions of monoamines at inhibitory 5-HT(1A), 5-HT(1B) and possibly 5-HT(5A) and 5-HT(7) receptors. Specific subsets of postsynaptic 5-HT receptors mediating antidepressant actions are under study (e.g., 5-HT(4) and 5-HT(6)). Association of a clinically characterized antidepressant mechanism with a nonmonoaminergic component of activity is an attractive strategy. For example, agomelatine (a melatonin agonist/5-HT(2C) antagonist) has clinically proven activity in major depression. Dual neurokinin(1) antagonists/5-HT reuptake inhibitors (SRIs) and melanocortin(4) antagonists/SRIs should display advantages over their selective counterparts, and histamine H(3) antagonists/SRIs, GABA(B) antagonists/SRIs, glutamatergic/SRIs, and cholinergic agents/SRIs may counter the compromised cognitive function of depression. Finally, drugs that suppress 5-HT reuptake and blunt hypothalamo-pituitary-adrenocorticotrophic axis overdrive, or that act at intracellular proteins such as GSK-3beta, may abrogate the negative effects of chronic stress on mood and neuronal integrity. This review discusses the discovery and development of dual- and triple-acting antidepressants, focusing on novel concepts and new drugs disclosed over the last 2 to 3 years.
Hu, M; Sheng, J; Kang, Z; Zou, L; Guo, J; Sun, P
2014-08-01
The aim of this study was to examine the relation between bone marrow adipose tissue (BMAT) and bone mineral density (BMD) of lumbar spine in male professional wrestlers and healthy untrained men. A total of 14 wrestlers (22.9±3.4 years) and 11 controls (24.4±1.6 years) were studied cross-sectionally. Body composition and BMD were measured by dual-energy X-ray absorptiometry. Magnetic resonance imaging of the lumbar spine was examined in a sagittal T1-weighted (T1-w) spin-echo (SE) sequence. The averaged bone marrow signal intensity (SI) of L2-L4 was related to the signal of an adjacent nondegenerative disk. Mean SI of T1-w SE in wrestlers was lower than controls (P=0.001), indicating L2-L4 BMAT in wrestlers was lower compared to controls. L2-L4 BMD in wrestlers was higher than controls (PBMAT and BMD was confirmed in this relatively small subject sample with narrow age range, which implies that exercise training is an important determinant of this association.
Dual-anticipating, dual and dual-lag synchronization in modulated time-delayed systems
International Nuclear Information System (INIS)
Ghosh, Dibakar; Chowdhury, A. Roy
2010-01-01
In this Letter, dual synchronization in modulated time delay system using delay feedback controller is proposed. Based on Lyapunov stability theory, we suggest a general method to achieve the dual-anticipating, dual, dual-lag synchronization of time-delayed chaotic systems and we find both its existing and sufficient stability conditions. Numerically it is shown that the dual synchronization is also possible when driving system contain two completely different systems. Effect of parameter mismatch on dual synchronization is also discussed. As an example, numerical simulations for the Mackey-Glass and Ikeda systems are conducted, which is in good agreement with the theoretical analysis.
New method to evaluate optical properties of core-shell nanostructures
Energy Technology Data Exchange (ETDEWEB)
Renteria-Tapia, V. [Universidad de Guadalajara, Ameca, Departamento de Ciencias Naturales y Exactas, Centro Universitario de Los Valles (Mexico); Franco, A., E-mail: alfredofranco@fisica.unam.mx; Garcia-Macedo, J. [Universidad Nacional Autonoma de Mexico, Departamento de Estado Solido, Instituto de Fisica (Mexico)
2012-06-15
A new method is presented to calculate, for metallic core-dielectric shell nanostructures, the local refractive index, resonance condition, maximum spectral shift, plasma wavelength, and the sensitivity of the wavelength maximum to variations in the refractive index of the environment. The equations that describe these properties are directly related to the surface plasmon peak position, refractive index of the shell, and to the surrounding medium. The method is based on the approach that a layered core dispersed in a dielectric environment (core-shell model) can be figured out as an uncoated sphere dispersed in a medium with a local refractive index (local refractive index model). Thus, in the Mie theory, the same spectral position of the surface plasmon resonance peak can be obtained by varying the volume fraction of the shell or by varying the local refractive index. The assumed equivalence between plasmon resonance wavelengths enable us to show that the local refractive index depends geometrically on the shell volume fraction. Hence, simple relationships between optical and geometrical properties of these core-shell nanostructures are obtained. Furthermore, good agreement is observed between the new relationships and experimental data corresponding to gold nanoparticles (radius = 7.5 nm) covered with silica shells (with thicknesses up to 29.19 nm), which insured that the equivalence hypothesis is correct.
Thermo-Optic Characterization of Silicon Nitride Resonators for Cryogenic Photonic Circuits
Elshaari, A.W.A.; Esmaeil Zadeh, I.; Jöns, K.D.; Zwiller, Val
2016-01-01
In this paper, we characterize the Thermo-optic properties of silicon nitride ring resonators between 18 and 300 K. The Thermo-optic coefficients of the silicon nitride core and the oxide cladding are measured by studying the temperature dependence of the resonance wavelengths. The resonant modes
Design of data transportation based on dual-port RAM in IMS system
International Nuclear Information System (INIS)
Zhang Guohui; Li Yongping
2010-01-01
Ion mobility spectroscopy (IMS) is a rugged, portable, sensitive, low cost, field instrumental technique capable of trace organic detection and monitoring for environmental pollutants, pesticides, explosives, narcotics, and other analytes, hence it is of great significance to social security and stability. High rate data transmission mechanism between DSP processor and ARM core is required in the electronic system of IMS. After careful comparison of UART and dual port RAM, a new design based on dual port RAM that can be applied to other similar systems. (authors)
Increased fluorescence of PbS quantum dots in photonic crystals by excitation enhancement
Barth, Carlo; Roder, Sebastian; Brodoceanu, Daniel; Kraus, Tobias; Hammerschmidt, Martin; Burger, Sven; Becker, Christiane
2017-07-01
We report on the enhanced fluorescence of lead sulfide quantum dots interacting with leaky modes of slab-type silicon photonic crystals. The photonic crystal slabs were fabricated, supporting leaky modes in the near infrared wavelength range. Lead sulfite quantum dots which are resonant in the same spectral range were prepared in a thin layer above the slab. We selectively excited the leaky modes by tuning the wavelength and angle of incidence of the laser source and measured distinct resonances of enhanced fluorescence. By an appropriate experiment design, we ruled out directional light extraction effects and determined the impact of enhanced excitation. Three-dimensional numerical simulations consistently explain the experimental findings by strong near-field enhancements in the vicinity of the photonic crystal surface. Our study provides a basis for systematic tailoring of photonic crystals used in biological applications such as biosensing and single molecule detection, as well as quantum dot solar cells and spectral conversion applications.
In-core assembly configuration having a dual-wall pressure boundary for nuclear reactor
International Nuclear Information System (INIS)
Todt, W.H. Sr.; Playfoot, K.C.
1988-01-01
This patent describes an in-core detector assembly of the type having an in-core part and an out-of-core part and having an elongated outer hollow housing tube with a wall thickness, an inner hollow calibration tube with a wall thickness and disposed concentrically within the outer tube to define an annular space therewith, and a plurality of discrete, circular, rod-like elements extending through the annular space, the improvement comprising: the elements having outer diameters and being of a number to substantially occupy the entire annular space of both the incore and out-of-core parts without significant voids between elements; each of the elements including at least an outer sheath and interior highly compacted mineral insulation for the entire length of the element; a first number of the elements also including center lead means connected to condition responsive element means in the in-core part of the length of the assembly and a second, remaining number of the elements being non-operating elements. The wall thickness of the housing tube and the wall thickness of the calibration tube, taken together with the diameter of the elements, provide a thickness dimension adequate to meet code primary pressure requirements for normal nuclear reactor in-core conditions, while the wall thickness of the calibration tube alone provides a thickness dimension less than adequate to meet such requirements
Femtosecond optical parametric oscillators toward real-time dual-comb spectroscopy
Jin, Yuwei; Cristescu, Simona M.; Harren, Frans J. M.; Mandon, Julien
2015-04-01
We demonstrate mid-infrared dual-comb spectroscopy with an optical parametric oscillator (OPO) toward real-time field measurement. A singly resonant OPO based on a MgO-doped periodically poled lithium niobate (PPLN) crystal is demonstrated. Chirped mirrors are used to compensate the dispersion caused by the optical cavity and the crystal. A low threshold of 17 mW has been achieved. The OPO source generates a tunable idler frequency comb between 2.7 and 4.7 μm. Dual-comb spectroscopy is achieved by coupling two identical Yb-fiber mode-locked lasers to this OPO with slightly different repetition frequencies. A measured absorption spectrum of methane is presented with a spectral bandwidth of , giving an instrumental resolution of . In addition, a second OPO containing two MgO-doped PPLN crystals in a singly resonant ring cavity is demonstrated. As such, this OPO generates two idler combs (average power up to 220 mW), covering a wavelength range between 2.7 and 4.2 μm, from which a mid-infrared dual-comb Fourier transform spectrometer is constructed. By detecting the heterodyned signal between the two idler combs, broadband spectra of molecular gases can be observed over a spectral bandwidth of more than . This special cavity design allows the spectral resolution to be improved to without locking the OPO cavity, indicating that this OPO represents an ideal high-power broadband mid-infrared source for real-time gas sensing.
Iizuka, Shunsuke; Sakurai, Fuminori; Tachibana, Masashi; Ohashi, Kazuo; Mizuguchi, Hiroyuki
2017-09-15
Gene therapy during neonatal and infant stages is a promising approach for hemophilia B, a congenital disorder caused by deficiency of blood coagulation factor IX (FIX). An adenovirus (Ad) vector has high potential for use in neonatal or infant gene therapy for hemophilia B due to its superior transduction properties; however, leaky expression of Ad genes often reduces the transduction efficiencies by Ad protein-mediated tissue damage. Here, we used a novel Ad vector, Ad-E4-122aT, which exhibits a reduction in the leaky expression of Ad genes in liver, in gene therapy studies for neonatal hemophilia B mice. Ad-E4-122aT exhibited significantly higher transduction efficiencies than a conventional Ad vector in neonatal mice. In neonatal hemophilia B mice, a single neonatal injection of Ad-E4-122aT expressing human FIX (hFIX) (Ad-E4-122aT-AHAFIX) maintained more than 6% of the normal plasma hFIX activity levels for approximately 100 days. Sequential administration of Ad-E4-122aT-AHAFIX resulted in more than 100% of the plasma hFIX activity levels for more than 100 days and rescued the bleeding phenotypes of hemophilia B mice. In addition, immunotolerance to hFIX was induced by Ad-E4-122aT-AHAFIX administration in neonatal hemophilia B mice. These results indicated that Ad-E4-122aT is a promising gene delivery vector for neonatal or infant gene therapy for hemophilia B.
International Nuclear Information System (INIS)
Kubaska, Samantha; Sahani, Dushyant V.; Saini, Sanjay; Hahn, Peter F.; Halpern, Elkan
2001-01-01
AIM: Iron oxide contrast agents are useful for lesion detection, and extracellular gadolinium chelates are advocated for lesion characterization. We undertook a study to determine if dual contrast enhanced liver imaging with sequential use of ferumoxides particles and gadolinium (Gd)-DTPA can be performed in the same imaging protocol. MATERIALS AND METHODS: Sixteen patients underwent dual contrast magnetic resonance imaging (MRI) of the liver for evaluation of known/suspected focal lesions which included, metastases (n = 5), hepatocellular carcinoma (HCC;n = 3), cholangiocharcinoma(n = 1) and focal nodular hyperplasia (FNH;n = 3). Pre- and post-iron oxide T1-weighted gradient recalled echo (GRE) and T2-weighted fast spin echo (FSE) sequences were obtained, followed by post-Gd-DTPA (0.1 mmol/kg) multi-phase dynamic T1-weighted out-of-phase GRE imaging. Images were analysed in a blinded fashion by three experts using a three-point scoring system for lesion conspicuity on pre- and post-iron oxide T1 images as well as for reader's confidence in characterizing liver lesions on post Gd-DTPA T1 images. RESULTS: No statistically significant difference in lesion conspicuity was observed on pre- and post-iron oxide T1-GRE images in this small study cohort. The presence of iron oxide did not appreciably diminish image quality of post-gadolinium sequences and did not prevent characterization of liver lesions. CONCLUSION: Our results suggest that characterization of focal liver lesion with Gd-enhanced liver MRI is still possible following iron oxide enhanced imaging. Kubaska, S. et al. (2001)
EEL Calculations and Measurements of Graphite and Graphitic-CNx Core-Losses
International Nuclear Information System (INIS)
Seepujak, A; Bangert, U; Harvey, A J; Blank, V D; Kulnitskiy, B A; Batov, D V
2006-01-01
Core EEL spectra of MWCNTs (multi-wall carbon nanotubes) grown in a nitrogen atmosphere were acquired utilising a dedicated STEM equipped with a Gatan Enfina system. Splitting of the carbon K-edge π* resonance into two peaks provided evidence of two nondegenerate carbon bonding states. In order to confirm the presence of a CN x bonding state, a full-potential linearised augmented plane-wave method was utilised to simulate core EEL spectra of graphite and graphitic-CN x compounds. The simulations confirmed splitting of the carbon K-edge π* resonance in graphitic-CN x materials, with the pristine graphite π* resonance remaining unsplit. The simulations also confirmed the increasing degree of amorphicity with higher concentrations (25%) of substitutional nitrogen in graphite
THE REDUCTION OF VIBRATIONS IN A CAR – THE PRINCIPLE OF PNEUMATIC DUAL MASS FLYWHEEL
Directory of Open Access Journals (Sweden)
Robert GREGA
2014-09-01
Full Text Available The dual-mass flywheel replaces the classic flywheel in such way that it is divided into two masses (the primary mass and the secondary mass, which are jointed together by means of a flexible interconnection. This kind of the flywheel solution enables to change resonance areas of the engine with regard to the engine dynamic behaviour what leads to a reduction of vibrations consequently. However, there is also a disadvantage of the dualmass flywheels. The disadvantage is its short-time durability. There was projected a new type of the dual-mass flywheel in the framework of our workplace in order to eliminate disadvantages of the present dual-mass flywheels, i.e. we projected the pneumatic dual-mass flywheel, taking into consideration our experiences obtained during investigation of vibrations.
Radiation-Pressure Acceleration of Ion Beams from Nanofoil Targets: The Leaky Light-Sail Regime
International Nuclear Information System (INIS)
Qiao, B.; Zepf, M.; Borghesi, M.; Dromey, B.; Geissler, M.; Karmakar, A.; Gibbon, P.
2010-01-01
A new ion radiation-pressure acceleration regime, the 'leaky light sail', is proposed which uses sub-skin-depth nanometer foils irradiated by circularly polarized laser pulses. In the regime, the foil is partially transparent, continuously leaking electrons out along with the transmitted laser field. This feature can be exploited by a multispecies nanofoil configuration to stabilize the acceleration of the light ion component, supplementing the latter with an excess of electrons leaked from those associated with the heavy ions to avoid Coulomb explosion. It is shown by 2D particle-in-cell simulations that a monoenergetic proton beam with energy 18 MeV is produced by circularly polarized lasers at intensities of just 10 19 W/cm 2 . 100 MeV proton beams are obtained by increasing the intensities to 2x10 20 W/cm 2 .
Radiation-pressure acceleration of ion beams from nanofoil targets: the leaky light-sail regime.
Qiao, B; Zepf, M; Borghesi, M; Dromey, B; Geissler, M; Karmakar, A; Gibbon, P
2010-10-08
A new ion radiation-pressure acceleration regime, the "leaky light sail," is proposed which uses sub-skin-depth nanometer foils irradiated by circularly polarized laser pulses. In the regime, the foil is partially transparent, continuously leaking electrons out along with the transmitted laser field. This feature can be exploited by a multispecies nanofoil configuration to stabilize the acceleration of the light ion component, supplementing the latter with an excess of electrons leaked from those associated with the heavy ions to avoid Coulomb explosion. It is shown by 2D particle-in-cell simulations that a monoenergetic proton beam with energy 18 MeV is produced by circularly polarized lasers at intensities of just 10¹⁹ W/cm². 100 MeV proton beams are obtained by increasing the intensities to 2 × 10²⁰ W/cm².
Bridge, Pascale; Pocock, Nicholas A; Nguyen, Tuan; Munns, Craig; Cowell, Christopher T; Thompson, Martin W
2009-09-01
Body composition studies in children have great potential to help understand the aetiology and evolution of acute and chronic. diseases. To validate appendicular lean soft tissue mass (LSTM) and fat mass (FM) measured using dual energy X-ray absorptiometry (DXA), with magnetic resonance imaging (MRI) as the reference standard, in healthy peri-pubertal adolescents. Peri-pubertal Caucasian children (n = 74) aged 11-14 years were evaluated. DXA LSTM and FM of the mid third femur were measured and skeletal muscle mass (SM) and FM of the same region were measured on the same day by MRI. There was a strong correlation between MRI SM and DXA LSTM (r2 = 0.98, index of concordance [C] = 0.91). DXA estimation of LSTM exceeded MRI SM by a mean of 189 g, from 6-371 g (p LSTM measurement in children, confirming its potential in clinical and research roles in paediatric diseases affecting and related to body composition.
Electronic structure of molecules using relativistic effective core potentials
International Nuclear Information System (INIS)
Hay, P.J.
1983-01-01
In this review an approach is outlined for studying molecules containing heavy atoms with the use of relativistic effective core potentials (RECP's). These potentials play the dual roles of (1) replacing the chemically-inert core electrons and (2) incorporating the mass velocity and Darwin term into a one-electron effective potential. This reduces the problem to a valence-electron problem and avoids computation of additional matrix elements involving relativistic operators. The spin-orbit effects are subsequently included using the molecular orbitals derived from the RECP calculation as a basis
Dual Entwining Structures and Dual Entwined Modules
Abuhlail, Jawad Y.
2003-01-01
In this note we introduce and investigate the concepts of dual entwining structures and dual entwined modules. This generalizes the concepts of dual Doi-Koppinen structures and dual Doi-Koppinen modules introduced (in the infinite case over rings) by the author is his dissertation.
Research on Wireless Power Transfer System via Magnetically Coupled Resonance
Directory of Open Access Journals (Sweden)
ZHU Meng
2017-04-01
Full Text Available In order to extend the transmission distance and improve the transmission efficiency of the traditional wireless power transmission(WPTsystem composed with the transmitting and receiving coil resonators based on magnetic resonance coupling,we proposed an effective method to add a magnetic core between repeating coil and receiving coil based on the single repeating three coils mode. This paper deduced a mathematical expression of the transmission efficiency,and built a model by the circuit theory,and also simulated the transmission system added with the magnetic core between repeating and receiving coil. Then we selected the flat magnetic core for test. At last,we verified the feasibility of the proposal by actual experiment.
Rapidly reconfigurable slow-light system based on off-resonant Raman absorption
International Nuclear Information System (INIS)
Vudyasetu, Praveen K.; Howell, John C.; Camacho, Ryan M.
2010-01-01
We present a slow-light system based on dual Raman absorption resonances in warm rubidium vapor. Each Raman absorption resonance is produced by a control beam in an off-resonant Λ system. This system combines all optical control of the Raman absorption and the low-dispersion broadening properties of the double Lorentzian absorption slow light. The bandwidth, group delay, and central frequency of the slow-light system can all be tuned dynamically by changing the properties of the control beam. We demonstrate multiple pulse delays with low distortion and show that such a system has fast switching dynamics and thus fast reconfiguration rates.
A dual-band reconfigurable Yagi-Uda antenna with diverse radiation patterns
Saurav, Kushmanda; Sarkar, Debdeep; Srivastava, Kumar Vaibhav
2017-07-01
In this paper, a dual-band pattern reconfigurable antenna is proposed. The antenna comprises of a dual-band complementary split ring resonators (CSRRs) loaded dipole as the driven element and two copper strips with varying lengths as parasitic segments on both sides of the driven dipole. PIN diodes are used with the parasitic elements to control their electrical length. The CSRRs loading provide a lower order mode in addition to the reference dipole mode, while the parasitic elements along with the PIN diodes are capable of switching the omni-directional radiation of the dual-band driven element to nine different configurations of radiation patterns which include bi-directional end-fire, broadside, and uni-directional end-fire in both the operating bands. A prototype of the designed antenna together with the PIN diodes and DC bias lines is fabricated to validate the concept of dual-band radiation pattern diversity. The simulation and measurement results are in good agreement. The proposed antenna can be used in wireless access points for PCS and WLAN applications.
Nieuwland, Mante S.
2016-01-01
Abstract Cognitive and linguistic theories of counterfactual language comprehension assume that counterfactuals convey a dual meaning. Subjunctive‐counterfactual conditionals (e.g., ‘If Tom had studied hard, he would have passed the test’) express a supposition while implying the factual state of affairs (Tom has not studied hard and failed). The question of how counterfactual dual meaning plays out during language processing is currently gaining interest in psycholinguistics. Whereas numerous studies using offline measures of language processing consistently support counterfactual dual meaning, evidence coming from online studies is less conclusive. Here, we review the available studies that examine online counterfactual language comprehension through behavioural measurement (self‐paced reading times, eye‐tracking) and neuroimaging (electroencephalography, functional magnetic resonance imaging). While we argue that these studies do not offer direct evidence for the online computation of counterfactual dual meaning, they provide valuable information about the way counterfactual meaning unfolds in time and influences successive information processing. Further advances in research on counterfactual comprehension require more specific predictions about how counterfactual dual meaning impacts incremental sentence processing. PMID:27512408
Ryan, Colan Graeme Matthew
Focused on the quad-band generalized negative-refractive-index transmission line (G-NRI-TL), this thesis presents a variety of novel printed G-NRI-TL multi-band microwave device and antenna prototypes. A dual-band coupled-line coupler, an all-pass G-NRI-TL bridged-T circuit, a dual-band metamaterial leaky-wave antenna, and a multi-band G-NRI-TL resonant antenna are all new developments resulting from this research. In addition, to continue the theme of multi-band components, negative-refractive-index transmission lines are used to create a dual-band circularly polarized transparent patch antenna and a two-element wideband decoupled meander antenna system. High coupling over two independently-specified frequency bands is the hallmark of the G-NRI-TL coupler: it is 0.35lambda0 long but achieves approximately -3 dB coupling over both bands with a maximum insertion loss of 1 dB. This represents greater design flexibility than conventional coupled-line couplers and less loss than subsequent G-NRI-TL couplers. The single-ended bridged-T G-NRI-TL offers a metamaterial unit cell with an all-pass magnitude response up to 8 GHz, while still preserving the quad-band phase response of the original circuit. It is shown how the all-pass response leads to wider bandwidths and improved matching in quad-band inverters, power dividers, and hybrid couplers. The dual-band metamaterial leaky-wave antenna presented here was the first to be reported in the literature, and it allows broadside radiation at both 2 GHz and 6 GHz without experiencing the broadside stopband common to conventional periodic antennas. Likewise, the G-NRI-TL resonant antenna is the first reported instance of such a device, achieving quad-band operation between 2.5 GHz and 5.6 GHz, with a minimum radiation efficiency of 80%. Negative-refractive-index transmission line loading is applied to two devices: an NRI-TL meander antenna achieves a measured 52% impedance bandwidth, while a square patch antenna incorporates
Structural Characterization of Core Region in Erwinia amylovora Lipopolysaccharide
Directory of Open Access Journals (Sweden)
Angela Casillo
2017-03-01
Full Text Available Erwinia amylovora (E. amylovora is the first bacterial plant pathogen described and demonstrated to cause fire blight, a devastating plant disease affecting a wide range of species including a wide variety of Rosaceae. In this study, we reported the lipopolysaccharide (LPS core structure from E. amylovora strain CFBP1430, the first one for an E. amylovora highly pathogenic strain. The chemical characterization was performed on the mutants waaL (lacking only the O-antigen LPS with a complete LPS-core, wabH and wabG (outer-LPS core mutants. The LPSs were isolated from dry cells and analyzed by means of chemical and spectroscopic methods. In particular, they were subjected to a mild acid hydrolysis and/or a hydrazinolysis and investigated in detail by one and two dimensional Nuclear Magnetic Resonance (NMR spectroscopy and ElectroSpray Ionization Fourier Transform-Ion Cyclotron Resonance (ESI FT-ICR mass spectrometry.
Core-shell particle composition by liquid phase infrared spectroscopy
International Nuclear Information System (INIS)
Ribeiro, Luiz F.B.; Machado, Ricardo A.F.; Goncalves, Odinei H.; Bona, Evandro
2011-01-01
Polymeric particles with core-shell morphology can offer advantages over conventional particles improving properties like mechanical and chemical resistance. However, particle composition must be known due to its influence on the final properties. In this work liquid phase infrared spectroscopy was used to determine the overall composition of core-shell particles composed by polystyrene (core) and poly(methyl methacrylate) (shell). Results were in agreement with those obtained with H 1 Nuclear Magnetic Resonance data (Goncalves et al, 2008). (author)
PANITIWAT, Prapaporn; SALIMEE, Prarom
2017-01-01
Abstract Objective This study evaluated the fracture resistance of endodontically treated teeth restored with fiber reinforced composite posts, using three resin composite core build-up materials, (Clearfil Photo Core (CPC), MultiCore Flow (MCF), and LuxaCore Z-Dual (LCZ)), and a nanohybrid composite, (Tetric N-Ceram (TNC)). Material and Methods Forty endodontically treated lower first premolars were restored with quartz fiber posts (D.T. Light-Post) cemented with resin cement (Panavia F2...
Shape resonances in molecular fields
International Nuclear Information System (INIS)
Dehmer, J.L.
1984-01-01
A shape resonance is a quasibound state in which a particle is temporarily trapped by a potential barrier (i.e., the shape of the potential), through which it may eventually tunnel and escape. This simple mechanism plays a prominent role in a variety of excitation processes in molecules, ranging from vibrational excitation by slow electrons to ionization of deep core levels by x-rays. Moreover, their localized nature makes shape resonances a unifying link between otherwise dissimilar circumstances. One example is the close connection between shape resonances in electron-molecule scattering and in molecular photoionization. Another is the frequent persistence of free-molecule shape resonant behavior upon adsorption on a surface or condensation into a molecular solid. The main focus of this article is a discussion of the basic properties of shape resonances in molecular fields, illustrated by the more transparent examples studied over the last ten years. Other aspects to be discussed are vibrational effects of shape resonances, connections between shape resonances in different physical settings, and examples of shape resonant behavior in more complex cases, which form current challenges in this field
Chimeras in leaky integrate-and-fire neural networks: effects of reflecting connectivities
Tsigkri-DeSmedt, Nefeli Dimitra; Hizanidis, Johanne; Schöll, Eckehard; Hövel, Philipp; Provata, Astero
2017-07-01
The effects of attracting-nonlocal and reflecting connectivity are investigated in coupled Leaky Integrate-and-Fire (LIF) elements, which model the exchange of electrical signals between neurons. Earlier investigations have demonstrated that repulsive-nonlocal and hierarchical network connectivity can induce complex synchronization patterns and chimera states in systems of coupled oscillators. In the LIF system we show that if the elements are nonlocally linked with positive diffusive coupling on a ring network, the system splits into a number of alternating domains. Half of these domains contain elements whose potential stays near the threshold and they are interrupted by active domains where the elements perform regular LIF oscillations. The active domains travel along the ring with constant velocity, depending on the system parameters. When we introduce reflecting coupling in LIF networks unexpected complex spatio-temporal structures arise. For relatively extensive ranges of parameter values, the system splits into two coexisting domains: one where all elements stay near the threshold and one where incoherent states develop, characterized by multi-leveled mean phase velocity profiles.
Reconstructing stimuli from the spike-times of leaky integrate and fire neurons
Directory of Open Access Journals (Sweden)
Sebastian eGerwinn
2011-02-01
Full Text Available Reconstructing stimuli from the spike-trains of neurons is an important approach for understanding the neural code. One of the difficulties associated with this task is that signals which are varying continuously in time are encoded into sequences of discrete events or spikes. An important problem is to determine how much information about the continuously varying stimulus can be extracted from the time-points at which spikes were observed, especially if these time-points are subject to some sort of randomness. For the special case of spike trains generated by leaky integrate and fire neurons, noise can be introduced by allowing variations in the threshold every time a spike is released. A simple decoding algorithm previously derived for the noiseless case can be extended to the stochastic case, but turns out to be biased. Here, we review a solution to this problem, by presenting a simple yet efficient algorithm which greatly reduces the bias, and therefore leads to better decoding performance in the stochastic case.
Dual fuel gradients in uranium silicide plates
Energy Technology Data Exchange (ETDEWEB)
Pace, B.W. [Babock and Wilcox, Lynchburg, VA (United States)
1997-08-01
Babcock & Wilcox has been able to achieve dual gradient plates with good repeatability in small lots of U{sub 3}Si{sub 2} plates. Improvements in homogeneity and other processing parameters and techniques have allowed the development of contoured fuel within the cladding. The most difficult obstacles to overcome have been the ability to evaluate the bidirectional fuel loadings in comparison to the perfect loading model and the different methods of instilling the gradients in the early compact stage. The overriding conclusion is that to control the contour of the fuel, a known relationship between the compact, the frames and final core gradient must exist. Therefore, further development in the creation and control of dual gradients in fuel plates will involve arriving at a plausible gradient requirement and building the correct model between the compact configuration and the final contoured loading requirements.
Optimization of an integrated optic broadband duplexer for 0.8/1.3-micrometer applications
Ghibaudo, Elise; Broquin, Jean-Emmanuel; Benech, Pierre
2003-06-01
These last years, the growth of data traffic has increased the interest for broadband integrated optic devices. Their applications include, for example, the fiber communications on a single fiber by adding the transmission capacity of two optical telecommunication windows for Local Area Networks (LAN) and Wide Area Networks (WAN) or by combining pump and signal wavelenghts in rare earth doped intergrated optical amplifiers. A promising technology to realize those devices is ion-exchange on glass. Indeed, it allows the integration of different functions in a glass substrate with efficient results and a better compatibility in fiber systems with a low cost. We propose in this paper an original broadband duplexer based on a leaky structure. First, the physical principle of the component is explained. The core of the structure is a leaky zone which involves a non-resonant coupling and ensures a broadband spectral behavior to the component. Then, the broadband duplexer is presented and the focus is specially made on the improvement of the outputs crosstalk through the suppression of parasitical back reflections. Theoretical optimization and validation by simulations are presented. Finally, perspectives of this work are proposed.
Nonlinear Model of Tape Wound Core Transformers
Directory of Open Access Journals (Sweden)
A. Vahedi
2015-03-01
Full Text Available Recently, tape wound cores due to their excellent magnetic properties, are widely used in different types of transformers. Performance prediction of these transformers needs an accurate model with ability to determine flux distribution within the core and magnetic loss. Spiral structure of tape wound cores affects the flux distribution and always cause complication of analysis. In this paper, a model based on reluctance networks method is presented for analysis of magnetic flux in wound cores. Using this model, distribution of longitudinal and transverse fluxes within the core can be determined. To consider the nonlinearity of the core, a dynamic hysteresis model is included in the presented model. Having flux density in different points of the core, magnetic losses can be calculated. To evaluate the validity of the model, results are compared with 2-D FEM simulations. In addition, a transformer designed for series-resonant converter and simulation results are compared with experimental measurements. Comparisons show accuracy of the model besides simplicity and fast convergence
Dual-Tasking Alleviated Sleep Deprivation Disruption in Visuomotor Tracking: An fMRI Study
Gazes, Yunglin; Rakitin, Brian C.; Steffener, Jason; Habeck, Christian; Butterfield, Brady; Basner, Robert C.; Ghez, Claude; Stern, Yaakov
2012-01-01
Effects of dual-responding on tracking performance after 49-h of sleep deprivation (SD) were evaluated behaviorally and with functional magnetic resonance imaging (fMRI). Continuous visuomotor tracking was performed simultaneously with an intermittent color-matching visual detection task in which a pair of color-matched stimuli constituted a…
Zabelina, Darya L; O'Leary, Daniel; Pornpattananangkul, Narun; Nusslock, Robin; Beeman, Mark
2015-03-01
Creativity has previously been linked with atypical attention, but it is not clear what aspects of attention, or what types of creativity are associated. Here we investigated specific neural markers of a very early form of attention, namely sensory gating, indexed by the P50 ERP, and how it relates to two measures of creativity: divergent thinking and real-world creative achievement. Data from 84 participants revealed that divergent thinking (assessed with the Torrance Test of Creative Thinking) was associated with selective sensory gating, whereas real-world creative achievement was associated with "leaky" sensory gating, both in zero-order correlations and when controlling for academic test scores in a regression. Thus both creativity measures related to sensory gating, but in opposite directions. Additionally, divergent thinking and real-world creative achievement did not interact in predicting P50 sensory gating, suggesting that these two creativity measures orthogonally relate to P50 sensory gating. Finally, the ERP effect was specific to the P50 - neither divergent thinking nor creative achievement were related to later components, such as the N100 and P200. Overall results suggest that leaky sensory gating may help people integrate ideas that are outside of focus of attention, leading to creativity in the real world; whereas divergent thinking, measured by divergent thinking tests which emphasize numerous responses within a limited time, may require selective sensory processing more than previously thought. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Izumi, Kiwamu; Sigg, Daniel
2017-01-01
Length sensing and control is vital for Advanced LIGO and its goal of performing astrophysical searches. The current kilometer scale gravitational wave antennae are dual recycled Michelson interferometers enhanced with Fabry–Perot resonators in the arms. Observation requires the lengths of all optical cavities to be precisely servoed in the vicinity of a resonance using feedback controls. Simultaneously achieving robustness and low-noise is challenging due to cross-couplings between the multiple coupled optical resonators. We analytically derive the Advanced LIGO sensing and control scheme, calculate the effects of radiation pressure forces and review the current strategies of minimizing the coupling of noise into the gravitational wave readout. (paper)
Stabilization of self-mode-locked quantum dash lasers by symmetric dual-loop optical feedback
Asghar, Haroon; Wei, Wei; Kumar, Pramod; Sooudi, Ehsan; McInerney, John. G.
2018-02-01
We report experimental studies of the influence of symmetric dual-loop optical feedback on the RF linewidth and timing jitter of self-mode-locked two-section quantum dash lasers emitting at 1550 nm. Various feedback schemes were investigated and optimum levels determined for narrowest RF linewidth and low timing jitter, for single-loop and symmetric dual-loop feedback. Two symmetric dual-loop configurations, with balanced and unbalanced feedback ratios, were studied. We demonstrate that unbalanced symmetric dual loop feedback, with the inner cavity resonant and fine delay tuning of the outer loop, gives narrowest RF linewidth and reduced timing jitter over a wide range of delay, unlike single and balanced symmetric dual-loop configurations. This configuration with feedback lengths 80 and 140 m narrows the RF linewidth by 4-67x and 10-100x, respectively, across the widest delay range, compared to free-running. For symmetric dual-loop feedback, the influence of different power split ratios through the feedback loops was determined. Our results show that symmetric dual-loop feedback is markedly more effective than single-loop feedback in reducing RF linewidth and timing jitter, and is much less sensitive to delay phase, making this technique ideal for applications where robustness and alignment tolerance are essential.
Brain activations during bimodal dual tasks depend on the nature and combination of component tasks
Directory of Open Access Journals (Sweden)
Emma eSalo
2015-02-01
Full Text Available We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or simple (speaker-gender or font-shade discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley’s model modality atypical, that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.
Tanabe, Koji; Nishikawa, Keiichi; Sano, Tsukasa; Sakai, Osamu; Jara, Hernán
2010-05-01
To test a newly developed fat suppression magnetic resonance imaging (MRI) prepulse that synergistically uses the principles of fat suppression via inversion recovery (STIR) and spectral fat saturation (CHESS), relative to pure CHESS and STIR. This new technique is termed dual fat suppression (Dual-FS). To determine if Dual-FS could be chemically specific for fat, the phantom consisted of the fat-mimicking NiCl(2) aqueous solution, porcine fat, porcine muscle, and water was imaged with the three fat-suppression techniques. For Dual-FS and STIR, several inversion times were used. Signal intensities of each image obtained with each technique were compared. To determine if Dual-FS could be robust to magnetic field inhomogeneities, the phantom consisting of different NiCl(2) aqueous solutions, porcine fat, porcine muscle, and water was imaged with Dual-FS and CHESS at the several off-resonance frequencies. To compare fat suppression efficiency in vivo, 10 volunteer subjects were also imaged with the three fat-suppression techniques. Dual-FS could suppress fat sufficiently within the inversion time of 110-140 msec, thus enabling differentiation between fat and fat-mimicking aqueous structures. Dual-FS was as robust to magnetic field inhomogeneities as STIR and less vulnerable than CHESS. The same results for fat suppression were obtained in volunteers. The Dual-FS-STIR-CHESS is an alternative and promising fat suppression technique for turbo spin echo MRI. Copyright 2010 Wiley-Liss, Inc.
Devi, Jutika; Saikia, Rashmi; Datta, Pranayee
2016-10-01
The present paper describes the study of core-shell nanoparticles for application as nanoantenna in the optical domain. To obtain the absorption and extinction efficiencies as well as the angular distribution of the far field radiation pattern and the resonance wavelengths for these metal-dielectric, dielectric-metal and metal-metal core-shell nanoparticles in optical domain, we have used Finite Element Method based COMSOL Multiphysics Software and Mie Theory. From the comparative study of the extinction efficiencies of core-shell nanoparticles of different materials, it is found that for silica - gold core - shell nanoparticles, the resonant wavelength is greater than that of the gold - silver, silver-gold and gold-silica core - shell nanoparticles and also the radiation pattern of the silica-gold core-shell nanoparticle is the most suitable one from the point of view of directivity. The dielectric functions of the core and shell material as well as of the embedded matrix are extremely important and plays a very major role to tune the directivity and resonance wavelength. Such highly controllable parameters of the dielectric - metal core - shell nanoparticles make them suitable for efficient coupling of optical radiation into nanoscale structures for a broad range of applications in the field of communications.
International Nuclear Information System (INIS)
Devi, Jutika; Datta, Pranayee; Saikia, Rashmi
2016-01-01
The present paper describes the study of core-shell nanoparticles for application as nanoantenna in the optical domain. To obtain the absorption and extinction efficiencies as well as the angular distribution of the far field radiation pattern and the resonance wavelengths for these metal-dielectric, dielectric-metal and metal-metal core-shell nanoparticles in optical domain, we have used Finite Element Method based COMSOL Multiphysics Software and Mie Theory. From the comparative study of the extinction efficiencies of core-shell nanoparticles of different materials, it is found that for silica - gold core - shell nanoparticles, the resonant wavelength is greater than that of the gold - silver, silver-gold and gold-silica core - shell nanoparticles and also the radiation pattern of the silica-gold core-shell nanoparticle is the most suitable one from the point of view of directivity. The dielectric functions of the core and shell material as well as of the embedded matrix are extremely important and plays a very major role to tune the directivity and resonance wavelength. Such highly controllable parameters of the dielectric - metal core - shell nanoparticles make them suitable for efficient coupling of optical radiation into nanoscale structures for a broad range of applications in the field of communications. (paper)
Magnetic x-ray linear dichroism in resonant and non-resonant Gd 4f photoemission
Energy Technology Data Exchange (ETDEWEB)
Mishra, S.; Gammon, W.J.; Pappas, D.P. [Virginia Commonwealth Univ., Richmond, VA (United States)] [and others
1997-04-01
The enhancement of the magnetic linear dichroism in resonant 4f photoemission (MLDRPE) is studied from a 50 monolayer film of Gd/Y(0001). The ALS at beamline 7.0.1 provided the source of linearly polarized x-rays used in this study. The polarized light was incident at an angle of 30 degrees relative to the film plane, and the sample magnetization was perpendicular to the photon polarization. The linear dichroism of the 4f core levels is measured as the photon energy is tuned through the 4d-4f resonance. The authors find that the MLDRPE asymmetry is strongest at the resonance. Near the threshold the asymmetry has several features which are out of phase with the fine structure of the total yield.
Magnetic x-ray linear dichroism in resonant and non-resonant Gd 4f photoemission
International Nuclear Information System (INIS)
Mishra, S.; Gammon, W.J.; Pappas, D.P.
1997-01-01
The enhancement of the magnetic linear dichroism in resonant 4f photoemission (MLDRPE) is studied from a 50 monolayer film of Gd/Y(0001). The ALS at beamline 7.0.1 provided the source of linearly polarized x-rays used in this study. The polarized light was incident at an angle of 30 degrees relative to the film plane, and the sample magnetization was perpendicular to the photon polarization. The linear dichroism of the 4f core levels is measured as the photon energy is tuned through the 4d-4f resonance. The authors find that the MLDRPE asymmetry is strongest at the resonance. Near the threshold the asymmetry has several features which are out of phase with the fine structure of the total yield
Low-Power Embedded DSP Core for Communication Systems
Tsao, Ya-Lan; Chen, Wei-Hao; Tan, Ming Hsuan; Lin, Maw-Ching; Jou, Shyh-Jye
2003-12-01
This paper proposes a parameterized digital signal processor (DSP) core for an embedded digital signal processing system designed to achieve demodulation/synchronization with better performance and flexibility. The features of this DSP core include parameterized data path, dual MAC unit, subword MAC, and optional function-specific blocks for accelerating communication system modulation operations. This DSP core also has a low-power structure, which includes the gray-code addressing mode, pipeline sharing, and advanced hardware looping. Users can select the parameters and special functional blocks based on the character of their applications and then generating a DSP core. The DSP core has been implemented via a cell-based design method using a synthesizable Verilog code with TSMC 0.35[InlineEquation not available: see fulltext.]m SPQM and 0.25[InlineEquation not available: see fulltext.]m 1P5M library. The equivalent gate count of the core area without memory is approximately 50 k. Moreover, the maximum operating frequency of a[InlineEquation not available: see fulltext.] version is 100 MHz (0.35[InlineEquation not available: see fulltext.]m) and 140 MHz (0.25[InlineEquation not available: see fulltext.]m).
Dual-band left-handed metamaterials fabricated by using tree-shaped fractal
International Nuclear Information System (INIS)
Xu He-Xiu; Wang Guang-Ming; Yang Zi-Mu; Wang Jia-Fu
2012-01-01
A method of fabricating dual-band left-handed metematerials (LHMs) is investigated numerically and experimentally by single-sided tree-like fractals. The resulting structure features multiband magnetic resonances and two electric resonances. By appropriately adjusting the dimensions, two left-handed (LH) bands with simultaneous negative permittivity and permeability are engineered and are validated by full-wave eigenmode analysis and measurement as well in the microwave frequency range. To study the multi-resonant mechanism in depth, the LHM is analysed from three different perspectives of field distribution analysis, circuit model analysis, and geometrical parameters evaluation. The derived formulae are consistent with all simulated results and resulting electromagnetic phenomena, indicating the effectiveness of the established theory. The method provides an alternative to the design of multi-band LHM and has the advantage of not requiring two individual resonant particles and electrically continuous wires, which in turn facilitates planar design and considerably simplifies the fabrication. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Dual-energy CT can detect malignant lymph nodes in rectal cancer.
Al-Najami, I; Lahaye, M J; Beets-Tan, R G H; Baatrup, G
2017-05-01
There is a need for an accurate and operator independent method to assess the lymph node status to provide the most optimal personalized treatment for rectal cancer patients. This study evaluates whether Dual Energy Computed Tomography (DECT) could contribute to the preoperative lymph node assessment, and compared it to Magnetic Resonance Imaging (MRI). The objective of this prospective observational feasibility study was to determine the clinical value of the DECT for the detection of metastases in the pelvic lymph nodes of rectal cancer patients and compare the findings to MRI and histopathology. The patients were referred to total mesorectal excision (TME) without any neoadjuvant oncological treatment. After surgery the rectum specimen was scanned, and lymph nodes were matched to the pathology report. Fifty-four histology proven rectal cancer patients received a pelvic DECT scan and a standard MRI. The Dual Energy CT quantitative parameters were analyzed: Water and Iodine concentration, Dual-Energy Ratio, Dual Energy Index, and Effective Z value, for the benign and malignant lymph node differentiation. DECT scanning showed statistical difference between malignant and benign lymph nodes in the measurements of iodine concentration, Dual-Energy Ratio, Dual Energy Index, and Effective Z value. Dual energy CT classified 42% of the cases correctly according to N-stage compared to 40% for MRI. This study showed statistical difference in several quantitative parameters between benign and malignant lymph nodes. There were no difference in the accuracy of lymph node staging between DECT and MRI. Copyright © 2017 Elsevier B.V. All rights reserved.
Roes, M.G.L.; Duarte, J.L.; Hendrix, M.A.M.
2011-01-01
Feedback sensor isolation is often an expensive necessity in power converters, for reasons of safety and electromagnetic compatibility. A disturbance observer-based control strategy for a dual-output resonant converter is proposed to overcome this problem. Current control of two LED loads is
Roes, M.G.L.; Duarte, J.L.; Hendrix, M.A.M.
2010-01-01
Feedback sensor isolation is often an expensive necessity in power converters, for reasons of safety and electromagnetic compatibility. A disturbance observer-based control strategy for a dual-output resonant converter is proposed to overcome this problem. Current control of two LED loads is
Directory of Open Access Journals (Sweden)
Firas Alhasson
Full Text Available Many of the symptoms of Gulf War Illness (GWI that include neurological abnormalities, neuroinflammation, chronic fatigue and gastrointestinal disturbances have been traced to Gulf War chemical exposure. Though the association and subsequent evidences are strong, the mechanisms that connect exposure to intestinal and neurological abnormalities remain unclear. Using an established rodent model of Gulf War Illness, we show that chemical exposure caused significant dysbiosis in the gut that included increased abundance of phylum Firmicutes and Tenericutes, and decreased abundance of Bacteroidetes. Several gram negative bacterial genera were enriched in the GWI-model that included Allobaculum sp. Altered microbiome caused significant decrease in tight junction protein Occludin with a concomitant increase in Claudin-2, a signature of a leaky gut. Resultant leaching of gut caused portal endotoxemia that led to upregulation of toll like receptor 4 (TLR4 activation in the small intestine and the brain. TLR4 knock out mice and mice that had gut decontamination showed significant decrease in tyrosine nitration and inflammatory mediators IL1β and MCP-1 in both the small intestine and frontal cortex. These events signified that gut dysbiosis with simultaneous leaky gut and systemic endotoxemia-induced TLR4 activation contributes to GW chemical-induced neuroinflammation and gastrointestinal disturbances.
Ma, Caijuan; Sun, Zijun; Liu, Guihua; Su, Zhengquan; Bai, Yan
2018-02-01
The method was presented for the sensitive and selective determination of chitosan (CTS) in health products with Brilliant Blue (BB) as a probe, based on dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS). In weakly acidic buffer solution, the binding of CTS and BB could result in the RRS intensities getting enhanced significantly at RRS peaks of 344 nm and 452 nm, and the scattering intensities of the two peaks were proportional to the concentration of CTS within a certain range. When the RRS intensities of the two wavelengths were superposed, the results showed higher sensitivity. Under the optimum experimental conditions, the total of the two increased RRS intensities was linear to the CTS concentration in the range of 0.02-1.80 μg/mL and the limit of detection (LOD) was 7.45 ng/mL. In this work, the optimum conditions and the effects of some foreign substances were studied. Accordingly, the new method based on DWO-RRS for the determination of CTS was developed. In addition, the effect of the molecular weight and the deacetylation degree between different chitosan molecules was discussed. Finally, this assay was applied to determine the concentration of CTS in health products with satisfactory results.
Infrared light extinction by charged dielectric core-coat particles
Thiessen, Elena; Heinisch, Rafael L.; Bronold, Franz X.; Fehske, Holger
2014-01-01
We study the effect of surplus electrons on the infrared extinction of dielectric particles with a core-coat structure and propose to use it for an optical measurement of the particle charge in a dusty plasma. The particles consist of an inner core with negative and an outer coat with positive electron affinity. Both the core and the coat give rise to strong transverse optical phonon resonances, leading to anomalous light scattering in the infrared. Due to the radial profile of the electron a...
Vibration mode and vibration shape under excitation of a three phase model transformer core
Okabe, Seiji; Ishigaki, Yusuke; Omura, Takeshi
2018-04-01
Structural vibration characteristics and vibration shapes under three-phase excitation of a archetype transformer core were investigated to consider their influences on transformer noise. Acoustic noise and vibration behavior were measured in a three-limb model transformer core. Experimental modal analysis by impact test was performed. The vibration shapes were measured by a laser scanning vibrometer at different exciting frequencies. Vibration amplitude of the core in out-of-plane direction were relatively larger than those in other two in-plane directions. It was consistent with the result that the frequency response function of the core in out-of-plane direction was larger by about 20 dB or more than those in in-plane directions. There were many vibration modes having bending deformation of limbs in out-of-plane direction. The vibration shapes of the core when excited at 50 Hz and 60 Hz were almost the same because the fundamental frequencies of the vibration were not close to the resonance frequencies. When excitation frequency was 69 Hz which was half of one of the resonance frequencies, the vibration shape changed to the one similar to the resonance vibration mode. Existence of many vibration modes in out-of-plane direction of the core was presumed to be a reason why frequency characteristics of magnetostriction and transformer noise do not coincide.
Zhu, Jinghui; Qin, Mingyou; Liu, Shaopu; Liu, Zhongfang; Yang, Jidong; Hu, Xiaoli
2014-09-15
A flow injection analysis (FIA) system combined with dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) has been established and validated for rapid determination of malachite green (MG) and its metabolite in fish samples. Under experimental condition, MG would react with Erythrosin (Ery) to form ion-association complexes, resulting in the occurrence of two RRS peaks and a dramatic enhancement of RRS intensity. The maximum RRS peaks were located at 286 nm and 337 nm. It is noted that the increments of both of these two peaks were proportional to the concentration of MG. The detection limit of DWO-RRS was 1.5 ng/mL, which was comparable to several reported methods. Moreover, the results of real sample analysis exhibited an acceptable recovery between 97.5% and 103.6%, indicating that the method had good reproducibility. Copyright © 2014 Elsevier B.V. All rights reserved.
Dual Resonant Frequencies Effects on an Induction-Based Oil Palm Fruit Sensor
Directory of Open Access Journals (Sweden)
Noor Hasmiza Harun
2014-11-01
Full Text Available As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB. Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB. A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA. To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.
Dual resonant frequencies effects on an induction-based oil palm fruit sensor.
Harun, Noor Hasmiza; Misron, Norhisam; Mohd Sidek, Roslina; Aris, Ishak; Wakiwaka, Hiroyuki; Tashiro, Kunihisa
2014-11-19
As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB). Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB). A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA). To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.
Core-Shell Particles as Building Blocks for Systems with High Duality Symmetry
Rahimzadegan, Aso; Rockstuhl, Carsten; Fernandez-Corbaton, Ivan
2018-05-01
Material electromagnetic duality symmetry requires a system to have equal electric and magnetic responses. Intrinsically dual materials that meet the duality conditions at the level of the constitutive relations do not exist in many frequency bands. Nevertheless, discrete objects like metallic helices and homogeneous dielectric spheres can be engineered to approximate the dual behavior. We exploit the extra degrees of freedom of a core-shell dielectric sphere in a particle optimization procedure. The duality symmetry of the resulting particle is more than 1 order of magnitude better than previously reported nonmagnetic objects. We use T -matrix-based multiscattering techniques to show that the improvement is transferred onto the duality symmetry of composite objects when the core-shell particle is used as a building block instead of homogeneous spheres. These results are relevant for the fashioning of systems with high duality symmetry, which are required for some technologically important effects.
Pressure-driven amplification and penetration of resonant magnetic perturbations
Energy Technology Data Exchange (ETDEWEB)
Loizu, J. [Max-Planck-Institut für Plasmaphysik, D-17491 Greifswald (Germany); Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543 (United States); Hudson, S. R.; Lazerson, S. A.; Bhattacharjee, A. [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543 (United States); Helander, P. [Max-Planck-Institut für Plasmaphysik, D-17491 Greifswald (Germany)
2016-05-15
We show that a resonant magnetic perturbation applied to the boundary of an ideal plasma screw-pinch equilibrium with nested surfaces can penetrate inside the resonant surface and into the core. The response is significantly amplified with increasing plasma pressure. We present a rigorous verification of nonlinear equilibrium codes against linear theory, showing excellent agreement.
International Nuclear Information System (INIS)
Ohno, Masahide
2006-01-01
The transition from the radiationless resonant Raman scattering to the normal Auger decay in resonant Auger-electron spectroscopy (RAES) spectra of charge transfer (CT) systems is discussed by treating the relaxation and the core-hole decay of the excited core-hole state on the same footing by a many-body theory. When the resonantly excited electron remains at the excited atomic site during the core-hole decay, the RAES spectrum shows the characteristic feature of the resonant Auger-Raman effect, whereas when the excited electron has been transferred from the atomic site before the core-hole decays, the RAES spectrum shows the normal Auger decay. The present theory supports the interpretation of the variation with photon energy of the intensity ratio of the latter spectrum to the former one in the RAES spectrum by the Ar 2p → 4s resonance of Ar atoms adsorbed on Ru(0 0 1) surface reported by Keller et al. [C. Keller, M. Stichler, G. Comelli, F. Esch, S. Lizzit, D. Menzel, W. Wurth, Phys. Rev. B 57 (1998) 11951]. The transition from the radiationless resonant Raman scattering to the normal Auger decay in the RAES spectrum of CuO reported by Finazzi et al. [M. Finazzi, G. Ghiringhell, O. Tjernberg, Ph. Ohresser, N.B. Brookes, Phys. Rev. B 61 (2000) 4629] is discussed in terms of the relaxation of the resonantly excited core-hole state to the core-electron ionized main-line state by the hole-particle excitations. The merging of the resonant Raman-Auger-electron kinetic energy into the normal one about 2 eV above the absorption maximum in Cu 2 O reported by Finazzi et al. [M. Finazzi, G. Ghiringhell, O. Tjernberg, Ph. Ohresser, N.B. Brookes, Phys. Rev. B 61 (2000) 4629] is explained in terms of the change in the characteristics of the screening electron in the two-hole final state. The Ti L 23 -M 23 V RAES spectra of TiO 2 and TiO 2-x are also analyzed
Measurement and analysis of reactivity worth of 237Np sample in cores of TCA and FCA
International Nuclear Information System (INIS)
Sakurai, Takeshi; Mori, Takamasa; Okajima, Shigeaki; Tani, Kazuhiro; Suzaki, Takenori; Saito, Masaki
2009-01-01
The reactivity worth of 22.87 grams of 237 Np oxide sample was measured and analyzed in seven uranium cores in the Tank-Type Critical Assembly (TCA) and two uranium cores in the Fast Critical Assembly (FCA) at the Japan Atomic Energy Agency. The TCA cores provided a systematic variation in the neutron spectrum between the thermal and resonance energy regions. The FCA cores, XXI and XXV, provided a hard neutron spectrum of the fast reactor and a soft one of the resonance energy region, respectively. Analyses were carried out using the JENDL-3.3 nuclear data library with a Monte Carlo method for the TCA cores and a deterministic method for the FCA cores. The ratios of calculated to experimental (C/E) reactivity worth were between 0.97 and 0.91, and showed no apparent dependence on the neutron spectrum. (author)
High-accuracy self-calibration method for dual-axis rotation-modulating RLG-INS
Wei, Guo; Gao, Chunfeng; Wang, Qi; Wang, Qun; Long, Xingwu
2017-05-01
Inertial navigation system has been the core component of both military and civil navigation systems. Dual-axis rotation modulation can completely eliminate the inertial elements constant errors of the three axes to improve the system accuracy. But the error caused by the misalignment angles and the scale factor error cannot be eliminated through dual-axis rotation modulation. And discrete calibration method cannot fulfill requirements of high-accurate calibration of the mechanically dithered ring laser gyroscope navigation system with shock absorbers. This paper has analyzed the effect of calibration error during one modulated period and presented a new systematic self-calibration method for dual-axis rotation-modulating RLG-INS. Procedure for self-calibration of dual-axis rotation-modulating RLG-INS has been designed. The results of self-calibration simulation experiment proved that: this scheme can estimate all the errors in the calibration error model, the calibration precision of the inertial sensors scale factor error is less than 1ppm and the misalignment is less than 5″. These results have validated the systematic self-calibration method and proved its importance for accuracy improvement of dual -axis rotation inertial navigation system with mechanically dithered ring laser gyroscope.
Lifetime-vibrational interference effects in resonantly excited x-ray emission spectra of CO
Energy Technology Data Exchange (ETDEWEB)
Skytt, P.; Glans, P.; Gunnelin, K. [Uppsala Univ. (Sweden)] [and others
1997-04-01
The parity selection rule for resonant X-ray emission as demonstrated for O{sub 2} and N{sub 2} can be seen as an effect of interference between coherently excited degenerate localized core states. One system where the core state degeneracy is not exact but somewhat lifted was previously studied at ALS, namely the resonant X-ray emission of amino-substituted benzene (aniline). It was shown that the X-ray fluorescence spectrum resulting from excitation of the C1s at the site of the {open_quotes}aminocarbon{close_quotes} could be described in a picture separating the excitation and the emission processes, whereas the spectrum corresponding to the quasi-degenerate carbons could not. Thus, in this case it was necessary to take interference effects between the quasi-degenerate intermediate core excited states into account in order to obtain agreement between calculations and experiment. The different vibrational levels of core excited states in molecules have energy splittings which are of the same order of magnitude as the natural lifetime broadening of core excitations in the soft X-ray range. Therefore, lifetime-vibrational interference effects are likely to appear and influence the band shapes in resonant X-ray emission spectra. Lifetime-vibrational interference has been studied in non-resonant X-ray emission, and in Auger spectra. In this report the authors discuss results of selectively excited soft X-ray fluorescence spectra of molecules, where they focus on lifetime-interference effects appearing in the band shapes.
Low-energy d-d excitations in MnO studied by resonant x-ray fluorescence spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Butorin, S.M.; Guo, J.; Magnuson, M. [Uppsala Univ. (Sweden)] [and others
1997-04-01
Resonant soft X-ray emission spectroscopy has been demonstrated to possess interesting abilities for studies of electronic structure in various systems, such as symmetry probing, alignment and polarization dependence, sensitivity to channel interference, etc. In the present abstract the authors focus on the feasibility of resonant soft X-ray emission to probe low energy excitations by means of resonant electronic X-ray Raman scattering. Resonant X-ray emission can be regarded as an inelastic scattering process where a system in the ground state is transferred to a low excited state via a virtual core excitation. The energy closeness to a core excitation of the exciting radiation enhances the (generally) low probability for inelastic scattering at these wavelengths. Therefore soft X-ray emission spectroscopy (in resonant electronic Raman mode) can be used to study low energy d-d excitations in transition metal systems. The involvement of the intermediate core state allows one to use the selection rules of X-ray emission, and the appearance of the elastically scattered line in the spectra provides the reference to the ground state.
Low-energy d-d excitations in MnO studied by resonant x-ray fluorescence spectroscopy
International Nuclear Information System (INIS)
Butorin, S.M.; Guo, J.; Magnuson, M.
1997-01-01
Resonant soft X-ray emission spectroscopy has been demonstrated to possess interesting abilities for studies of electronic structure in various systems, such as symmetry probing, alignment and polarization dependence, sensitivity to channel interference, etc. In the present abstract the authors focus on the feasibility of resonant soft X-ray emission to probe low energy excitations by means of resonant electronic X-ray Raman scattering. Resonant X-ray emission can be regarded as an inelastic scattering process where a system in the ground state is transferred to a low excited state via a virtual core excitation. The energy closeness to a core excitation of the exciting radiation enhances the (generally) low probability for inelastic scattering at these wavelengths. Therefore soft X-ray emission spectroscopy (in resonant electronic Raman mode) can be used to study low energy d-d excitations in transition metal systems. The involvement of the intermediate core state allows one to use the selection rules of X-ray emission, and the appearance of the elastically scattered line in the spectra provides the reference to the ground state
Sigler, Chris; Gibson, Ricky; Boyle, Colin; Kirch, Jeremy D.; Lindberg, Donald; Earles, Thomas; Botez, Dan; Mawst, Luke J.; Bedford, Robert
2018-01-01
The modal characteristics of nonresonant five-element phase-locked arrays of 4.7-μm emitting quantum cascade lasers (QCLs) have been studied using spectrally resolved near- and far-field measurements and correlated with results of device simulation. Devices are fabricated by a two-step metal-organic chemical vapor deposition process and operate predominantly in an in-phase array mode near threshold, although become multimode at higher drive levels. The wide spectral bandwidth of the QCL's core region is found to be a factor in promoting multispatial-mode operation at high drive levels above threshold. An optimized resonant-array design is identified to allow sole in-phase array-mode operation to high drive levels above threshold, and indicates that for phase-locked laser arrays full spatial coherence to high output powers does not require full temporal coherence.
Note on Nahm's partition function of the dual spectrum II
Minimi, M
1977-01-01
For pt.I see CERN publication TH2240. In part I, in considering the Nahm dual resonance mass spectra theory, it was noticed that there is another modular form; a generating function that transforms automorphically under T:w to -1/w and would realize the Veneziano dualism. The group structure associated with this form is studied since it appears, to the authors, to be more natural than Nahm's original. (6 refs).
Porous Core-Shell Nanostructures for Catalytic Applications
Ewers, Trevor David
Porous core-shell nanostructures have recently received much attention for their enhanced thermal stability. They show great potential in the field of catalysis, as reactant gases can diffuse in and out of the porous shell while the core particle is protected from sintering, a process in which particles coalesce to form larger particles. Sintering is a large problem in industry and is the primary cause of irreversible deactivation. Despite the obvious advantages of high thermal stability, porous core-shell nanoparticles can be developed to have additional interactive properties from the combination of the core and shell together, rather than just the core particle alone. This dissertation focuses on developing new porous core-shell systems in which both the core and shell take part in catalysis. Two types of systems are explored; (1) yolk-shell nanostructures with reducible oxide shells formed using the Kirkendall effect and (2) ceramic-based porous oxide shells formed using sol-gel chemistry. Of the Kirkendall-based systems, Au FexOy and Cu CoO were synthesized and studied for catalytic applications. Additionally, ZnO was explored as a potential shelling material. Sol-gel work focused on optimizing synthetic methods to allow for coating of small gold particles, which remains a challenge today. Mixed metal oxides were explored as a shelling material to make dual catalysts in which the product of a reaction on the core particle becomes a reactant within the shell.
Directory of Open Access Journals (Sweden)
Atrayee Banerjee
Full Text Available The mechanisms of alcohol-mediated advanced liver injury in HIV-infected individuals are poorly understood. Thus, this study was aimed to investigate the effect of binge alcohol on the inflammatory liver disease in HIV transgenic rats as a model for simulating human conditions. Female wild-type (WT or HIV transgenic rats were treated with three consecutive doses of binge ethanol (EtOH (3.5 g/kg/dose oral gavages at 12-h intervals or dextrose (Control. Blood and liver tissues were collected at 1 or 6-h following the last dose of ethanol or dextrose for the measurements of serum endotoxin and liver pathology, respectively. Compared to the WT, the HIV rats showed increased sensitivity to alcohol-mediated gut leakiness, hepatic steatosis and inflammation, as evidenced with the significantly elevated levels of serum endotoxin, hepatic triglycerides, histological fat accumulation and F4/80 staining. Real-time PCR analysis revealed that hepatic levels of toll-like receptor-4 (TLR4, leptin and the downstream target monocyte chemoattractant protein-1 (MCP-1 were significantly up-regulated in the HIV-EtOH rats, compared to all other groups. Subsequent experiments with primary cultured cells showed that both hepatocytes and hepatic Kupffer cells were the sources of the elevated MCP-1 in HIV-EtOH rats. Further, TLR4 and MCP-1 were found to be upregulated by leptin. Collectively, these results show that HIV rats, similar to HIV-infected people being treated with the highly active anti-retroviral therapy (HAART, are more susceptible to binge alcohol-induced gut leakiness and inflammatory liver disease than the corresponding WT, possibly due to additive or synergistic interaction between binge alcohol exposure and HIV infection. Based on these results, HIV transgenic rats can be used as a surrogate model to study the molecular mechanisms of many disease states caused by heavy alcohol intake in HIV-infected people on HAART.
Core/Shell Structured Magnetic Nanoparticles for Biological Applications
International Nuclear Information System (INIS)
Park, Jeong Chan; Jung, Myung Hwan
2013-01-01
Magnetic nanoparticles have been widely used for biomedical applications, such as magnetic resonance imaging (MRI), hyperthermia, drug delivery and cell signaling. The surface modification of the nanomaterials is required for biomedical use to give physiogical stability, surface reactivity and targeting properties. Among many approaches for the surface modification with materials, such as polymers, organic ligands and metals, one of the most attractive ways is using metals. The fabrication of metal-based, monolayer-coated magnetic nanoparticles has been intensively studied. However, the synthesis of metal-capped magnetic nanoparticles with monodispersities and controllable sizes is still challenged. Recently, gold-capped magnetic nanoparticles have been reported to increase stability and to provide biocompatibility. Magnetic nanoparticle with gold coating is an attractive system, which can be stabilized in biological conditions and readily functionalized in biological conditions and readily functionalized through well-established surface modification (Au-S) chemistry. The Au coating offers plasmonic properties to magnetic nanoparticles. This makes the magnetic/Au core/shell combinations interesting for magnetic and optical applications. Herein, the synthesis and characterization of gold capped-magnetic core structured nanomaterials with different gold sources, such as gold acetate and chloroauric acid have been reported. The core/shell nanoparticles were transferred from organic to aqueous solutions for biomedical applications. Magnetic core/shell structured nanoparticles have been prepared and transferred from organic phase to aqueous solutions. The resulting Au-coated magnetic core nanoparticles might be an attractive system for biomedical applications, which are needed both magnetic resonance imaging and optical imaging
Optical absorption of carbon-gold core-shell nanoparticles
Wang, Zhaolong; Quan, Xiaojun; Zhang, Zhuomin; Cheng, Ping
2018-01-01
In order to enhance the solar thermal energy conversion efficiency, we propose to use carbon-gold core-shell nanoparticles dispersed in liquid water. This work demonstrates theoretically that an absorbing carbon (C) core enclosed in a plasmonic gold (Au) nanoshell can enhance the absorption peak while broadening the absorption band; giving rise to a much higher solar absorption than most previously studied core-shell combinations. The exact Mie solution is used to evaluate the absorption efficiency factor of spherical nanoparticles in the wavelength region from 300 nm to 1100 nm as well as the electric field and power dissipation profiles inside the nanoparticles at specified wavelengths (mostly at the localized surface plasmon resonance wavelength). The field enhancement by the localized plasmons at the gold surfaces boosts the absorption of the carbon particle, resulting in a redshift of the absorption peak with increased peak height and bandwidth. In addition to spherical nanoparticles, we use the finite-difference time-domain method to calculate the absorption of cubic core-shell nanoparticles. Even stronger enhancement can be achieved with cubic C-Au core-shell structures due to the localized plasmonic resonances at the sharp edges of the Au shell. The solar absorption efficiency factor can exceed 1.5 in the spherical case and reach 2.3 in the cubic case with a shell thickness of 10 nm. Such broadband absorption enhancement is in great demand for solar thermal applications including steam generation.
Lee, Sang Seok; Seo, Hyeon Jin; Kim, Yun Ho; Kim, Shin-Hyun
2017-06-01
Photonic microcapsules with onion-like topology are microfluidically designed to have cholesteric liquid crystals with opposite handedness in their core and shell. The microcapsules exhibit structural colors caused by dual photonic bandgaps, resulting in a rich variety of color on the optical palette. Moreover, the microcapsules can switch the colors from either core or shell depending on the selection of light-handedness. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Subharmonic excitation in an HTGR core
International Nuclear Information System (INIS)
Bezler, P.; Curreri, J.R.
1977-01-01
The occurrence of subharmonic resonance in a series of blocks with clearance between blocks and with springs on the outer most ends is the subject of this paper. This represents an HTGR core response to an earthquake input. An analytical model of the cross section of this type of core is a series of blocks arranged horizontally between outer walls. Each block represents many graphite hexagonal core elements acting in unison as a single mass. The blocks are of unequal size to model the true mass distribution through the core. Core element elasticity and damping characteristics are modeled with linear spring and viscous damping units affixed to each block. The walls and base represent the core barell or core element containment structure. For forced response calculations, these boundaries are given prescribed motions. The clearance between each block could be the same or different with the total clearance duplicating that of the entire core. Spring packs installed between the first and last block and the boundaries model the boundary elasticity. The system non-linearity is due to the severe discontinuity in the interblock elastic forces when adjacent blocks collide. A computer program using a numerical integration scheme was developed to solve for the response of the system to arbitrary inputs
Low-Loss Hollow-Core Anti-Resonant Fibers With Semi-Circular Nested Tubes
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
Hollow-core fibers with a single ring of circular antiresonant tubes as the cladding provide a simple way of getting a negative-curvature hollow core, resulting in broadband low-loss transmission with little power overlap in the glass. These fibers show a significant improvement in loss performan...
Real-Time Leaky Lamb Wave Spectrum Measurement and Its Application to NDE of Composites
Lih, Shyh-Shiuh; Bar-Cohen, Yoseph
1999-01-01
Numerous analytical and theoretical studies of the behavior of leaky Lamb waves (LLW) in composite materials were documented in the literature. One of the key issues that are constraining the application of this method as a practical tool is the amount of data that needs to be acquired and the slow process that is involved with such experiments. Recently, a methodology that allows quasi real-time acquisition of LLW dispersion data was developed. At each angle of incidence the reflection spectrum is available in real time from the experimental setup and it can be used for rapid detection of the defects. This technique can be used to rapidly acquire the various plate wave modes along various angles of incidence for the characterization of the material elastic properties. The experimental method and data acquisition technique will be described in this paper. Experimental data was used to examine a series of flaws including porosity and delaminations and demonstrated the efficiency of the developed technique.
Cooperative spontaneous emission of nano-emitters with inter-emitter coupling in a leaky microcavity
International Nuclear Information System (INIS)
Hong, Suc-Kyoung; Nam, Seog Woo; Yang, Hyung Jin
2015-01-01
We study the spontaneous emission from a few two-level nano-emitters placed in a leaky microcavity with Lorentzian spectral density near a critically damped regime. Collective features of the spontaneous emission are investigated by numerical analysis of the excitation dynamics when initially one nano-emitter is totally excited but we do not know which one. The results show that there are three decay rates in the excitation dynamics, two for simple exponential decays and one for damped oscillatory decay. The excitation dynamics is found to critically depend on the regime of the system. It is shown that the spontaneous emission is enhanced or suppressed depending on whether the system is in the underdamped or overdamped regime, respectively. On the other hand, the cooperative spontaneous emission is suppressed in the underdamped while it is enhanced in the overdamped regime. Furthermore, the effect of the direct inter-emitter coupling on the breaking of the cooperativeness of the spontaneous emission is shown as well. (paper)
Electromagnetic torques in the core and resonant excitation of decadal polar motion
Mound, Jon E.
2005-02-01
Motion of the rotation axis of the Earth contains decadal variations with amplitudes on the order of 10 mas. The origin of these decadal polar motions is unknown. A class of rotational normal modes of the core-mantle system termed torsional oscillations are known to affect the length of day (LOD) at decadal periods and have also been suggested as a possible excitation source for the observed decadal polar motion. Torsional oscillations involve relative motion between the outer core and the surrounding solid bodies, producing electromagnetic torques at the inner-core boundary (ICB) and core-mantle boundary (CMB). It has been proposed that the ICB torque can explain the excitation of the approximately 30-yr-period polar motion termed the Markowitz wobble. This paper uses the results of a torsional oscillation model to calculate the torques generated at Markowitz and other decadal periods and finds, in contrast to previous results, that electromagnetic torques at the ICB can not explain the observed polar motion.
International Nuclear Information System (INIS)
Donescu, O.S.; Battie, M.C.; Videman, T.
2007-01-01
Purpose: To examine degenerative features based on magnetic resonance imaging (MRI) measurements at the lumbar spine in relation to dual-energy X-ray absorptiometry (DXA), and to investigate whether bone mineral density (BMD) is reflected in the substitution of bone trabecular structure by fat at the vertebral body level indicated by MRI T1 relaxation time, endplate concavity, and hypertrophic (osteophytes and endplate sclerosis) MRI findings. Material and Methods: The sample for this cross-sectional study was composed of 102 subjects, 35-70 years old, from a population-based cohort. Data collection included DXA in the anterior-posterior projection at the L1-L4 vertebrae and right femoral neck, and MRI of the lumbar spine in the midsagittal plane. Results: Age, vertebral signal intensity, osteophytes, and endplate concavity collectively explained 20% of the variance in spine BMD. Conclusion: The study findings suggest that degenerative findings based on MRI measurements at the lumbar spine have an influence on bone assessment using DXA. Therefore, an overall bone assessment such as DXA might not offer an accurate measure of BMD
Some properties of dual and approximate dual of fusion frames
Arefijamaal, Ali Akbar; Neyshaburi, Fahimeh Arabyani
2016-01-01
In this paper we extend the notion of approximate dual to fusion frames and present some approaches to obtain dual and approximate alternate dual fusion frames. Also, we study the stability of dual and approximate alternate dual fusion frames.
General well function for pumping from a confined, leaky, or unconfined aquifer
Perina, Tomas; Lee, Tien-Chang
2006-02-01
A general well function for groundwater flow toward an extraction well with non-uniform radial flux along the screen and finite-thickness skin, partially penetrating an unconfined, leaky-boundary flux, or confined aquifer is derived via the Laplace and generalized finite Fourier transforms. The mixed boundary condition at the well face is solved as the discretized Fredholm integral equation. The general well function reduces to a uniform radial flux solution as a special case. In the Laplace domain, the relation between the drawdown in the extraction well and flowrate is linear and the formulations for specified flowrate or specified drawdown pumping are interchangeable. The deviation in drawdown of the uniform from non-uniform radial flux solutions depends on the relative positions of the extraction and observation well screens, aquifer properties, and time of observation. In an unconfined aquifer the maximum deviation occurs during the period of delayed drawdown when the effect of vertical flow is most apparent. The skin and wellbore storage in an observation well are included as model parameters. A separate solution is developed for a fully penetrating well with the radial flux being a continuous function of depth.
Temporal lobe epilepsy: analysis of patients with dual pathology.
Salanova, V; Markand, O; Worth, R
2004-02-01
To determine the frequency and types of dual pathology in patients with temporal lobe epilepsy (TLE) and to analyze the clinical manifestations and surgical outcome. A total of 240 patients with TLE underwent temporal resections following a comprehensive pre-surgical evaluation. Thirty-seven (15.4%) of these had hippocampal sclerosis (HS) or temporal lobe gliosis in association with another lesion (dual pathology). Eighteen of 37 patients with dual pathology had heterotopia of the temporal lobe, nine had cortical dysplasia, four had cavernous angiomas or arteriovenous malformations, one had a dysembryoplastic neuroepithelial tumor, one had a contusion and four patients had cerebral infarctions in childhood. 68.5% had abnormal head magnetic resonance imagings, 91.3% had abnormal positron emission tomography scans, and 96% had abnormal ictal SPECT. The intracarotid amobarbital procedure (IAP) showed impaired memory of the epileptogenic side in 72% of the patients. Twenty patients had left and 17 had right-sided en bloc temporal resections, including the lesion and mesial temporal structures. Twenty-six (70.2%) became seizure-free, eight (21.6%) had rare seizures, two (5.4%) had worthwhile seizure reduction and one (2.7%) had no improvement (range of follow-up 1-16 years, mean = 7.4 years). 15.4% had dual pathology. The dual pathology was almost exclusively seen in patients whose lesions were congenital, or occurred early in life, suggesting that the hippocampus is more vulnerable and more readily develops HS in early childhood. Resections, including the lateral and mesial temporal structures led to a favorable outcome with no mortality and little morbidity.
Yao, Chuanjin
2017-06-07
Knowledge of preferential flow in heterogeneous environments is essential for enhanced hydrocarbon recovery, geothermal energy extraction, and successful sequestration of chemical waste and carbon dioxide. Dual tracer tests using nanoparticles with a chemical tracer could indicate the preferential flow. A dual-permeability model with a high permeable core channel surrounded by a low permeable annulus was constructed and used to determine the viability of an inert carbon nanoparticle tracer for this application. A series of column experiments were conducted to demonstrate how this nanoparticle tracer can be used to implement the dual tracer tests in heterogeneous environments. The results indicate that, with the injection rate selected and controlled appropriately, nanoparticles together with a chemical tracer can assess the preferential flow in heterogeneous environments. The results also implement the dual tracer tests in heterogeneous environments by simultaneously injecting chemical and nanoparticle tracers.
Application of a numerical model in the interpretation of a leaky aquifer test
International Nuclear Information System (INIS)
Schroth, B.; Narasimhan, T.N.
1997-01-01
The potential use of numerical models in aquifer analysis is by no means a new concept; yet relatively few engineers and scientists are taking advantage of this powerful tool that is more convenient to use now than ever before. In this technical note the authors present an example of using a numerical model in an integrated analysis of data from a three-layer leaky aquifer system involving well-bore storage, skin effects, variable discharge, and observation wells in the pumped aquifer and in an unpumped aquifer. The modeling detail may differ for other cases. The intent is to show that interpretation can be achieved with reduced bias by reducing assumptions in regard to system geometry, flow rate, and other details. A multiwell aquifer test was carried out at a site on the western part of the Lawrence Livermore National Laboratory (LLNL), located about 60 kilometers east of San Francisco. The test was conducted to hydraulically characterize one part of the site and thus help develop remediation strategies to alleviate the ground-water contamination
Startup testing of Romania dual-core test reactor
International Nuclear Information System (INIS)
Whittemore, W.L.
1980-01-01
Late in 1979 both the Annular Core Pulsed Reactor (ACPR) and the 14-MW steady-state reactor (SSR) were loaded to critical. The fuel loading in both was then carried to completion and low-power testing was conducted. Early in 1980 both reactors successfully underwent high-power testing. The ACPR was operated for several hours at 500 kW and underwent pulse tests culminating in pulses with reactivity insertions of $4.60, peak power levels of about 20,000 MW, energy releases of 100 MW-sec, and peak measured fuel temperatures of 830 deg. C. The SSR was operated in several modes, both with natural convection and forced cooling with one or more pumps. The reactor successfully completed a 120-hr full-power test. Subsequent fuel element inspections confirmed that the fuel has performed without fuel damage or distortion. (author)
Assessment of myocardial perfusion with MRI using a modified dual bolus method
International Nuclear Information System (INIS)
Husso, M; Sipola, P; Manninen, H; Vainio, P; Kuittinen, T; Hartikainen, J; Saarakkala, S; Töyräs, J; Kuikka, J
2014-01-01
Quantification of regional myocardial blood flow (rMBF) with first-pass magnetic resonance imaging (FP-MRI) requires two contrast agent injections (dual bolus technique), inducing error in the determined rMBF if the injections differ. We hypothesize that using input and residue curves of the same injection would be more reliable. We aim to introduce and evaluate a novel method to correct the high concentration arterial input function (AIF) for determination of rMBF. Sixteen patients with non-Hodgkin's lymphoma were examined before and after chemotherapy. The input function was solved by correcting initial high concentration AIF using the ratio of low and high contrast AIF areas, normalized by corresponding heart rates (modified dual bolus method). For comparison, the scaled low contrast AIF was used as an input function (dual bolus method). Unidirectional transfer coefficient K trans was calculated using both methods. K trans -values determined with the dual bolus (0.81 ± 0.32 ml g −1 min −1 ) and modified dual bolus (0.77 ± 0.42 ml g −1 min −1 ) methods were in agreement (p = 0.21). Mean K trans -values increased from 0.76 ± 0.43 to 0.89 ± 0.55 ml g −1 min −1 after chemotherapy (p = 0.17). The modified dual bolus technique agrees with the dual bolus technique (R2 = 0.899) when the low and high contrast injections are similar. However, when this is not the case, the modified dual bolus technique may be more reliable. (paper)
The Neurocognitive Basis for Impaired Dual-Task Performance in Senior Fallers.
Nagamatsu, Lindsay S; Hsu, C Liang; Voss, Michelle W; Chan, Alison; Bolandzadeh, Niousha; Handy, Todd C; Graf, Peter; Beattie, B Lynn; Liu-Ambrose, Teresa
2016-01-01
Falls are a major health-care concern, and while dual-task performance is widely recognized as being impaired in those at-risk for falls, the underlying neurocognitive mechanisms remain unknown. A better understanding of the underlying mechanisms could lead to the refinement and development of behavioral, cognitive, or neuropharmacological interventions for falls prevention. Therefore, we conducted a cross-sectional study with community-dwelling older adults aged 70-80 years with a history of falls (i.e., two or more falls in the past 12 months) or no history of falls (i.e., zero falls in the past 12 months); n = 28 per group. We compared functional activation during cognitive-based dual-task performance between fallers and non-fallers using functional magnetic resonance imaging (fMRI). Executive cognitive functioning was assessed via Stroop, Trail Making, and Digit Span. Mobility was assessed via the Timed Up and Go test (TUG). We found that non-fallers exhibited significantly greater functional activation compared with fallers during dual-task performance in key regions responsible for resolving dual-task interference, including precentral, postcentral, and lingual gyri. Further, we report slower reaction times during dual-task performance in fallers and significant correlations between level of functional activation and independent measures of executive cognitive functioning and mobility. Our study is the first neuroimaging study to examine dual-task performance in fallers, and supports the notion that fallers have reduced functional brain activation compared with non-fallers. Given that dual-task performance-and the underlying neural concomitants-appears to be malleable with relevant training, our study serves as a launching point for promising strategies to reduce falls in the future.
Role of screening and angular distributions in resonant soft-x-ray emission of CO
Energy Technology Data Exchange (ETDEWEB)
Skytt, P.; Glans, P.; Gunnelin, K. [Uppsala Univ. (Sweden)] [and others
1997-04-01
In the present work the authors focus on two particular properties of resonant X-ray emission, namely core hole screening of the excited electron, and anisotropy caused by the polarization of the exciting synchrotron radiation. The screening of the core hole by the excited electron causes energy shifts and intensity variations in resonant spectra compared to the non-resonant case. The linear polarization of the synchrotron radiation and the dipole nature of the absorption process create a preferential alignment selection of the randomly oriented molecules in the case of resonant excitation, producing an anisotropy in the angular distribution of the emitted X-rays. The authors have chosen CO for this study because this molecule has previously served as a showcase for non-resonant X-ray emission, mapping the valence electronic structure differently according to the local selection rules. With the present work they take interest in how this characteristic feature of the spectroscopy is represented in the resonant case.
Feng, Jingjie; Zhou, Congcong; He, Cheng; Li, Yuan; Ye, Xuesong
2017-04-01
In this paper, a miniaturized wearable core body temperature (CBT) monitoring system based on the dual heat flux (DHF) principle was developed. By interspersing calcium carbonate powder in PolyDimethylsiloxane (PDMS), a reformative heat transfer medium was produced to reduce the thermal equilibrium time. Besides, a least mean square (LMS) algorithm based active noise cancellation (ANC) method was adopted to diminish the impact of ambient temperature fluctuations. Theoretical analyses, finite element simulation, experiments on a hot plate and human volunteers were performed. The results showed that the proposed system had the advantages of small size, reduced initial time (~23.5 min), and good immunity to fluctuations of the air temperature. For the range of 37-41 °C on the hot plate, the error compared with a Fluke high accuracy thermometer was 0.08 ± 0.20 °C. In the human experiments, the measured temperature in the rest trial (34 subjects) had a difference of 0.13 ± 0.22 °C compared with sublingual temperature, while a significant increase of 1.36 ± 0.44 °C from rest to jogging was found in the exercise trial (30 subjects). This system has the potential for reliable continuous CBT measurement in rest and can reflect CBT variations during exercise.
Minimum Lens Size Supporting the Leaky-Wave Nature of Slit Dipole Antenna at Terahertz Frequency
Directory of Open Access Journals (Sweden)
Niamat Hussain
2016-01-01
Full Text Available We designed a slit dipole antenna backed by an extended hemispherical silicon lens and investigated the minimum lens size in which the slit dipole antenna works as a leaky-wave antenna. The slit dipole antenna consists of a planar feeding structure, which is a center-fed and open-ended slot line. A slit dipole antenna backed by an extended hemispherical silicon lens is investigated over a frequency range from 0.2 to 0.4 THz with the center frequency at 0.3 THz. The numerical results show that the antenna gain responses exhibited an increased level of sensitivity to the lens size and increased linearly with increasing lens radius. The lens with the radius of 1.2λo is found to be the best possible minimum lens size for a slit dipole antenna on an extended hemispherical silicon lens.
Biess, J. J.; Inouye, L. Y.; Shank, J. H.
1974-01-01
A high-voltage, high-power LC series resonant inverter using SCRs has been developed for an Ion Engine Power Processor. The inverter operates within 200-400Vdc with a maximum output power of 2.5kW. The inverter control logic, the screen supply electrical and mechanical characteristics, the efficiency and losses in power components, regulation on the dual feedback principle, the SCR waveforms and the component weight are analyzed. Efficiency of 90.5% and weight density of 4.1kg/kW are obtained.
Nanodiamond-Manganese dual mode MRI contrast agents for enhanced liver tumor detection.
Hou, Weixin; Toh, Tan Boon; Abdullah, Lissa Nurrul; Yvonne, Tay Wei Zheng; Lee, Kuan J; Guenther, Ilonka; Chow, Edward Kai-Hua
2017-04-01
Contrast agent-enhanced magnetic resonance (MR) imaging is critical for the diagnosis and monitoring of a number of diseases, including cancer. Certain clinical applications, including the detection of liver tumors, rely on both T1 and T2-weighted images even though contrast agent-enhanced MR imaging is not always reliable. Thus, there is a need for improved dual mode contrast agents with enhanced sensitivity. We report the development of a nanodiamond-manganese dual mode contrast agent that enhanced both T1 and T2-weighted MR imaging. Conjugation of manganese to nanodiamonds resulted in improved longitudinal and transverse relaxivity efficacy over unmodified MnCl 2 as well as clinical contrast agents. Following intravenous administration, nanodiamond-manganese complexes outperformed current clinical contrast agents in an orthotopic liver cancer mouse model while also reducing blood serum concentration of toxic free Mn 2+ ions. Thus, nanodiamond-manganese complexes may serve as more effective dual mode MRI contrast agent, particularly in cancer. Copyright © 2016 Elsevier Inc. All rights reserved.
In-situ Mechanical Manipulation of Wellbore Cements as a Solution to Leaky Wells
Kupresan, D.; Radonjic, M.; Heathman, J.
2013-12-01
mechanical manipulation (shear stress). The main advantage of this methodology is that mechanical manipulation of cement can induce healing of existing fractures, channels and microannulus seal in a wellbore without introducing new materials (e.g. cement squeeze jobs). Furthermore, this methodology is less sensitive to the influence of downhole conditions such as pressure, temperature and formation fluids, since it uses cement pore water as a medium to alter cement sheath. Based on lab experiments observation, it is possible to perceive that once tested at the industrial scale and if successful, the implementation of this method in the field can potentially mitigate leaky wells in CO2 sequestration projects, wellbores completed for hydraulic-fracturing and other conventional oil and gas producing wells. Key words: Wellbore cement integrity; Leaky wells; Cement microstructures; Casing expansion effect on cement mineralogy alterations.
Energy Technology Data Exchange (ETDEWEB)
Kołtunowicz, Tomasz N., E-mail: t.koltunowicz@pollub.pl [Department of Electrical Devices and High Voltage Technology, Lublin University of Technology, Nadbystrzycka 38a, 20-618 Lublin (Poland); Zukowski, Pawel [Department of Electrical Devices and High Voltage Technology, Lublin University of Technology, Nadbystrzycka 38a, 20-618 Lublin (Poland); Sidorenko, Julia [Department of Semiconductors Physics and Nanoelectronics, Belarusian State University, Independence Av. 4, 220030 Minsk (Belarus); Bayev, Vadim; Fedotova, Julia A. [Institute for Nuclear Problems, Belarusian State University, Bobrujskaya Str. 11, 220030 Minsk (Belarus); Opielak, Marek [Institute of Transport, Combustion Engines and Ecology, Lublin University of Technology, Nadbystrzycka 36, 20-618 Lublin (Poland); Marczuk, Andrzej [Department of Transporting and Agricultural Machinery, University of Life Sciences in Lublin, Głeboka 28, 20-612 Lublin (Poland)
2017-01-01
Ferromagnetic resonance (FMR) spectroscopy is applied for comparative analysis of granular (CoFeZ){sub x}(Al{sub 2}O{sub 3}){sub 100−x}, (31 at%≤x≤47 at%) films containing pure FeCo-based nanoparticles (NPs) or “FeCo-based core – oxide shell” NPs inside Al{sub 2}O{sub 3} matrix when deposited in oxygen-free or oxygen-containing atmosphere, correspondingly. It is established that g-factor extracted from the FMR spectra of films with core–shell NPs decreases with x below the value g =2.0023 for free electron that is untypical for metallic NPs. This effect is associated with the formation of the interface between ferromagnetic core and antiferromagnetic (ferrimagnetic) oxide shell of NPs. - Highlights: • CoFeZr-Al{sub 2}O{sub 3} granular films containing “FeCo core – oxide shell” nanoparticles. • magnetic anisotropy of (CoFeZr){sub x}(Al{sub 2}O{sub 3}){sub 100−x} films is of an easy plane type. • essential difference in dependence of g-factor on metal content in non- and oxidized film. • non-oxidized samples indicates the reduction of the value of films magnetization.
Dual-probe spectroscopic fingerprints of defects in graphene
DEFF Research Database (Denmark)
Settnes, Mikkel; Power, Stephen; Petersen, Dirch Hjorth
2014-01-01
(e.g., an extended graphene sheet). Applying this method, we study the transport anisotropies in pristine graphene sheets, and analyze the spectroscopic fingerprints arising from quantum interference around single-site defects, such as vacancies and adatoms. Furthermore, we demonstrate that the dual......-probe setup is a useful tool for characterizing the electronic transport properties of extended defects or designed nanostructures. In particular, we show that nanoscale perforations, or antidots, in a graphene sheet display Fano-type resonances with a strong dependence on the edge geometry of the perforation....
Directory of Open Access Journals (Sweden)
Topor Marcel
2017-01-01
Full Text Available This paper introduces a novel brushless, single winding and single stator, dual PM rotor axial-air-gap machine capable to deliver independently torque at the two rotors by adequate dual vector control. The proposed topologies, the circuit model, controlled dynamics simulation and preliminary 3D FEM torque production on a case study constitute the core of the paper. The proposed dual mechanical port system should be instrumental in parallel (with planetary gears or series hybrid electric vehicles (HEV aiming at a more compact and efficient electric propulsion system solution.
PZT crack detection in suspension-based dual stage actuator [for HDDs
Yung Ping Yeh; Ku, C
2000-01-01
An impedance method is proposed to detect cracks of PZT bars in suspension based dual stage-actuators. The frequency response amplitude of impedance at the resonance of 1.95 MHz, the PZT bar width extension mode, was very sensitive to the cracks in PZT material. As cracks in the PZT bars propagated from invisible micro cracks to visible macro cracks, the impedance gain at 1.95 MHz dropped suddenly. (3 refs).
Cheng, Jinbing; Lu, Yang; Qiu, Kangwen; Yan, Hailong; Xu, Jinyou; Han, Lei; Liu, Xianming; Luo, Jingshan; Kim, Jang-Kyo; Luo, Yongsong
2015-07-01
We report the synthesis of three dimensional (3D) NiCo2O4@NiCo2O4 nanocactus arrays grown directly on a Ni current collector using a facile solution method followed by electrodeposition. They possess a unique 3D hierarchical core-shell structure with large surface area and dual-functionalities that can serve as electrodes for both supercapacitors (SCs) and lithium-ion batteries (LIBs). As the SC electrode, they deliver a remarkable specific capacitance of 1264 F g-1 at a current density of 2 A g-1 and ~93.4% of capacitance retention after 5000 cycles at 2 A g-1. When used as the anode for LIBs, a high reversible capacity of 925 mA h g-1 is achieved at a rate of 120 mA g-1 with excellent cyclic stability and rate capability. The ameliorating features of the NiCo2O4 core/shell structure grown directly on highly conductive Ni foam, such as hierarchical mesopores, numerous hairy needles and a large surface area, are responsible for the fast electron/ion transfer and large active sites which commonly contribute to the excellent electrochemical performance of both the SC and LIB electrodes.
Dual Credit/Dual Enrollment and Data Driven Policy Implementation
Lichtenberger, Eric; Witt, M. Allison; Blankenberger, Bob; Franklin, Doug
2014-01-01
The use of dual credit has been expanding rapidly. Dual credit is a college course taken by a high school student for which both college and high school credit is given. Previous studies provided limited quantitative evidence that dual credit/dual enrollment is directly connected to positive student outcomes. In this study, predictive statistics…
Kang, Bo-Kyeong; Yu, Eun Sil; Lee, Seung Soo; Lee, Youngjoo; Kim, Namkug; Sirlin, Claude B; Cho, Eun Yoon; Yeom, Suk Keu; Byun, Jae Ho; Park, Seong Ho; Lee, Moon-Gyu
2012-06-01
The aims of this study were to assess the confounding effects of hepatic iron deposition, inflammation, and fibrosis on hepatic steatosis (HS) evaluation by magnetic resonance imaging (MRI) and magnetic resonance spectroscopy (MRS) and to assess the accuracies of MRI and MRS for HS evaluation, using histology as the reference standard. In this institutional review board-approved prospective study, 56 patients gave informed consents and underwent chemical-shift MRI and MRS of the liver on a 1.5-T magnetic resonance scanner. To estimate MRI fat fraction (FF), 4 analysis methods were used (dual-echo, triple-echo, multiecho, and multi-interference), and MRS FF was calculated with T2 correction. Degrees of HS, iron deposition, inflammation, and fibrosis were analyzed in liver resection (n = 37) and biopsy (n = 19) specimens. The confounding effects of histology on fat quantification were assessed by multiple linear regression analysis. Using the histologic degree of HS as the reference standard, the accuracies of each method in estimating HS and diagnosing an HS of 5% or greater were determined by linear regression and receiver operating characteristic analyses. Iron deposition significantly confounded estimations of FF by the dual-echo (P hepatic fat, with coexisting histologic abnormalities having no confounding effects.
An Overview of Resonant Circuits for Wireless Power Transfer
Directory of Open Access Journals (Sweden)
Chaoqiang Jiang
2017-06-01
Full Text Available With ever-increasing concerns for the safety and convenience of the power supply, there is a fast growing interest in wireless power transfer (WPT for industrial devices, consumer electronics, and electric vehicles (EVs. As the resonant circuit is one of the cores of both the near-field and far-field WPT systems, it is a pressing need for researchers to develop a high-efficiency high-frequency resonant circuit, especially for the mid-range near-field WPT system. In this paper, an overview of resonant circuits for the near-field WPT system is presented, with emphasis on the non-resonant converters with a resonant tank and resonant inverters with a resonant tank as well as compensation networks and selective resonant circuits. Moreover, some key issues including the zero-voltage switching, zero-voltage derivative switching and total harmonic distortion are addressed. With the increasing usage of wireless charging for EVs, bidirectional resonant inverters for WPT based vehicle-to-grid systems are elaborated.
Bigot-Astruc, Marianne; Molin, Denis; Sillard, Pierre
2014-11-04
A depressed graded-index multimode optical fiber includes a central core, an inner depressed cladding, a depressed trench, an outer depressed cladding, and an outer cladding. The central core has an alpha-index profile. The depressed claddings limit the impact of leaky modes on optical-fiber performance characteristics (e.g., bandwidth, core size, and/or numerical aperture).
Quantum damped oscillator I: Dissipation and resonances
International Nuclear Information System (INIS)
Chruscinski, Dariusz; Jurkowski, Jacek
2006-01-01
Quantization of a damped harmonic oscillator leads to so called Bateman's dual system. The corresponding Bateman's Hamiltonian, being a self-adjoint operator, displays the discrete family of complex eigenvalues. We show that they correspond to the poles of energy eigenvectors and the corresponding resolvent operator when continued to the complex energy plane. Therefore, the corresponding generalized eigenvectors may be interpreted as resonant states which are responsible for the irreversible quantum dynamics of a damped harmonic oscillator
Dual layer hollow fiber sorbents for trace H2S removal from gas streams
Bhandari, Dhaval A.; Bessho, Naoki; Koros, William J.
2013-01-01
Hollow fiber sorbents are pseudo monolithic materials with potential use in various adsorption based applications. Dual layer hollow fiber sorbents have the potential to allow thermal regeneration without direct contact of the regeneration fluid with the sorbent particles. This paper considers the application of dual layer hollow fiber sorbents for a case involving trace amounts of H2S removal from a simulated gas stream and offers a comparison with single layer hollow fiber sorbents. The effect of spin dope composition and core layer zeolite loading on the gas flux, H2S transient sorption capacity and pore structure are also studied. This work can be used as a guide to develop and optimize dual layer hollow fiber sorbent properties beyond the specific example considered here. © 2013 Elsevier Ltd.
Dual layer hollow fiber sorbents for trace H2S removal from gas streams
Bhandari, Dhaval A.
2013-05-01
Hollow fiber sorbents are pseudo monolithic materials with potential use in various adsorption based applications. Dual layer hollow fiber sorbents have the potential to allow thermal regeneration without direct contact of the regeneration fluid with the sorbent particles. This paper considers the application of dual layer hollow fiber sorbents for a case involving trace amounts of H2S removal from a simulated gas stream and offers a comparison with single layer hollow fiber sorbents. The effect of spin dope composition and core layer zeolite loading on the gas flux, H2S transient sorption capacity and pore structure are also studied. This work can be used as a guide to develop and optimize dual layer hollow fiber sorbent properties beyond the specific example considered here. © 2013 Elsevier Ltd.
International Nuclear Information System (INIS)
McCulloch, D.B.; Hoskins, T.A.
1963-01-01
Experiments have been carried out using a fuel element comprising a 2.75 in. o.d./2.40 in. i.d. natural uranium tube containing a graphite core of diameter 2.0 in. Values of material buckling and migration area asymmetry for lattices at 7 in., 8 in. and 8/2 in. pitch have been obtained, and correlated with the theory of Syrett (1961) to derive an effective resonance integral for the cored element. By comparison with the resonance integral for the same fuel tube without a core, a value for the constant 'γ' of the theory of Stace (1959) is obtained. (author)
Hollow-core fibers for high power pulse delivery
DEFF Research Database (Denmark)
Michieletto, Mattia; Lyngsø, Jens K.; Jakobsen, Christian
2016-01-01
We investigate hollow-core fibers for fiber delivery of high power ultrashort laser pulses. We use numerical techniques to design an anti-resonant hollow-core fiber having one layer of non-touching tubes to determine which structures offer the best optical properties for the delivery of high power...... picosecond pulses. A novel fiber with 7 tubes and a core of 30 mu m was fabricated and it is here described and characterized, showing remarkable low loss, low bend loss, and good mode quality. Its optical properties are compared to both a 10 mu m and a 18 mu m core diameter photonic band gap hollow......-core fiber. The three fibers are characterized experimentally for the delivery of 22 picosecond pulses at 1032nm. We demonstrate flexible, diffraction limited beam delivery with output average powers in excess of 70W. (C) 2016 Optical Society of America...
Terahertz-wave differential detection based on simultaneous dual-wavelength up-conversion
Directory of Open Access Journals (Sweden)
Yuma Takida
2017-03-01
Full Text Available We report a terahertz (THz-wave differential detection based on simultaneous dual-wavelength up-conversion in a nonlinear optical MgO:LiNbO3 crystal with optical and electronic THz-wave sources. The broadband parametric gain and noncollinear phase-matching of MgO:LiNbO3 provide efficient conversion from superposed THz waves to spatially distributed near-infrared (NIR beams to function as a dispersive THz-wave spectrometer without any additional dispersive element. We show that the μW-level THz waves from two independent sources, a 0.78-THz injection-seeded THz-wave parametric generator (is-TPG and a 1.14-THz resonant tunneling diode (RTD, are simultaneously up-converted to two NIR waves and then detected with two NIR photodetectors. By applying a balanced detection scheme to this dual-frequency detection, we demonstrate THz-wave differential imaging of maltose and polyethylene pellets in the transmission geometry. This dual-wavelength detection is applicable to more than three frequencies and broadband THz-wave radiation for real-time THz-wave spectroscopic detection and imaging.
Yang, Hong; Zhao, Fenglong; Li, Ying; Xu, Mingming; Li, Li; Wu, Chunhui; Miyoshi, Hirokazu; Liu, Yiyao
2013-01-01
Multifunctional nanomaterials with unique magnetic and luminescent properties have broad potential in biological applications. Because of the overexpression of vascular cell adhesion molecule-1 (VCAM-1) receptors in inflammatory endothelial cells as compared with normal endothelial cells, an anti-VCAM-1 monoclonal antibody can be used as a targeting ligand. Herein we describe the development of multifunctional core-shell Fe(3)O(4)@SiO2 nanoparticles with the ability to target inflammatory endothelial cells via VCAM-1, magnetism, and fluorescence imaging, with efficient magnetic resonance imaging contrast characteristics. Superparamagnetic iron oxide and fluorescein isothiocyanate (FITC) were loaded successfully inside the nanoparticle core and the silica shell, respectively, creating VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles that were characterized by scanning electron microscopy, transmission electron microscopy, fluorescence spectrometry, zeta potential assay, and fluorescence microscopy. The VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles typically had a diameter of 355 ± 37 nm, showed superparamagnetic behavior at room temperature, and cumulative and targeted adhesion to an inflammatory subline of human umbilical vein endothelial cells (HUVEC-CS) activated by lipopolysaccharide. Further, our data show that adhesion of VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles to inflammatory HUVEC-CS depended on both shear stress and duration of exposure to stress. Analysis of internalization into HUVEC-CS showed that the efficiency of delivery of VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles was also significantly greater than that of nontargeted Fe(3)O(4)@SiO2(FITC)-NH2 nanoparticles. Magnetic resonance images showed that the superparamagnetic iron oxide cores of the VCAM-1-targeted Fe(3)O(4)@SiO2(FITC) nanoparticles could also act as a contrast agent for magnetic resonance imaging. Taken together, the cumulative adhesion and uptake potential of
Development of sustained and dual drug release co-extrusion formulations for individual dosing.
Laukamp, Eva Julia; Vynckier, An-Katrien; Voorspoels, Jody; Thommes, Markus; Breitkreutz, Joerg
2015-01-01
In personalized medicine and patient-centered medical treatment individual dosing of medicines is crucial. The Solid Dosage Pen (SDP) allows for an individual dosing of solid drug carriers by cutting them into tablet-like slices. The aim of the present study was the development of sustained release and dual release formulations with carbamazepine (CBZ) via hot-melt co-extrusion for the use in the SDP. The selection of appropriate coat- and core-formulations was performed by adapting the mechanical properties (like tensile strength and E-modulus) for example. By using different excipients (polyethyleneglycols, poloxamers, white wax, stearic acid, and carnauba wax) and drug loadings (30-50%) tailored dissolution kinetics was achieved showing cube root or zero order release mechanisms. Besides a biphasic drug release, the dose-dependent dissolution characteristics of sustained release formulations were minimized by a co-extruded wax-coated formulation. The dissolution profiles of the co-extrudates were confirmed during short term stability study (six months at 21.0 ± 0.2 °C, 45%r.h.). Due to a good layer adhesion of core and coat and adequate mechanical properties (maximum cutting force of 35.8 ± 2.0 N and 26.4 ± 2.8 N and E-modulus of 118.1 ± 8.4 and 33.9 ± 4.5 MPa for the dual drug release and the wax-coated co-extrudates, respectively) cutting off doses via the SDP was precise. While differences of the process parameters (like the barrel temperature) between the core- and the coat-layer resulted in unsatisfying content uniformities for the wax-coated co-extrudates, the content uniformity of the dual drug release co-extrudates was found to be in compliance with pharmacopoeial specification. Copyright © 2015 Elsevier B.V. All rights reserved.
M. Oudkerk (Matthijs); C.G. Torres; B. Song; M. Konig; J. Grimm; J. Fernandez-Cuadrado; B. op de Beeck; M. Marquardt; P. van Dijk (Pieter); J.C. de Groot (Jan Cees)
2002-01-01
textabstractPURPOSE: To evaluate whether mangafodipir trisodium (Mn-DPDP)-enhanced magnetic resonance (MR) imaging surpasses dual-phase spiral computed tomography (CT) in differentiating focal liver lesions. MATERIALS AND METHODS: One hundred forty-five patients who had or were
Directory of Open Access Journals (Sweden)
Yaqeen S Mezaal
Full Text Available A compact dual-mode microstrip bandpass filter using geometrical slot is presented in this paper. The adopted geometrical slot is based on first iteration of Cantor square fractal curve. This filter has the benefits of possessing narrower and sharper frequency responses as compared to microstrip filters that use single mode resonators and traditional dual-mode square patch resonators. The filter has been modeled and demonstrated by Microwave Office EM simulator designed at a resonant frequency of 2 GHz using a substrate of εr = 10.8 and thickness of h = 1.27 mm. The output simulated results of the proposed filter exhibit 22 dB return loss, 0.1678 dB insertion loss and 12 MHz bandwidth in the passband region. In addition to the narrow band gained, miniaturization properties as well as weakened spurious frequency responses and blocked second harmonic frequency in out of band regions have been acquired. Filter parameters including insertion loss, return loss, bandwidth, coupling coefficient and external quality factor have been compared with different values of perturbation dimension (d. Also, a full comparative study of this filter as compared with traditional square patch filter has been considered.
Directory of Open Access Journals (Sweden)
Eric K Hoobler
Full Text Available We report the discovery of a novel dual inhibitor targeting fungal sterol 14α-demethylase (CYP51 or Erg11 and human 5-lipoxygenase (5-LOX with improved potency against 5-LOX due to its reduction of the iron center by its phenylenediamine core. A series of potent 5-LOX inhibitors containing a phenylenediamine core, were synthesized that exhibit nanomolar potency and >30-fold selectivity against the LOX paralogs, platelet-type 12-human lipoxygenase, reticulocyte 15-human lipoxygenase type-1, and epithelial 15-human lipoxygenase type-2, and >100-fold selectivity against ovine cyclooxygenase-1 and human cyclooxygnease-2. The phenylenediamine core was then translated into the structure of ketoconazole, a highly effective anti-fungal medication for seborrheic dermatitis, to generate a novel compound, ketaminazole. Ketaminazole was found to be a potent dual inhibitor against human 5-LOX (IC50 = 700 nM and CYP51 (IC50 = 43 nM in vitro. It was tested in whole blood and found to down-regulate LTB4 synthesis, displaying 45% inhibition at 10 µM. In addition, ketaminazole selectively inhibited yeast CYP51 relative to human CYP51 by 17-fold, which is greater selectivity than that of ketoconazole and could confer a therapeutic advantage. This novel dual anti-fungal/anti-inflammatory inhibitor could potentially have therapeutic uses against fungal infections that have an anti-inflammatory component.
Dual-band and high-efficiency polarization converter based on metasurfaces at microwave frequencies
Liu, Yajun; Xia, Song; Shi, Hongyu; Zhang, Anxue; Xu, Zhuo
2016-06-01
We present a dual-band and high-efficiency polarization converter in microwave regime. The proposed converter can convert a linearly polarized wave to its cross-polarized wave for two distinct bands: Ku (11.5-20.0 GHz) and Ka (28.8-34.0 GHz). It can also convert the linearly polarized wave to a circularly polarized wave at four other frequencies. The experimental results are in good agreement with simulation results for both frequency bands. The polarization conversion ratio is above 0.94 for the Ku-band and 0.90 for the Ka-band. Furthermore, the converter can achieve dual-band and high-efficiency polarization conversion over angles of incidence up to 45°. The converter is also polarization-selective in that only the x- and y-polarized waves can be converted. The physical mechanism of the dual-band polarization conversion effect is interpreted via decomposed electric field components that couple with different plasmon resonance modes of the structure.
Saturn's F Ring Core: Calm in the Midst of Chaos
Cuzzi, J. N.; Whizin, A. D.; Hogan, R. C.; Dobrovolskis, A. R.; Dones, L.; Showalter. M. R.; Colwell, J. E.; Scargle, J. D.
2013-01-01
The long-term stability of the narrow F Ring core has been hard to understand. Instead of acting as "shepherds", Prometheus and Pandora together stir the vast preponderance of the region into a chaotic state, consistent with the orbits of newly discovered objects like S/2004S6. We show how a comb of very narrow radial locations of high stability in semimajor axis is embedded within this otherwise chaotic region. The stability of these semimajor axes relies fundamentally on the unusual combination of rapid apse precession and long synodic period which characterizes the region. This situation allows stable "antiresonances" to fall on or very close to traditional Lindblad resonances which, under more common circumstances, are destabilizing. We present numerical integrations of tens of thousands of test particles over tens of thousands of Prometheus orbits that map out the effect. The stable antiresonance zones are most stable in a subset of the region where Prometheus first-order resonances are least cluttered by Pandora resonances. This region of optimum stability is paradoxically closer to Prometheus than a location more representative of "torque balance", helping explain a longstanding paradox. One stable zone corresponds closely to the currently observed semimajor axis of the F Ring core. While the model helps explain the stability of the narrow F Ring core, it does not explain why the F Ring material all shares a common apse longitude; we speculate that collisional damping at the preferred semimajor axis (not included in the current simulations) may provide that final step. Essentially, we find that the F Ring core is not confined by a combination of Prometheus and Pandora, but a combination of Prometheus and precession.
Simultaneous live cell imaging using dual FRET sensors with a single excitation light.
Directory of Open Access Journals (Sweden)
Yusuke Niino
Full Text Available Fluorescence resonance energy transfer (FRET between fluorescent proteins is a powerful tool for visualization of signal transduction in living cells, and recently, some strategies for imaging of dual FRET pairs in a single cell have been reported. However, these necessitate alteration of excitation light between two different wavelengths to avoid the spectral overlap, resulting in sequential detection with a lag time. Thus, to follow fast signal dynamics or signal changes in highly motile cells, a single-excitation dual-FRET method should be required. Here we reported this by using four-color imaging with a single excitation light and subsequent linear unmixing to distinguish fluorescent proteins. We constructed new FRET sensors with Sapphire/RFP to combine with CFP/YFP, and accomplished simultaneous imaging of cAMP and cGMP in single cells. We confirmed that signal amplitude of our dual FRET measurement is comparable to of conventional single FRET measurement. Finally, we demonstrated to monitor both intracellular Ca(2+ and cAMP in highly motile cardiac myocytes. To cancel out artifacts caused by the movement of the cell, this method expands the applicability of the combined use of dual FRET sensors for cell samples with high motility.
A plug’n’play WiFi surface-mount dual-loop antenna
Directory of Open Access Journals (Sweden)
Pedro Chamorro-Posada
2017-04-01
Full Text Available We present the design, modelling and characterization in the 2.4 GHz band of a B-shaped antenna consisting of a dual circular loop over a conductor plane. The proposed design is intrinsically unbalanced and features a very good match to a 50 Ω line at resonance, which makes our device essentially plug’n’play for a coaxial cable feed. Another interesting property of the proposed antenna is its simplicity of construction. The antenna has been modelled using the moment method. A prototype resonant at 2.4 GHz has been built and we have measured its impedance in this spectral region. The radiation pattern and the gain at resonance have also been characterized and the device has been shown to provide 6.31 dBi gain. The overall properties of the device make it an excellent option to provide WiFi connectivity when required in open hardware implementations.
Guided-mode resonant filters and reflectors: Principles, design, and fabrication
Niraula, Manoj
In this dissertation, we overview the operational principles of these resonant periodic structures, discuss the methods of their design and fabrication, and propose and demonstrate novel functionalities for spatial and spectral filtering, and unpolarized wideband reflection. Fashioned with materially sparse gratings, these optical devices are easy to fabricate and integration friendly compared to their traditional multi-layer counterparts making their research and development critical for practical applications. We study, theoretically, modal properties and parametric dependence of resonant periodic bandpass filters operating in the mid- and near-infrared spectral domains. We investigate three different device architectures consisting of single, double, and triple layers based on all-transparent dielectric and semiconductor thin films. We present three modal coupling configurations forming complex mixtures of two or three distinct leaky modes coupling at different evanescent diffraction orders. Our modal analysis demonstrates key attributes of subwavelength periodic thin-film structures in multiple-modal blending to achieve desired transmission spectra. We provide the first experimental demonstration of high-efficiency and narrow-linewidth resonant bandpass filter applying a single patterned silicon layer on a quartz substrate. Its performance corresponds to bandpass filters requiring 15 traditional Si/SiO2 thin-film layers. The feasibility of sparse narrowband, high-efficiency bandpass filters with extremely wide, flat, and low sidebands is thereby demonstrated. The proposed technology is integration-friendly and opens doors for further development in various disciplines and spectral regions where thin-film solutions are traditionally applied. We demonstrate concurrent spatial and spectral filtering as a new outstanding attribute of resonant periodic devices. This functionality is enabled by a unique, near-complete, reflection state that is discrete in both
Quench detection of superconducting magnet by dual-core optical fiber
International Nuclear Information System (INIS)
Tsukamoto, O.; Kawai, K.; Kokubun, Y.; Takao, T.
1988-01-01
A quench-detecting technique using two single-mode optical cores in one fiber has been developed. The technique can detect quench from a temperature rise of 1.0 K at 4.2 K. An electromagnetic force-stress to the fiber did not deteriorate quench detection sensitivity. A quench detector using this method was immune from electromagnetic noise and free from troubles caused by high voltage tension. Problems arising when applying this method to a large scale magnet and possible improvements in the instrumentation are discussed
Alexander, Anthony J; Ma, Lianjia
2009-02-27
This paper focuses on the application of RPLC x RPLC to pharmaceutical analysis and addresses the specific problem of separating co-eluting impurities/degradation products that maybe "hidden" within the peak envelope of the active pharmaceutical ingredient (API) and thus may escape detection by conventional methods. A comprehensive two-dimensional liquid chromatograph (LC x LC) was constructed from commercially available HPLC equipment. This system utilizes two independently configurable 2nd dimension binary pumping systems to deliver independent flow rates, gradient profiles and mobile phase compositions to dual Fused-Core secondary columns. Very fast gradient separations (30s total cycle time) were achieved at ambient temperature without excessive backpressure and without compromising optimal 1st dimension sampling rates. The operation of the interface is demonstrated for the analysis of a 1mg/ml standard mixture containing 0.05% of a minor component. The practicality of using RPLC x RPLC for the analysis of actual co-eluting pharmaceutical degradation products, by exploiting pH-induced changes in selectivity, is also demonstrated using a three component mixture. This mixture (an API, an oxidation product of the API at 1.0%, w/w, and a photo degradant of the API at 0.5%, w/w) was used to assess the stability indicating nature of an established LC method for analysis of the API.
Polymer dual ring resonators for label-free optical biosensing using microfluidics.
Salleh, Muhammad H M; Glidle, Andrew; Sorel, Marc; Reboud, Julien; Cooper, Jonathan M
2013-04-18
We demonstrate a polymer resonator microfluidic biosensor that overcomes the complex manufacturing procedures required to fabricate traditional devices. In this new format, we show that a gapless light coupling photonic configuration, fabricated in SU8 polymer, can achieve high sensitivity, label-free chemical sensing in solution and high sensitivity biological sensing, at visible wavelengths.
International Nuclear Information System (INIS)
Ohno, Masahide
2006-01-01
The Si K-LL resonant Auger-electron spectroscopy (RAES) spectra of silicon delta dopped layers in GaAs with very thin capping layers show both normal Auger decay and resonant Auger decay, when the core-level electron is excited to the conduction band. The resonant Auger peak kinetic energy (KE) shows no dispersion with photon energy, except when excited by the highest energy photons [M.D. Jackson, J.M.C. Thornton, D. Lewis, A. Robinson, M. Fahy, A. Aviary, P. Weightman, Phys. Rev. B71 (2005) 075313]. The RAES spectra are analyzed using a many-body theory. The presence of resonant Auger decay and no dispersion of resonant Auger peak KE with photon energy is explained in terms of the relaxation of a metastable excited core-hole state to a stable one on the time scale of core-hole decay. The excited electron in the conduction band either delocalizes rapidly leaving the ionized Si to decay by a normal Auger decay or drops to a state localized in the Si delta layer before the core-hole decays so that the RAES spectrum has both normal Auger decay and resonant Auger decay. As a result of the relaxation, the resonant Auger peak KE does not show any dispersion with photon energy. The variations with photon energy of the normal or resonant Auger peak intensity, KE, and width are explained in a consistent manner by a many-body theory
International Nuclear Information System (INIS)
Petcov, S.T.
1999-01-01
It is shown that the ν 2 → ν e and ν μ → ν e (ν e → ν μ(τ) ) transitions respectively of the solar and atmospheric neutrinos in the Earth in the case of ν e - ν μ(τ) mixing in vacuum, are strongly enhanced by a new type of resonance when the neutrinos cross the Earth core. The resonance is operative at small mixing angles but differs from the MSW one. It is in many respects similar to the electron paramagnetic resonance taking place in a specific configuration of two magnetic fields. The conditions for existence of the new resonance include, in particular, specific constraints on the neutrino oscillation lengths in the Earth mantle and in the Earth core, thus the resonance is a 'neutrino oscillation length resonance'. It leads also to enhancement of the ν 2 → ν e and ν e → ν s transitions in the case of ν e - ν s mixing and of the ν-bar s (or ν μ → ν s ) transitions at small mixing angles. The presence of the neutrino oscillation length resonance in the transitions of solar and atmospheric neutrinos traversing the Earth core has important implications for current and future solar and atmospheric neutrino experiments, and more specifically, for the interpretation of the results of the Super-Kamiokande experiment
Shape resonance in K-shell photodetachment from C-
International Nuclear Information System (INIS)
Walter, C. W.; Gibson, N. D.; Bilodeau, R. C.; Berrah, N.; Bozek, J. D.; Ackerman, G. D.; Aguilar, A.
2006-01-01
The core-excited (1s2s 2 2p 4 4 P) negative ion shape resonance of C - near 281.7 eV has been investigated using the merged ion beam--photon beam photodetachment technique on the Advanced Light Source beamline 10.0.1. C + ions formed by double detachment were detected as a function of photon energy. Higher resolution spectra yield more precise values for the energy and width of the resonance than our previous measurements [N. D. Gibson et al., Phys. Rev. A 67, 030703(R) (2003)]. The absolute cross section for double detachment from C - following 1s photoexcitation is measured for the first time and the spectrum is compared to previous theoretical calculations. These measurements also provide information on the lowest core-excited state of neutral carbon (1s2s 2 2p 3 5 S)
Localized surface plasmon resonance properties of symmetry-broken Au-ITO-Ag multilayered nanoshells
Lv, Jingwei; Mu, Haiwei; Lu, Xili; Liu, Qiang; Liu, Chao; Sun, Tao; Chu, Paul K.
2018-06-01
The plasmonic properties of symmetry-broken Au-ITO-Ag multilayered nanoshells by shell cutting are studied by the finite element method. The influence of the polarization of incident light and geometrical parameters on the plasmon resonances of the multilayered nanoshells are investigated. The polarization-dependent multiple plasmon resonances appear from the multilayered nanoshells due to symmetry breaking. In nanostructures with a broken symmetry, the localized surface plasmon resonance modes are enhanced resulting in higher order resonances. According to the plasmon hybridization theory, these resonance modes and greater spectral tunability derive from the interactions of an admixture of both primitive and multipolar modes between the inner Au core and outer Ag shell. By changing the radius of the Au core, the extinction resonance modes of the multilayered nanoshells can be easily tuned to the near-infrared region. To elucidate the symmetry-broken effects of multilayered nanoshells, we link the geometrical asymmetry to the asymmetrical distributions of surface charges and demonstrate dipolar and higher order plasmon modes with large associated field enhancements at the edge of the Ag rim. The spectral tunability of the multiple resonance modes from visible to near-infrared is investigated and the unique properties are attractive to applications including angularly selective filtering to biosensing.
Martínez-Araya, Jorge I; Yepes, Diana; Jaque, Pablo
2017-12-27
Six organometallic compounds coming from a basic Mo-based complex were analyzed from the perspective of the dual descriptor in order to detect subtle influences that a substituent group could exert on the reactive core at a long range. Since the aforementioned complexes are open-shell systems, the used operational formula for the dual descriptor is that one defined for those aforementioned systems, which was then compared with spin density. In addition, dual descriptor was decomposed into two terms, each of which was also applied on every molecular system. The obtained results indicated that components of dual descriptor could become more useful than the operational formula of dual descriptor because differences exerted by the substituents at the para position were better detected by components of dual descriptor rather than the dual descriptor by itself.
Ledentsov, N.; Shchukin, V. A.; Kropp, J.-R.; Burger, S.; Schmidt, F.; Ledentsov, N. N.
2016-03-01
Oxide-confined apertures in vertical cavity surface emitting laser (VCSEL) can be engineered such that they promote leakage of the transverse optical modes from the non- oxidized core region to the selectively oxidized periphery of the device. The reason of the leakage is that the VCSEL modes in the core can be coupled to tilted modes in the periphery if the orthogonality between the core mode and the modes at the periphery is broken by the oxidation-induced optical field redistribution. Three-dimensional modeling of a practical VCSEL design reveals i) significantly stronger leakage losses for high-order transverse modes than that of the fundamental one as high-order modes have a higher field intensity close to the oxide layers and ii) narrow peaks in the far-field profile generated by the leaky component of the optical modes. Experimental 850-nm GaAlAs leaky VCSELs produced in the modeled design demonstrate i) single-mode lasing with the aperture diameters up to 5μm with side mode suppression ratio >20dB at the current density of 10kA/cm2; and ii) narrow peaks tilted at 37 degrees with respect to the vertical axis in excellent agreement with the modeling data and confirming the leaky nature of the modes and the proposed mechanism of mode selection. The results indicate that in- plane coupling of VCSELs, VCSELs and p-i-n photodiodes, VCSEL and delay lines is possible allowing novel photonic integrated circuits. We show that the approach enables design of oxide apertures, air-gap apertures, devices created by impurity-induced intermixing or any combinations of such designs through quantitative evaluation of the leaky emission.
Highly parallel line-based image coding for many cores.
Peng, Xiulian; Xu, Jizheng; Zhou, You; Wu, Feng
2012-01-01
Computers are developing along with a new trend from the dual-core and quad-core processors to ones with tens or even hundreds of cores. Multimedia, as one of the most important applications in computers, has an urgent need to design parallel coding algorithms for compression. Taking intraframe/image coding as a start point, this paper proposes a pure line-by-line coding scheme (LBLC) to meet the need. In LBLC, an input image is processed line by line sequentially, and each line is divided into small fixed-length segments. The compression of all segments from prediction to entropy coding is completely independent and concurrent at many cores. Results on a general-purpose computer show that our scheme can get a 13.9 times speedup with 15 cores at the encoder and a 10.3 times speedup at the decoder. Ideally, such near-linear speeding relation with the number of cores can be kept for more than 100 cores. In addition to the high parallelism, the proposed scheme can perform comparatively or even better than the H.264 high profile above middle bit rates. At near-lossless coding, it outperforms H.264 more than 10 dB. At lossless coding, up to 14% bit-rate reduction is observed compared with H.264 lossless coding at the high 4:4:4 profile.
Nuclear Magnetic Resonance Study of Nanoscale Ionic Materials
Oommen, Joanna Mary; Hussain, Muhammad Mustafa; Emwas, Abdul-Hamid M.; Agarwal, Praveen; Archer, Lynden A.
2010-01-01
using nuclear magnetic resonance (NMR) spectroscopy. NIMs are relatively stable over a temperature range from 300 to 383 K, rendering them usable in high temperature applications. We confirmed the presence of covalent bonds between the SiO2 core
Development of an ESR/MR dual-imaging system as a tool to detect bioradicals
International Nuclear Information System (INIS)
Fujii, Hirotada; Aoki, Masaaki; Haishi, Tomoyuki; Itoh, Kouichi; Sakata, Motomichi
2006-01-01
A system combining electron spin resonance imaging (ESRI) with another imaging modality capable of enabling visualization of the distribution of bioradicals on an anatomical map of the specimens would be a superior biomedical imaging system. We describe the development of an electron spin resonance ESR/MR dual-imaging system with one permanent magnet and the biomedical applications of this system. The magnetic circuit developed for the ESR/MR dual-imaging system consisted of the permanent magnet made of Fe-Nd-B, pole pieces, and poke. The permanent magnet was installed on the MR side only, and the ESR side was made of pole pieces only. The magnetic field was adjusted to 0.5T at MR and to 0.042T at ESR. The overall dimensions of the magnet developed for the ESR/MR imaging system were 460 (W) x 440 (D) x 460 (H) mm, and it weighed 220 kg. The distance of each center for the magnet for ESR and MR imaging could be set as close as 200 mm. The entire ESR/MR imaging system can be installed in a common laboratory without magnetic shielding. MR images of plants (myoga) and small animals (mice and rats) were successfully acquired with or without ESR operation. ESR spectra of nitroxyl spin probes were also measured, even with MRI operation. ESR signals of triarylmethyl derivatives with narrow line-width (0.026 mT) were observed in living mice while MRI was operating. The ESR/MR imaging dual functions work properly with no electric or magnetic interference. The ESR/MR dual images demonstrate that this system enables visualization of the distribution of bioradicals on the anatomical map of the object. (author)
Remanent magnetization stratigraphy of lunar cores
Banerjee, S. K.; Gingrich, D.; Marvin, J. A.
1977-01-01
Depth dependent fluctuations have been observed in the natural remanent magnetizations (NRM) of drive cores and drill strings from Apollo 16 and 17 missions. Partial demagnetization of unstable secondary magnetizations and identification of characteristic error signals from a core which is known to have been recently disturbed allow us to identify and isolate the stable NRM stratigraphy in double drive core 60010/60009 and drill strings 60002-60004. The observed magnetization fluctuations persist after normalization to take into account depth dependent variations in the carriers of stable NRM. We tentatively ascribe the stable NRM stratigraphy to instantaneous records of past magnetic fields at the lunar surface and suggest that the stable NRM stratigraphy technique could develop as a new relative time-stratigraphic tool, to be used with other physical measurements such as relative intensity of ferromagnetic resonance and charged particle track density to study the evolution of the lunar regolith.
Manipulation of resonant Auger processes with strong optical fields
Picón, Antonio; Buth, Christian; Doumy, Gilles; Krässig, Bertold; Young, Linda; Southworth, Stephen
2013-05-01
We recently reported on the optical control of core-excited states of a resonant Auger process in neon. We have focused on the resonant excitation 1 s --> 1s-1 3 p , while a strong optical field may resonantly couple two core-excited states (1s-1 3 p and 1s-1 3 s) in the Rydberg manifold as well as dressing the continuum. There is a clear signature in the Auger electron spectrum of the inner-shell dynamics induced by the strong optical field: i) the Auger electron spectrum is modified by the rapid optical-induced population transfer from the 1s-1 3 p state to the 1s-1 3 s state during their decay. ii) The angular anisotropy parameter, defining the angular distribution of the Auger electron, is manifested in the envelope of the (angle-integrated) sidebands. This work is funded by the Office of Basic Energy Sciences, Office of Science, U.S. Department of Energy, under Contract No. DE-AC02-06CH11357.
Modeling and analysis of neutron noise from an ex-core detector at a pressurized water reactor
International Nuclear Information System (INIS)
Wood, R.T.; Perez, R.B.
1991-01-01
Two applications of a noise diagnostic methodology were performed using ex-core neutron detector data from a pressurized water reactor (PWR). A feedback dynamics model of the neutron power spectral density (PSD) was derived from a low-order whole-plant physical model made stochastic using the Langevin technique. From a functional fit to plant data, the response of the dynamic system to changes in important physical parameters was evaluated by a direct sensitivity analysis. In addition, changes in monitored spectra were related to changes in physical parameters and detection thresholds using common surveillance discriminants were determined. A resonance model was developed from perturbation theory to give the ex-core neutron detector response for small in-core mechanical motions in terms of a pole-strength factor, a resonance asymmetry (or skewness) factor, a vibration damping factor, and a frequency of vibration. The mechanical motion parameters for several resonances were determined by a functional fit of the model to plant data taken at various times during a fuel cycle and were tracked to determine trends that indicated vibrational changes of reactor internals. In addition, the resonance model gave the ability to separate the resonant components of the PSD after the parameters had been identified. As a result, the behavior of several vibration peaks were monitored over a fuel cycle. 9 refs., 6 figs., 1 tab
The ferro-resonance, a phenomenon sometimes chaotic
Energy Technology Data Exchange (ETDEWEB)
Grison, P; Kieny, J C; Riouai, M [Electricite de France (EDF), 92 - Clamart (France)
1996-04-01
The ferro-resonance is a resonance phenomenon involving the saturation of the magnetic core in transformers; in particular, it is generated by the energization of that equipment during a power system restoration. It exhibits classical periodic regimes, but also more complex ones, as harmonic, pseudo-periodic, even chaotic, which have been measured on site or during laboratory tests. The mathematical analysis of this phenomenon belongs to the theory of bifurcations; the use of a program solving non linear systems may lead to a better understanding of the observed overvoltages. (authors). 14 figs., 2 photos.
Active resonance tuning of stretchable plasmonic structures
DEFF Research Database (Denmark)
Zhu, Xiaolong; Xiao, Sanshui; Mortensen, N. Asger
2012-01-01
Active resonance tuning is highly desired for the applications of plasmonic structures, such as optical switches and surface enhanced Raman substrates. In this paper, we demonstrate the active tunable plasmonic structures, which composed of monolayer arrays of metallic semishells with dielectric...... cores on stretchable elastic substrates. These composite structures support Bragg-type surface plasmon resonances whose frequencies are sensitive to the arrangement of the metallic semishells. Under uniaxial stretching, the lattice symmetry of these plasmonic structures can be reconfigured from...... applications of the stretch-tunable plasmonic structures in sensing, switching, and filtering....
Minamino, Takuya; Mine, Atsushi; Matsumoto, Mariko; Sugawa, Yoshihiko; Kabetani, Tomoshige; Higashi, Mami; Kawaguchi, Asuka; Ohmi, Masato; Awazu, Kunio; Yatani, Hirofumi
2015-10-01
No previous reports have observed inside the root canal using both optical coherence tomography (OCT) and x-ray microcomputed tomography (μCT) for the same sample. The purpose of this study was to clarify both OCT and μCT image properties from observations of the same root canal after resin core build-up treatment. As OCT allows real-time observation of samples, gap formation may be able to be shown in real time. A dual-cure, one-step, self-etch adhesive system bonding agent, and dual-cure resin composite core material were used in root canals in accordance with instructions from the manufacturer. The resulting OCT images were superior for identifying gap formation at the interface, while μCT images were better to grasp the tooth form. Continuous tomographic images from real-time OCT observation allowed successful construction of a video of the resin core build-up procedure. After 10 to 12 s of light curing, a gap with a clear new signal occurred at the root-core material interface, proceeding from the coronal side (6 mm from the cemento-enamel junction) to the apical side of the root.
Directory of Open Access Journals (Sweden)
Maksim Skorobogatiy
2009-01-01
Full Text Available We review application of microstructured and photonic bandgap fibers for designing resonant optical sensors of changes in the value of analyte refractive index. This research subject has recently invoked much attention due to development of novel fiber types, as well as due to development of techniques for the activation of fiber microstructure with functional materials. Particularly, we consider two sensors types. The first sensor type employs hollow core photonic bandgap fibers where core guided mode is confined in the analyte filled core through resonant effect in the surrounding periodic reflector. The second sensor type employs metalized microstructured or photonic bandgap waveguides and fibers, where core guided mode is phase matched with a plasmon propagating at the fiber/analyte interface. In resonant sensors one typically employs fibers with strongly nonuniform spectral transmission characteristics that are sensitive to changes in the real part of the analyte refractive index. Moreover, if narrow absorption lines are present in the analyte transmission spectrum, due to Kramers-Kronig relation this will also result in strong variation in the real part of the refractive index in the vicinity of an absorption line. Therefore, resonant sensors allow detection of minute changes both in the real part of the analyte refractive index (10−6–10−4 RIU, as well as in the imaginary part of the analyte refractive index in the vicinity of absorption lines. In the following we detail various resonant sensor implementations, modes of operation, as well as analysis of sensitivities for some of the common transduction mechanisms for bio- and chemical sensing applications. Sensor designs considered in this review span spectral operation regions from the visible to terahertz.
Core-shell magnetic nanoparticles for on-chip RF inductors
Koh, Kisik
2013-01-01
FeNi3 based core-shell magnetic nanoparticles are demonstrated as the magnetic core material for on-chip, radio frequency (RF) inductors. FeNi3 nanoparticles with 50-150 nm in diameter with 15-20 nm-thick SiO2 coating are chemically synthesized and deposited on a planar inductor as the magnetic core to enhance both inductance (L) and quality factor (Q) of the inductor. Experimentally, the ferromagnetic resonant frequency of the on-chip inductors based on FeNi3 core-shell nanoparticles has been shown to be over several GHz. A post-CMOS process has been developed to integrate the magnetic nanoparticles to a planar inductor and inductance enhancements up to 50% of the original magnitude with slightly enhanced Q-factor up to 1 GHz have been achieved. © 2013 IEEE.
Lin, Zhuchong; Liu, Kun; Zhang, Li; Zeng, Delin
2016-09-01
Maglev dual-stage inertially stabilization (MDIS) system is a newly proposed system which combines a conventional two-axis gimbal assembly and a 5-DOF (degree of freedom) magnetic bearing with vernier tilting capacity to perform dual-stage stabilization for the LOS of the suspended optical instrument. Compared with traditional dual-stage system, maglev dual-stage system exhibits different characteristics due to the negative position stiffness of the magnetic forces, which introduces additional coupling in the dual stage control system. In this paper, the coupling effect on the system performance is addressed based on frequency-domain analysis, including disturbance rejection, fine stage saturation and coarse stage structural resonance suppression. The difference between various control strategies is also discussed, including pile-up(PU), stabilize-follow (SF) and stabilize-compensate (SC). A number of principles for the design of a maglev dual stage system are proposed. A general process is also suggested, which leads to a cost-effective design striking a balance between high performance and complexity. At last, a simulation example is presented to illustrate the arguments in the paper. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
AlAfeef, Ala, E-mail: a.al-afeef.1@research.gla.ac.uk [SUPA School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom); School of Computing Science, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Bobynko, Joanna [SUPA School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Cockshott, W. Paul. [School of Computing Science, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Craven, Alan J. [SUPA School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Zuazo, Ian; Barges, Patrick [ArcelorMittal Maizières Research, Maizières-lès-Metz 57283 (France); MacLaren, Ian, E-mail: ian.maclaren@glasgow.ac.uk [SUPA School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom)
2016-11-15
We have investigated the use of DualEELS in elementally sensitive tilt series tomography in the scanning transmission electron microscope. A procedure is implemented using deconvolution to remove the effects of multiple scattering, followed by normalisation by the zero loss peak intensity. This is performed to produce a signal that is linearly dependent on the projected density of the element in each pixel. This method is compared with one that does not include deconvolution (although normalisation by the zero loss peak intensity is still performed). Additionally, we compare the 3D reconstruction using a new compressed sensing algorithm, DLET, with the well-established SIRT algorithm. VC precipitates, which are extracted from a steel on a carbon replica, are used in this study. It is found that the use of this linear signal results in a very even density throughout the precipitates. However, when deconvolution is omitted, a slight density reduction is observed in the cores of the precipitates (a so-called cupping artefact). Additionally, it is clearly demonstrated that the 3D morphology is much better reproduced using the DLET algorithm, with very little elongation in the missing wedge direction. It is therefore concluded that reliable elementally sensitive tilt tomography using EELS requires the appropriate use of DualEELS together with a suitable reconstruction algorithm, such as the compressed sensing based reconstruction algorithm used here, to make the best use of the limited data volume and signal to noise inherent in core-loss EELS. - Highlights: • DualEELS is essential for chemically sensitive electron tomography using EELS. • A new compressed sensing based algorithm (DLET) gives high fidelity reconstruction. • This combination of DualEELS and DLET will give reliable results from few projections.