On the quark structure of resonance states in dual models
International Nuclear Information System (INIS)
Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.
1975-01-01
It is shown using as an example the Veneziano dual model, that each particular dual model already contains a certain latent quark structure unambiauously determined by internal properties of the dual model. To prove this degeneration of the resonance state spectrum is studied by introducing an additional disturbing interaction into the model being considered. Induced transitions of particles into a vacuum act as such an additional disturbance. This method complements the known factorization method of Fubini, Gordon and Veneziano and turns out to be free from an essential limitation of the latter connected with implicit assumption about the basence of internal additive laws of conservation in the model. By using the method of induced transitions of particles into a vacuum it has been possible to show that the resonance state spectrum is indeed more degenerated than it should be expected from the factorization theorem, and that the supplementary degeneration corresponds to the quark model with an infinite number of quarks of the increasing mass. Structures of some terms of the dual amplitude expansion over the degrees of the constant of the induced transition of particles to vacuum are considered; it is shown that the summation of this expansion may be reduced to a solution of a certain integral equation. On the basis of the integral equation obtained an integral representation ofr dual amplitudes is established. The problems related with degeneration of resonance states and with determination of additive quantum numbers leading to the quark interpretation of the degeneration being considered are discussed
Dual resonance models and their currents
International Nuclear Information System (INIS)
Johnson, E.A.
1978-01-01
It is shown how dual resonance models were rederived from the concept of a string tracing out a surface in space-time. Thus, interacting strings reproduce the dual amplitudes. A scheme for tackling the unitarity problem began to develop. As a consistent theory of hadronic processes began to be built, workers at the same time were naturally led to expect that leptons could be included with hadrons in a unified dual theory. Thus, there is a search for dual amplitudes which would describe interactions between hadrons and currents (for example, electrons), as well as interactions involving only hadrons. Such amplitudes, it is believed, will be the correct ones, describing the real world. Such amplitudes will provide valuable information concerning such things as hadronic form factors. The great difficulties in building current-amplitudes with the required properties of proper factorization on a good spectrum, duality, current algebra, and proper asymptotic behavior are described. Dual models at the present time require for consistency, an intercept value of α 0 = 1 and a dimension value of d = 26 (or d = 10). There have been speculations that the unphysical dimension may be made physical by associating the ''extra dimensions'' with certain internal degrees of freedom. However, it is desired that the theory itself, force the dimension d = 4. It is quite possible that the dimension problem and the intercept problem are tied together and that resolving either problem will resolve the other. Order by order, a new dual current is constructed that is manifestly factorizable and which appears to be valid for arbitrary space-time dimension. The fact that this current is not bound at d = 26, leads to interesting speculations on the nature of dual currents
Interacting-string picture of dual-resonance models
International Nuclear Information System (INIS)
Mandelstam, S.
1985-01-01
Dual-resonance models are an alyzed by means of operators which act within the physical Hilbert space of positive-metric states. The basis of the method is to extend the relativistic-string picture of a previous study to interacting particles. Functional methods are used, but their relation to the operator is evident, and factorization is maintained. An expression is given for the N-point amplitude in terms of physical-particle operators. For the three-point function the Neumann functions which occur in this expression are evaluated, so that we have a formula for the on- and off-energy-shell vertex. The authors assume that the string has no longitudinal degrees of freedom, and their results are Lorentz invariant and dual only if d=26
The early years of string theory: The dual resonance model
International Nuclear Information System (INIS)
Ramond, P.
1987-10-01
This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story
Intermediate mass distribution of the dual resonance pomeron
International Nuclear Information System (INIS)
Chiu, C.B.; Matsuda, S.
1978-01-01
The intermediate mass distribution of the dual resonance pomeron is determined at the one-loop level and it is shown that the mass distribution obtained is remarkably similar to a suitably defined mass distribution in the dual multiperipheral model. Thus it is suggestive to identify the intermediate states of the dual resonance pomeron with multiperipheral processes. (Auth.)
Modelling and analysis of the transformer current resonance in dual active bridge converters
DEFF Research Database (Denmark)
Qin, Zian; Shen, Zhan; Blaabjerg, Frede
2017-01-01
Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency....... In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model...
A dual resonance model for high energy electroweak reactions
International Nuclear Information System (INIS)
Picard, Jean-Francois
1995-01-01
The aim of this work is to propose an original model for the weak interaction at high energy (about 1 TeV) that is inspired from resonance dual models established for hadron physics. The first chapter details the basis and assumptions of the standard model. The second chapter deals with various scenarios that go beyond the standard model and that involve a strong interaction and a perturbative approach to assess coupling. The third chapter is dedicated to the main teachings of hadron physics concerning resonances, the model of Regge poles and the concept of duality. We present our new model in the fourth chapter, we build a scenario in which standard fermions and the 3 massive gauge bosons would have a sub-structure alike that of hadrons. In order to give non-null values to the width of resonances we use the K matrix method, we describe this method in the last chapter and we apply it for the computation of the width of the Z 0 boson. Our model predicts a large spectra of states particularly with the 143-up-lets of ff-bar states. The K matrix method has allowed us to compute amplitudes for helicity, then to collapse them in amplitudes invariant with SU(2) and to project these amplitudes in partial waves of helicity. For most resonances partial widths are very low compared to their mass
Analysis and measurement of the stability of dual-resonator oscillators
Ghaed, Hassan
2012-01-01
This paper investigates the stability of oscillators with dual-resonating tanks. After deriving oscillator models, it is shown that contrary to prior belief, there can be only one stable oscillating state. Sufficient conditions for stable oscillating states are derived and silicon measurement results are used to prove their validity. A fully integrated transmitter for intraocular pressure sensing that leverages the dual-resonator tank is designed and fabricated based on the derived models. An unstable version of the transmitter is also demonstrated to prove the concept of instability in dual-resonator oscillators © 2012 IEEE.
Modelling and simulation of a thermally induced optical transparency in a dual micro-ring resonator.
Lydiate, Joseph
2017-07-01
This paper introduces the simulation and modelling of a novel dual micro-ring resonator. The geometric configuration of the resonators, and the implementation of a simulated broadband excitation source, results in the realization of optical transparencies in the combined through port output spectrum. The 130 nm silicon on insulator rib fabrication process is adopted for the simulation of the dual-ring configuration. Two titanium nitride heaters are positioned over the coupling regions of the resonators, which can be operated independently, to control the spectral position of the optical transparency. A third heater, centrally located above the dual resonator rings, can be used to red shift the entire spectrum to a required reference resonant wavelength. The free spectral range with no heater currents applied is 4.29 nm. For a simulated heater current of 7 mA (55.7 mW heater power) applied to one of the through coupling heaters, the optical transparency exhibits a red shift of 1.79 nm from the reference resonant wavelength. The ring-to-ring separation of approximately 900 nm means that it can be assumed that there is a zero ring-to-ring coupling field in this model. This novel arrangement has potential applications as a gas mass airflow sensor or a gas species identification sensor.
Covariant introduction of quark spin into the dual resonance model
International Nuclear Information System (INIS)
Iroshnikov, G.S.
1979-01-01
A very simple method of insertion of a quark spin into the dual resonance model of hadron interaction is proposed. The method is suitable for amplitudes with an arbitrary number of particles. The amplitude of interaction of real particles is presented as a product of contribution of oscillatory excitations in the (q anti q) system and of a spin factor. The latter is equal to the trace of the product of the external particle wave functions constructed from structural quarks and satisfying the relativistic Bargman-Wigner equations. Two examples of calculating the meson interaction amplitudes are presented
The Hagedorn Spectrum and the Dual Resonance Model: An Old Love Affair
Veneziano, Gabriele
2016-01-01
In this contribution I recall how people working in the late 1960s on the dual resonance model came to the surprising discovery of a Hagedorn-like spectrum, and why they should not have been surprised. I will then turn to discussing the Hagedorn spectrum from a string theory viewpoint (which adds a huge degeneracy to the exponential spectrum). Finally, I will discuss how all this can be reinterpreted in the new incarnation of string theory through the properties of quantum black holes.
Dual-band plasmonic resonator based on Jerusalem cross-shaped nanoapertures
Cetin, Arif E.; Kaya, Sabri; Mertiri, Alket; Aslan, Ekin; Erramilli, Shyamsunder; Altug, Hatice; Turkmen, Mustafa
2015-06-01
In this paper, we both experimentally and numerically introduce a dual-resonant metamaterial based on subwavelength Jerusalem cross-shaped apertures. We numerically investigate the physical origin of the dual-resonant behavior, originating from the constituting aperture elements, through finite difference time domain calculations. Our numerical calculations show that at the dual-resonances, the aperture system supports large and easily accessible local electromagnetic fields. In order to experimentally realize the aperture system, we utilize a high-precision and lift-off free fabrication method based on electron-beam lithography. We also introduce a fine-tuning mechanism for controlling the dual-resonant spectral response through geometrical device parameters. Finally, we show the aperture system's highly advantageous far- and near-field characteristics through numerical calculations on refractive index sensitivity. The quantitative analyses on the availability of the local fields supported by the aperture system are employed to explain the grounds behind the sensitivity of each spectral feature within the dual-resonant behavior. Possessing dual-resonances with large and accessible electromagnetic fields, Jerusalem cross-shaped apertures can be highly advantageous for wide range of applications demanding multiple spectral features with strong nearfield characteristics.
Deng, Wei; Wang, Ya
2017-09-01
This paper reports a dual resonant rectilinear-to-rotary oscillation converter (RROC) for low frequency broadband electromagnetic energy harvesting from ambient vibrations. An approximate theoretical model has been established to integrate the electromechanical coupling into a comprehensive electromagnetic-dynamic model of the dual resonant RROC. Numerical simulation has proved the nature of dual resonances by revealing that both the rectilinear resonance and the rotary resonance could be achieved when the stand-alone rectilinear oscillator (RLO) and the stand-alone rotary oscillator (RTO) were excited independently. Simulation on the magnetically coupled RROC has also shown that the rectilinear resonance and the rotary resonance could be obtained simultaneously in the low-frequency region (2-14 Hz) with well-defined restoring torque (M r ) and the initial rotation angle of the RLO (ψ). The magnetic interaction patterns between the rectilinear and the RTOs have been categorized based on aforementioned simulation results. Both simulation and experimental results have demonstrated broadband output attributing from the dual resonances. Experimental results have also indicated that the RROC could have wide bandwidth in a much lower frequency region (2-8 Hz) even without the rotary resonance as long as the system parameters are carefully tuned. Parameter analysis on different values of M r and ψ are experimentally carried out to provide a quantitative guidance of designing the RROC to achieve an optimal power density.
Grover, D.; Seth, R. K.
2018-05-01
Analysis and numerical results are presented for the thermoelastic dissipation of a homogeneous isotropic, thermally conducting, Kelvin-Voigt type circular micro-plate based on Kirchhoff's Love plate theory utilizing generalized viscothermoelasticity theory of dual-phase-lagging model. The analytical expressions for thermoelastic damping of vibration and frequency shift are obtained for generalized dual-phase-lagging model and coupled viscothermoelastic plates. The scaled thermoelastic damping has been illustrated in case of circular plate and axisymmetric circular plate for fixed aspect ratio for clamped and simply supported boundary conditions. It is observed that the damping of vibrations significantly depend on time delay and mechanical relaxation times in addition to thermo-mechanical coupling in circular plate under resonance conditions and plate dimensions.
Compact Dual-Band Bandpass Filter Using Stubs Loaded Ring Resonator
Xu, Jin
2016-01-01
This paper presents a novel second-order dual-band bandpass filter (BPF) by using proposed stubs loaded ring resonator. The resonant behavior of proposed stubs loaded ring resonator is analyzed by even-/odd-mode method, which shows its multiple-mode resonant characteristic. Parameters sweep is done so as to give the design guidelines. As an example, a second-order dual-band BPF operating at 1.8/5.2 GHz for GSM and WLAN applications is designed, fabricated and measured. The fabricated filter has a very compact size of 0.05λg×0.15λg. Measured results also show that the proposed dual-band BPF has a better than 20 dB rejection upper stopband from 5.47 GHz to 12.56 GHz. Good agreement is shown between the simulated and measured results.
Design of a dual linear polarization antenna using split ring resonators at X-band
Ahmed, Sadiq; Chandra, Madhukar
2017-11-01
Dual linear polarization microstrip antenna configurations are very suitable for high-performance satellites, wireless communication and radar applications. This paper presents a new method to improve the co-cross polarization discrimination (XPD) for dual linear polarized microstrip antennas at 10 GHz. For this, three various configurations of a dual linear polarization antenna utilizing metamaterial unit cells are shown. In the first layout, the microstrip patch antenna is loaded with two pairs of spiral ring resonators, in the second model, a split ring resonator is placed between two microstrip feed lines, and in the third design, a complementary split ring resonators are etched in the ground plane. This work has two primary goals: the first is related to the addition of metamaterial unit cells to the antenna structure which permits compensation for an asymmetric current distribution flow on the microstrip antenna and thus yields a symmetrical current distribution on it. This compensation leads to an important enhancement in the XPD in comparison to a conventional dual linear polarized microstrip patch antenna. The simulation reveals an improvement of 7.9, 8.8, and 4 dB in the E and H planes for the three designs, respectively, in the XPD as compared to the conventional dual linear polarized patch antenna. The second objective of this paper is to present the characteristics and performances of the designs of the spiral ring resonator (S-RR), split ring resonator (SRR), and complementary split ring resonator (CSRR) metamaterial unit cells. The simulations are evaluated using the commercial full-wave simulator, Ansoft High-Frequency Structure Simulator (HFSS).
Dual resonant structure for energy harvesting from random vibration sources at low frequency
Directory of Open Access Journals (Sweden)
Shanshan Li
2016-01-01
Full Text Available We introduce a design with dual resonant structure which can harvest energy from random vibration sources at low frequency range. The dual resonant structure consists of two spring-mass subsystems with different frequency responses, which exhibit strong coupling and broad bandwidth when the two masses collide with each other. Experiments with piezoelectric elements show that the energy harvesting device with dual resonant structure can generate higher power output than the sum of the two separate devices from random vibration sources.
Design and analysis of a novel dual-mass MEMS resonant output gyroscope
Directory of Open Access Journals (Sweden)
Yang Gao
2018-02-01
Full Text Available This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS resonant output gyroscope (ROG, which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.
Dual band metamaterial perfect absorber based on Mie resonances
Energy Technology Data Exchange (ETDEWEB)
Liu, Xiaoming; Lan, Chuwen; Li, Bo; Zhou, Ji, E-mail: zhouji@tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Bi, Ke [School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhao, Qian [State Key Lab of Tribology, Department of Precision Instruments and Mechanology, Tsinghua University, Beijing 100084 (China)
2016-08-08
We numerically and experimentally demonstrated a polarization insensitive dual-band metamaterial perfect absorber working in wide incident angles based on the two magnetic Mie resonances of a single dielectric “atom” with simple structure. Two absorption bands with simulated absorptivity of 99% and 96%, experimental absorptivity of 97% and 94% at 8.45 and 11.97 GHz were achieved due to the simultaneous magnetic and electric resonances in dielectric “atom” and copper plate. Mie resonances of dielectric “atom” provide a simple way to design metamaterial perfect absorbers with high symmetry.
Ultrasmall Dual-Band Metamaterial Antennas Based on Asymmetrical Hybrid Resonators
Directory of Open Access Journals (Sweden)
Ji-Xu Zhu
2016-01-01
Full Text Available A new type of hybrid resonant circuit model is investigated theoretically and experimentally. The resonant model consists of a right hand (RH patch part and a composite right and left handed (CRLH part (RH + CRLH, which determines a compact size and also a convenient frequency modulation characteristic for the proposed antennas. For experimental demonstration, two antennas are fabricated. The former dual-band antenna operating at f-1=3.5 GHz (Wimax and f+1=5.25 GHz (WLAN occupies an area of 0.21λ0×0.08λ0, and two dipolar radiation patterns are obtained with comparable gains of about 6.1 and 6.2 dB, respectively. The latter antenna advances in many aspects such as an ultrasmall size of only 0.16λ0×0.08λ0, versatile radiation patterns with a monopolar pattern at f0=2.4 GHz (Bluetooth, and a dipole one at f+1=3.5 GHz (Wimax and also comparable antenna gains. Circuit parameters are extracted and researched. Excellent performances of the antennas based on hybrid resonators predict promising applications in multifunction wireless communication systems.
Directory of Open Access Journals (Sweden)
Billy W. Day
2010-11-01
Full Text Available Biosensors have been used extensively in the scientific community for several purposes, most notably to determine association and dissociation kinetics, protein-ligand, protein-protein, or nucleic acid hybridization interactions. A number of different types of biosensors are available in the field, each with real or perceived benefits over the others. This review discusses the basic theory and operational arrangements of four commercially available types of optical biosensors: surface plasmon resonance, resonant mirror, resonance waveguide grating, and dual polarization interferometry. The different applications these techniques offer are discussed from experiments and results reported in recently published literature. Additionally, recent advancements or modifications to the current techniques are also discussed.
Vacuum transitions in dual models
International Nuclear Information System (INIS)
Pashnev, A.I.; Volkov, D.V.; Zheltukhin, A.A.
1976-01-01
The investigation is continued of the spontaneous vacuum transition problem in the Neview-Schwartz dual model (NSDM). It is shown that vacuum transitions allow disclosing of supplementary degeneration in the resonance state spectrum. The dual amplitudes possess an internal structure corresponding to the presence of an infinite number of quarks with increasing masses and retained charges. The Adler principle holds. Analytic continuation on the constant of induced vacuum transitions makes it possible to establish the existence of spontaneous vacuum transitions in the NSDM. The consequence of this fact is the exact SU(2) symmetry of π, rho meson trajectories and the Higgs mechanism in the model. In this case the ratios of masses of particles leading trajectories are analogous to those obtained in the current algebra. It is shown that in the NSDM there arises chiral SU(2) x SU(2) x U(1) x U(1) x ... symmetry resulting from spontaneous vacuum transitions
Zhang, Hui; Li, Yu-Hao; Chen, Yang; Wang, Man-Man; Wang, Xue-Sheng; Yin, Xue-Bo
2017-03-01
Phototherapy shows some unique advantages in clinical application, such as remote controllability, improved selectivity, and low bio-toxicity, than chemotherapy. In order to improve the safety and therapeutic efficacy, imaging-guided therapy seems particularly important because it integrates visible information to speculate the distribution and metabolism of the probe. Here we prepare biocompatible core-shell nanocomposites for dual-modality imaging-guided photothermal and photodynamic dual-therapy by the in situ growth of porphyrin-metal organic framework (PMOF) on Fe3O4@C core. Fe3O4@C core was used as T2-weighted magnetic resonance (MR) imaging and photothermal therapy (PTT) agent. The optical properties of porphyrin were well remained in PMOF, and PMOF was therefore selected for photodynamic therapy (PDT) and fluorescence imaging. Fluorescence and MR dual-modality imaging-guided PTT and PDT dual-therapy was confirmed with tumour-bearing mice as model. The high tumour accumulation of Fe3O4@C@PMOF and controllable light excitation at the tumour site achieved efficient cancer therapy, but low toxicity was observed to the normal tissues. The results demonstrated that Fe3O4@C@PMOF was a promising dual-imaging guided PTT and PDT dual-therapy platform for tumour diagnosis and treatment with low cytotoxicity and negligible in vivo toxicity.
Design of ultrathin dual-resonant reflective polarization converter with customized bandwidths
Kundu, Debidas; Mohan, Akhilesh; Chakrabarty, Ajay
2017-10-01
In this paper, an ultrathin dual-resonant reflective polarization converter is proposed to obtain customized bandwidths using precise space-filling technique to its top geometry. The unit cell of the dual-resonant prototype consists of conductive square ring with two diagonally arranged slits, supported by metal-backed thin dielectric layer. It offers two narrow bands with fractional bandwidths of 3.98 and 6.65% and polarization conversion ratio (PCR) of 97.16 and 98.87% at 4.52 and 6.97 GHz, respectively. The resonances are brought in proximity to each other by changing the length of surface current paths of the two resonances. By virtue of this mechanism, two polarization converters with two different types of bandwidths are obtained. One polarization converter produces a full-width at half-maxima PCR bandwidth of 34%, whereas another polarization converter produces a 90% PCR bandwidth of 19%. All the proposed polarization converters are insensitive to wide variations of incident angle for both TE- and TM-polarized incident waves. Measured results show good agreement with the numerically simulated results.
360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Xue, Weiqi; Liu, Liu
2010-01-01
We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...
Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator
DEFF Research Database (Denmark)
Pu, Minhao; Liu, Liu; Xue, Weiqi
2010-01-01
We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator...
Experimental evidence for dual diffractive resonances in nucleon-nucleus scattering
International Nuclear Information System (INIS)
Ion, D.B.; Ion-Mihai, R.
1981-09-01
Experimental data on nucleon-nucleus scattering for laboratory momenta between 0.9:10 GeV/c are analysed in terms of the dual diffractive resonance (DDR) mechanism. The experimental data for all the nuclei are found to agree well with the predictions of the collective DDR states dominance. (authors)
Dual and tri-band bandpass filters based on novel Π-shaped resonator
Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei
2014-05-01
A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.
Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation
Energy Technology Data Exchange (ETDEWEB)
Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)
2017-12-15
Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)
Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation
International Nuclear Information System (INIS)
Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian
2017-01-01
Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)
Nazari, Tavakol; Khazaeinezhad, Reza; Jung, Woohyun; Joo, Boram; Kong, Byung-Joo; Oh, Kyunghwan
2015-07-13
Dual resonant bands in UV and the visible range were simultaneously observed in the enhanced optical transmission (EOT) through star-shaped plasmonic structures. EOTs through four types of polygonal bull's eyes with a star aperture surrounded by the concentric star grooves were analyzed and compared for 3, 4, 5, and 6 corners, using finite difference time domain (FDTD) method. In contrast to plasmonic resonances in the visible range, the UV-band resonance intensity was found to scale with the number of corners, which is related with higher order multipole interactions. Spectral positions and relative intensities of the dual resonances were analyzed parametrically to find optimal conditions to maximize EOT in UV-visible dual bands.
Zhang, Yulong; Wang, Tianyang; Zhang, Ai; Peng, Zhuoteng; Luo, Dan; Chen, Rui; Wang, Fei
2016-12-01
In this paper, we present design and test of a broadband electrostatic energy harvester with a dual resonant structure, which consists of two cantilever-mass subsystems each with a mass attached at the free edge of a cantilever. Comparing to traditional devices with single resonant frequency, the proposed device with dual resonant structure can resonate at two frequencies. Furthermore, when one of the cantilever-masses is oscillating at resonance, the vibration amplitude is large enough to make it collide with the other mass, which provides strong mechanical coupling between the two subsystems. Therefore, this device can harvest a decent power output from vibration sources at a broad frequency range. During the measurement, continuous power output up to 6.2-9.8 μW can be achieved under external vibration amplitude of 9.3 m/s 2 at a frequency range from 36.3 Hz to 48.3 Hz, which means the bandwidth of the device is about 30% of the central frequency. The broad bandwidth of the device provides a promising application for energy harvesting from the scenarios with random vibration sources. The experimental results indicate that with the dual resonant structure, the vibration-to-electricity energy conversion efficiency can be improved by 97% when an external random vibration with a low frequency filter is applied.
Properties of quasi-elastic processes due to exchange of one dual pomeron
International Nuclear Information System (INIS)
Gedalin, Eh.V.; Gurvich, E.G.
1975-01-01
The asymptotic (at S tending to infinity) characteristics of four-particle amplitudes of diffraction scattering of resonance states in the dual-resonance model is considered in the lower order of the dual theory of perturbations. It is shown that for transverse transferred momentum K→0, at least for part of the spectrum of states of the dual resonance model - i.e. of the transverse states -, the scattering amplitudes are zero, except for the elastically scattered ones, which are all identical. (author)
Experimental results of high power dual frequency resonant magnet excitation at TRIUMF
International Nuclear Information System (INIS)
Reiniger, K.W.; Heritier, G.
1988-06-01
We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)
Electromagnetic Form Factors of Hadrons in Dual-Large Nc QCD
International Nuclear Information System (INIS)
Dominguez, C. A.
2011-01-01
In this talk, results are presented of determinations of electromagnetic form factors of hadrons (pion, proton, and Δ(1236)) in the framework of Dual-Large N c QCD (Dual-QCD ∞ ). This framework improves considerably tree-level VMD results by incorporating an infinite number of zero-width resonances, with masses and couplings fixed by the dual-resonance (Veneziano-type) model.
International Nuclear Information System (INIS)
Bora, B.; Bhuyan, H.; Favre, M.; Wyndham, E.; Chuaqui, H.
2012-01-01
Plasma series resonance (PSR) effect is well known in geometrically asymmetric capacitively couple radio frequency plasma. However, plasma series resonance effect in geometrically symmetric plasma has not been properly investigated. In this work, a theoretical approach is made to investigate the plasma series resonance effect and its influence on Ohmic and stochastic heating in geometrically symmetric discharge. Electrical asymmetry effect by means of dual frequency voltage waveform is applied to excite the plasma series resonance. The results show considerable variation in heating with phase difference between the voltage waveforms, which may be applicable in controlling the plasma parameters in such plasma.
Dual-band reflective polarization converter based on slotted wire resonators
Li, Fengxia; Zhang, Linbo; Zhou, Peiheng; Chen, Haiyan; Zhao, Rui; Zhou, Yang; Liang, Difei; Lu, Haipeng; Deng, Longjiang
2018-02-01
A dual-band and high-efficiency reflective linear polarization converter composed of a layer of slotted metal wires has been proposed. Both the simulated and experimental results indicate that the structure can convert a linearly polarized wave to its cross-polarized state for two distinct frequency bands under normal incidence: 9.8-15.1 and 19.2-25.7 GHz. This phenomenon is attributed to a resonance that corresponds to the "trapped mode" at 15.8 GHz. This mode is stable with structural parameters and incident angle at a relatively wide range, and thus becomes promising for dual-band (also multiband) devices design. By surface current distribution and electric field analysis, the operation mechanism has been illuminated, especially for the "trapped mode", identified by the equally but also oppositely directed currents in each unit cell.
Compact Dual-Band Zeroth-Order Resonance Antenna
International Nuclear Information System (INIS)
Xu He-Xiu; Wang Guang-Ming; Gong Jian-Qiang
2012-01-01
A novel microstrip zeroth-order resonator (ZOR) antenna and its equivalent circuit model are exploited with two zeroth-order resonances. It is constructed based on a resonant-type composite right/left handed transmission line (CRLH TL) using a Wunderlich-shaped extended complementary single split ring resonator pair (W-ECSSRRP) and a series capacitive gap. The gap either can be utilized for double negative (DNG) ZOR antenna or be removed to engineer a simplified elision-negative ZOR (ENG) antenna. For verification, a DNG ZOR antenna sample is fabricated and measured. Numerical and experimental results agree well with each other, indicating that the omnidirectional radiations occur at two frequency bands which are accounted for by two shunt branches in the circuit model. The size of the antenna is 49% more compact than its previous counterpart. The superiority of W-ECSSRRP over CSSRRP lies in the lower fundamental resonance of the antenna by 38.2% and the introduction of a higher zeroth-order resonance. (fundamental areas of phenomenology(including applications))
Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.
Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun
2014-03-01
To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.
Taniguchi, Tadahiro; Sawaragi, Tetsuo
In this paper, a new machine-learning method, called Dual-Schemata model, is presented. Dual-Schemata model is a kind of self-organizational machine learning methods for an autonomous robot interacting with an unknown dynamical environment. This is based on Piaget's Schema model, that is a classical psychological model to explain memory and cognitive development of human beings. Our Dual-Schemata model is developed as a computational model of Piaget's Schema model, especially focusing on sensori-motor developing period. This developmental process is characterized by a couple of two mutually-interacting dynamics; one is a dynamics formed by assimilation and accommodation, and the other dynamics is formed by equilibration and differentiation. By these dynamics schema system enables an agent to act well in a real world. This schema's differentiation process corresponds to a symbol formation process occurring within an autonomous agent when it interacts with an unknown, dynamically changing environment. Experiment results obtained from an autonomous facial robot in which our model is embedded are presented; an autonomous facial robot becomes able to chase a ball moving in various ways without any rewards nor teaching signals from outside. Moreover, emergence of concepts on the target movements within a robot is shown and discussed in terms of fuzzy logics on set-subset inclusive relationships.
Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams
Directory of Open Access Journals (Sweden)
Xiaohui Du
2016-01-01
Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.
Wang, Cuiling; Zhang, Shouheng; Qiao, Shizhu; Du, Honglei; Liu, Xiaomin; Sun, Ruicong; Chu, Xian-Ming; Miao, Guo-Xing; Dai, Youyong; Kang, Shishou; Yan, Shishen; Li, Shandong
2018-05-01
Dual-mode ferromagnetic resonance is observed in FeCoB/Ru/FeCoB trilayer synthetic antiferromagnets with uniaxial in-plane magnetic anisotropy. The optical mode is present in the (0-108 Oe) magnetic field range, where the top and bottom layer magnetizations are aligned in opposite directions. The strong acoustic mode appears, when the magnetic field exceeds the 300 Oe value, which corresponds to the flop transition in the trilayer. Magnetic field and angular dependences of resonant frequencies are studied for both optical (low-field) and acoustic (high field) modes. The low-field mode is found to be anisotropic but insensitive to the magnetic field value. In contrast, the high field mode is quasi-isotropic, but its resonant frequency is tunable by the value of the magnetic field. The coexistence of two modes of ferromagnetic resonance as well as switching between them with the increase in the magnetic field originates from the difference in the sign of interlayer coupling energy at the parallel and antiparallel configurations of the synthetic antiferromagnet. The dual-mode resonance in the studied trilayer structures provides greater flexibility in the design and functionalization of micro-inductors in monolithic microwave integrated circuits.
Nonword Reading: Comparing Dual-Route Cascaded and Connectionist Dual-Process Models with Human Data
Pritchard, Stephen C.; Coltheart, Max; Palethorpe, Sallyanne; Castles, Anne
2012-01-01
Two prominent dual-route computational models of reading aloud are the dual-route cascaded (DRC) model, and the connectionist dual-process plus (CDP+) model. While sharing similarly designed lexical routes, the two models differ greatly in their respective nonlexical route architecture, such that they often differ on nonword pronunciation. Neither…
Energy Technology Data Exchange (ETDEWEB)
Satoh, Kei; Takagi, Yuta; Narahashi, Shoichi [Research Laboratories, NTT DOCOMO, INC., 3-6 Hikari-no-oka Yokosuka, Kanagawa 239-8536 Japan (Japan); Nojima, Toshio, E-mail: satokei@nttdocomo.co.j [Graduate School of Information Science and Technology, Hokkaido University, Kita 14, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-0814 Japan (Japan)
2010-06-01
This paper presents a high-temperature superconducting coplanar-waveguide quarter-wavelength resonator that has two different resonant modes for use in a dual-band bandpass filter (DBPF). An RF filter with multiple passbands such as the DBPF is a basic element that is expected to achieve broadband transmission by using separated frequency bands aggregately and simultaneously in future mobile communication systems. The proposed resonator has a folded center conductor and two open stubs that are aligned close to it. The odd- and even-mode resonant frequencies are configured using the space between the folded center conductor and the open stubs. It is easy to configure the odd- and even-mode coupling coefficients independently because the two resonant modes have different current density distributions. Consequently, a DBPF with two different bandwidths can be easily designed. This paper presents three design examples for a four-pole Chebyshev DBPF with different combinations of fractional bandwidths in order to investigate the validity of the proposed resonator. This paper also presents measured results of the DBPF based on the design examples from the standpoint of experimental investigation. The designed and measured frequency responses confirm that the proposed resonator is effective in achieving DBPFs not only with two of the same bandwidths but also with two different bandwidths.
Dielectric Meta-Holograms Enabled with Dual Magnetic Resonances in Visible Light.
Li, Zile; Kim, Inki; Zhang, Lei; Mehmood, Muhammad Q; Anwar, Muhammad S; Saleem, Murtaza; Lee, Dasol; Nam, Ki Tae; Zhang, Shuang; Luk'yanchuk, Boris; Wang, Yu; Zheng, Guoxing; Rho, Junsuk; Qiu, Cheng-Wei
2017-09-26
Efficient transmission-type meta-holograms have been demonstrated using high-index dielectric nanostructures based on Huygens' principle. It is crucial that the geometry size of building blocks be judiciously optimized individually for spectral overlap of electric and magnetic dipoles. In contrast, reflection-type meta-holograms using the metal/insulator/metal scheme and geometric phase can be readily achieved with high efficiency and small thickness. Here, we demonstrate a general platform for design of dual magnetic resonance based meta-holograms based on the geometric phase using silicon nanostructures that are quarter wavelength thick for visible light. Significantly, the projected holographic image can be unambiguously observed without a receiving screen even under the illumination of natural light. Within the well-developed semiconductor industry, our ultrathin magnetic resonance-based meta-holograms may have promising applications in anticounterfeiting and information security.
The dual of the Carroll-Field-Jackiw model
International Nuclear Information System (INIS)
Guimaraes, M.S.; Grigorio, L.; Wotzasek, C.
2006-01-01
In this work we apply different duality techniques, both the dual projection, based on the soldering formalism and the master action, in order to obtain and study the dual description of the Carroll- Field-Jackiw model [1], a theory with a Chern-Simons-like explicitly Lorentz and CPT violating term, including the interaction with external charges. This Maxwell-Chern-Simons-like model may be rewritten in terms of the interacting modes of a massless scalar model and a topologically massive model [2], that are mapped, through duality, into interacting massless Maxwell and massive self-dual modes [3]. It is also shown that these dual modes might be represented into an unified rank-two self-dual model that represents the direct dual of the vector Maxwell-Chern-Simons-like model
Vector and tensor meson production in quasi-two-body final states using the dual fermion model
International Nuclear Information System (INIS)
Becker, L.; Matthaeus, E.; Weigt, G.
1975-01-01
Phenomenological dual fermion amplitudes are obtained by using the Neveu-Schwarz-Ramond model as a guide to incorporate half-integer spin. The model relates the production mechanism of different resonances lying on the same degenerated Regge trajectory, thus allowing a simultaneous description of vector and tensor meson production. A characteristic feature of the amplitudes is their non-evasive coupling structure. Predictions of the model for rho 0 - f - g 0 , ω - A 2 - and anti K-890 and anti K-1420 resonances production in quasi-two-body reactions are compared with experimental data. The differential cross sections for natural and unnatural spin-parity t-channel exchanges as well as their contributions to different helicities of the produced resonances are given. In particular, new properties arise from the non-evasive pion exchange. Reasonable agreement with the data is found. (author)
Performance Improvement of Polymer Solar Cells by Surface-Energy-Induced Dual Plasmon Resonance.
Yao, Mengnan; Shen, Ping; Liu, Yan; Chen, Boyuan; Guo, Wenbin; Ruan, Shengping; Shen, Liang
2016-03-09
The surface plasmon resonance (SPR) effect of metal nanoparticles (MNPs) is effectively applied on polymer solar cells (PSCs) to improve power conversion efficiency (PCE). However, universality of the reported results mainly focused on utilizing single type of MNPs to enhance light absorption only in specific narrow wavelength range. Herein, a surface-energy-induced dual MNP plasmon resonance by thermally evaporating method was presented to achieve the absorption enhancement in wider range. The differences of surface energy between silver (Ag), gold (Au), and tungsten trioxide (WO3) compared by contact angle images enable Ag and Au prefer to respectively aggregate into isolated islands rather than films at the initial stage of the evaporation process, which was clearly demonstrated in the atomic force microscopy (AFM) measurement. The sum of plasmon-enhanced wavelength range induced by both Ag NPs (350-450 nm) and Au NPs (450-600 nm) almost cover the whole absorption spectra of active layers, which compatibly contribute a significant efficiency improvement from 4.57 ± 0.16 to 6.55 ± 0.12% compared to the one without MNPs. Besides, steady state photoluminescence (PL) measurements provide strong evidence that the SPR induced by the Ag-Au NPs increase the intensity of light absorption. Finally, ultraviolet photoelectron spectroscopy (UPS) reveals that doping Au and Ag causes upper shift of both the work function and valence band of WO3, which is directly related to hole collection ability. We believe the surface-energy-induced dual plasmon resonance enhancement by simple thermally evaporating technique might pave the way toward higher-efficiency PSCs.
Energy Technology Data Exchange (ETDEWEB)
Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.
2014-09-15
Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.
Varma, Ruchi; Ghosh, Jayanta
2018-06-01
A new hybrid technique, which is a combination of neural network (NN) and support vector machine, is proposed for designing of different slotted dual band proximity coupled microstrip antennas. Slots on the patch are employed to produce the second resonance along with size reduction. The proposed hybrid model provides flexibility to design the dual band antennas in the frequency range from 1 to 6 GHz. This includes DCS (1.71-1.88 GHz), PCS (1.88-1.99 GHz), UMTS (1.92-2.17 GHz), LTE2300 (2.3-2.4 GHz), Bluetooth (2.4-2.485 GHz), WiMAX (3.3-3.7 GHz), and WLAN (5.15-5.35 GHz, 5.725-5.825 GHz) bands applications. Also, the comparative study of this proposed technique is done with the existing methods like knowledge based NN and support vector machine. The proposed method is found to be more accurate in terms of % error and root mean square % error and the results are in good accord with the measured values.
A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications
DEFF Research Database (Denmark)
Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng
2017-01-01
This paper proposes a dual-bridge (DB) LLC resonant converter for wide input applications. The topology is an integration of a half-bridge (HB) LLC circuit and a full-bridge (FB) LLC circuit. The fixed-frequency PWM control is employed and a range of twice the minimum input voltage can be covered....... Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...
Slow light based on plasmon-induced transparency in dual-ring resonator-coupled MDM waveguide system
International Nuclear Information System (INIS)
Zhan, Shiping; Li, Hongjian; He, Zhihui; Li, Boxun; Yang, Hui; Cao, Guangtao
2014-01-01
We report a theoretical and numerical investigation of the plasmon-induced transparency (PIT) effect in a dual-ring resonator-coupled metal–dielectric–metal waveguide system. A transfer matrix method (TMM) is introduced to analyse the transmission and dispersion properties in the transparency window. A tunable PIT is realized in a constant separation design. The phase dispersion and slow-light effect are discussed in both the resonance and non-resonance conditions. Finally, a propagation constant based on the TMM is derived for the periodic system. It is found that the group index in the transparency window of the proposed structure can be easily tuned by the period p, which provides a new understanding, and a group index ∼51 is achieved. The quality factor of resonators can also be effective in adjusting the dispersion relation. These observations could be helpful to fundamental research and applications for integrated plasmonic devices. (paper)
Foley, W Dennis; Shuman, William P; Siegel, Marilyn J; Sahani, Dushyant V; Boll, Daniel T; Bolus, David N; De Cecco, Carlo N; Kaza, Ravi K; Morgan, Desiree E; Schoepf, U Joseph; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L
This is the second of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography. This paper, part 2, addresses radiation dose and iodine sensitivity in dual-energy computed tomography.
User Preference-Based Dual-Memory Neural Model With Memory Consolidation Approach.
Nasir, Jauwairia; Yoo, Yong-Ho; Kim, Deok-Hwa; Kim, Jong-Hwan; Nasir, Jauwairia; Yong-Ho Yoo; Deok-Hwa Kim; Jong-Hwan Kim; Nasir, Jauwairia; Yoo, Yong-Ho; Kim, Deok-Hwa; Kim, Jong-Hwan
2018-06-01
Memory modeling has been a popular topic of research for improving the performance of autonomous agents in cognition related problems. Apart from learning distinct experiences correctly, significant or recurring experiences are expected to be learned better and be retrieved easier. In order to achieve this objective, this paper proposes a user preference-based dual-memory adaptive resonance theory network model, which makes use of a user preference to encode memories with various strengths and to learn and forget at various rates. Over a period of time, memories undergo a consolidation-like process at a rate proportional to the user preference at the time of encoding and the frequency of recall of a particular memory. Consolidated memories are easier to recall and are more stable. This dual-memory neural model generates distinct episodic memories and a flexible semantic-like memory component. This leads to an enhanced retrieval mechanism of experiences through two routes. The simulation results are presented to evaluate the proposed memory model based on various kinds of cues over a number of trials. The experimental results on Mybot are also presented. The results verify that not only are distinct experiences learned correctly but also that experiences associated with higher user preference and recall frequency are consolidated earlier. Thus, these experiences are recalled more easily relative to the unconsolidated experiences.
Vector and tensor meson production in quasi-two-body final states using the dual fermion model
International Nuclear Information System (INIS)
Becker, L.; Matthaeus, E.; Weigt, G.
1976-01-01
Phenomenological dual fermion amplitudes are obtained by using Neveu-Schwarz-Ramond model as a guide to incorporate half-integer spin. The model relates the production mechanism of different resonances lying on the same degenerate Regge trajectory, thus allowing a simultaneous description of vector and tensor meson production. A characteristic feature of the amplitudes is their non-evasive coupling structure. Predictions of the model for rho 0 -f-g 0 , ω-A 2 - and anti K*(890)-anti K*(1420) production in quasi-two-body reactions are compared with experimental data. The differential cross sections for natural and unnatural spin-parity t-channel exchanges as well as their contributions to different helicities of the produced resonances are given. In particular, new properties arise from the non-evasive pion exchange. Reasonable agreement with the data is found. (Auth.)
Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors
Deen, David A.; Osinsky, Andrei; Miller, Ross
2014-03-01
A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection.
Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors
International Nuclear Information System (INIS)
Deen, David A.; Osinsky, Andrei; Miller, Ross
2014-01-01
A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection
Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors
Energy Technology Data Exchange (ETDEWEB)
Deen, David A.; Osinsky, Andrei; Miller, Ross [Agnitron Technology Incorporated, Eden Prairie, Minnesota 55346 (United States)
2014-03-03
A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection.
Study of loading by beam of dual-resonator structure of linear electron accelerator
International Nuclear Information System (INIS)
Milovanov, O.S.; Smirnov, I.A.
1988-01-01
Loading by the beam of the accelerating structure of an Argus dual-resonator linear electron accelerator with a kinetic energy of ∼ 1 MeV and a pulsed beam current of up to 0.5 A is studied experimentally. It is shown that the conditions for stable single-frequency operation of the magnetron are disrupted and the acceleration process is cut off at certain electron-beam currents. Experimental curves of the maximum beam current and maximum electron efficiency of the Argus linear electron accelerator as functions of rf power are given
Schmidt, Rita; Webb, Andrew
2017-10-11
Magnetic resonance imaging and spectroscopy (MRI and MRS) are both widely used techniques in medical diagnostics and research. One of the major thrusts in recent years has been the introduction of ultrahigh-field magnets in order to boost the sensitivity. Several MRI studies have examined further potential improvements in sensitivity using metamaterials, focusing on single frequency applications. However, metamaterials have yet to reach a level that is practical for routine MRI use. In this work, we explore a new metamaterial implementation for MRI, a dual-nuclei resonant structure, which can be used for both proton and heteronuclear magnetic resonance. Our approach combines two configurations, one based on a set of electric dipoles for the low frequency band, and the second based on a set of magnetic dipoles for the high frequency band. We focus on the implementation of a dual-nuclei metamaterial for phosphorus and proton imaging and spectroscopy at an ultrahigh-field strength of 7 T. In vivo scans using this flexible and compact structure show that it locally enhances both the phosphorus and proton transmit and receive sensitivities.
On Goldstone particles and the Adler principle in dual models
International Nuclear Information System (INIS)
Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.
1975-01-01
The results that have been obtained on the basis of considering the spontaneous vacuum transitions for the cases of Veneziano dual model and dual M-model are generalized to model containing internal quantum numbers of SU(N)-group. This generalization allows to consider how in dual models the spontaneous violation of symmetry occurs, which Goldstone particles appear in this process, how Adler's principle is realized for dual amplitudes and their topics related of spontaneous violation of symmetry
Charge distribution in an two-chain dual model
International Nuclear Information System (INIS)
Fialkowski, K.; Kotanski, A.
1983-01-01
Charge distributions in the multiple production processes are analysed using the dual chain model. A parametrisation of charge distributions for single dual chains based on the νp and anti vp data is proposed. The rapidity charge distributions are then calculated for pp and anti pp collisions and compared with the previous calculations based on the recursive cascade model of single chains. The results differ at the SPS collider energies and in the energy dependence of the net forward charge supplying the useful tests of the dual chain model. (orig.)
Dual-Resonant Implantable Circular Patch Antenna for Biotelemetry Communication
Directory of Open Access Journals (Sweden)
Rongqiang Li
2016-01-01
Full Text Available A compact broadband implantable circular patch antenna is designed and experimentally demonstrated for Medical Implant Communications Service (MICS band (402–405 MHz. Compared with other similar implantable antennas, the proposed antenna incorporates three advantages for biotelemetry communication. First, it can realize a broad impedance bandwidth by exhibiting dual resonances. Second, it can obtain a compact structure by introducing two arc-shaped slots, a rectangular slot and a circular slot on metal radiating patch. Finally, it can display a friendly shape by using a circular structure. The proposed antenna occupies a volume of about 431.5 mm3 (10.42 × 1.27π mm3, which is a compromise between miniaturization and bandwidth. The measured −10 dB impedance bandwidth is 55 MHz (385–440 MHz. Furthermore, the radiation performance and human body safety consideration of the antenna are examined and characterized.
Directory of Open Access Journals (Sweden)
Yingsong Li
2012-04-01
Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.
Dual superconductor models of color confinement
Ripka, Georges
2004-01-01
The lectures, delivered at ECT (European Centre for Theoretical Studies in Nuclear Physics and Related Areas) in Trento (Italy) in 2002 and 2003, are addressed to physicists who wish to acquire a minimal background to understand present day attempts to model the confinement of quantum chromo-dynamics (QCD) in terms of dual superconductors. The lectures focus more on the models than on attempts to derive them from QCD. They discuss the Dirac theory of magnetic monopoles, the world sheet swept out by Dirac strings, deformations of Dirac strings and charge quantization, gauge fields associated to the field tensor and to the dual field tensor, the Landau-Ginzburg (Abelian Higgs) model of a dual superconductor, the flux tube joining two equal and opposite color-electric charges, the Abrikosov-Nielsen-Olesen vortex, the divergencies of the London limit, the comparison of the calculated flux tube and string tension with lattice data, duality transformations and the use of Kalb-Ramond fields, the two-potential Zwanzi...
Dual Numbers Approach in Multiaxis Machines Error Modeling
Directory of Open Access Journals (Sweden)
Jaroslav Hrdina
2014-01-01
Full Text Available Multiaxis machines error modeling is set in the context of modern differential geometry and linear algebra. We apply special classes of matrices over dual numbers and propose a generalization of such concept by means of general Weil algebras. We show that the classification of the geometric errors follows directly from the algebraic properties of the matrices over dual numbers and thus the calculus over the dual numbers is the proper tool for the methodology of multiaxis machines error modeling.
Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency
Directory of Open Access Journals (Sweden)
C. Baccouch
2016-11-01
Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.
Dual processing model of medical decision-making
Djulbegovic, Benjamin; Hozo, Iztok; Beckstead, Jason; Tsalatsanis, Athanasios; Pauker, Stephen G
2012-01-01
Abstract Background Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I) and/or an analytical, deliberative (system II) processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administe...
A dynamic dual process model of risky decision making.
Diederich, Adele; Trueblood, Jennifer S
2018-03-01
Many phenomena in judgment and decision making are often attributed to the interaction of 2 systems of reasoning. Although these so-called dual process theories can explain many types of behavior, they are rarely formalized as mathematical or computational models. Rather, dual process models are typically verbal theories, which are difficult to conclusively evaluate or test. In the cases in which formal (i.e., mathematical) dual process models have been proposed, they have not been quantitatively fit to experimental data and are often silent when it comes to the timing of the 2 systems. In the current article, we present a dynamic dual process model framework of risky decision making that provides an account of the timing and interaction of the 2 systems and can explain both choice and response-time data. We outline several predictions of the model, including how changes in the timing of the 2 systems as well as time pressure can influence behavior. The framework also allows us to explore different assumptions about how preferences are constructed by the 2 systems as well as the dynamic interaction of the 2 systems. In particular, we examine 3 different possible functional forms of the 2 systems and 2 possible ways the systems can interact (simultaneously or serially). We compare these dual process models with 2 single process models using risky decision making data from Guo, Trueblood, and Diederich (2017). Using this data, we find that 1 of the dual process models significantly outperforms the other models in accounting for both choices and response times. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
A Low-Cost and Portable Dual-Channel Fiber Optic Surface Plasmon Resonance System.
Liu, Qiang; Liu, Yun; Chen, Shimeng; Wang, Fang; Peng, Wei
2017-12-04
A miniaturization and integration dual-channel fiber optic surface plasmon resonance (SPR) system was proposed and demonstrated in this paper. We used a yellow light-emitting diode (LED, peak wavelength 595 nm) and built-in web camera as a light source and detector, respectively. Except for the detection channel, one of the sensors was used as a reference channel to compensate nonspecific binding and physical absorption. We packaged the LED and surface plasmon resonance (SPR) sensors together, which are flexible enough to be applied to mobile devices as a compact and portable system. Experimental results show that the normalized intensity shift and refractive index (RI) of the sample have a good linear relationship in the RI range from 1.328 to 1.348. We used this sensor to monitor the reversible, specific interaction between lectin concanavalin A (Con A) and glycoprotein ribonuclease B (RNase B), which demonstrate its capabilities of specific identification and biochemical samples concentration detection. This sensor system has potential applications in various fields, such as medical diagnosis, public health, food safety, and environment monitoring.
The dual model of perfectionism and depression among Chinese ...
African Journals Online (AJOL)
The dual model of perfectionism was adopted to explore the influence of adaptive and maladaptive perfectionism on depression in college students. The results support the dual process model of perfectionism in Chinese undergraduates. A sample of 206 Chinese undergraduates completed measures of perfectionism, ...
Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais
2017-01-13
An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.
Extended charge banking model of dual path shocks for implantable cardioverter defibrillators.
Dosdall, Derek J; Sweeney, James D
2008-08-01
Single path defibrillation shock methods have been improved through the use of the Charge Banking Model of defibrillation, which predicts the response of the heart to shocks as a simple resistor-capacitor (RC) circuit. While dual path defibrillation configurations have significantly reduced defibrillation thresholds, improvements to dual path defibrillation techniques have been limited to experimental observations without a practical model to aid in improving dual path defibrillation techniques. The Charge Banking Model has been extended into a new Extended Charge Banking Model of defibrillation that represents small sections of the heart as separate RC circuits, uses a weighting factor based on published defibrillation shock field gradient measures, and implements a critical mass criteria to predict the relative efficacy of single and dual path defibrillation shocks. The new model reproduced the results from several published experimental protocols that demonstrated the relative efficacy of dual path defibrillation shocks. The model predicts that time between phases or pulses of dual path defibrillation shock configurations should be minimized to maximize shock efficacy. Through this approach the Extended Charge Banking Model predictions may be used to improve dual path and multi-pulse defibrillation techniques, which have been shown experimentally to lower defibrillation thresholds substantially. The new model may be a useful tool to help in further improving dual path and multiple pulse defibrillation techniques by predicting optimal pulse durations and shock timing parameters.
Establishment of animal model of dual liver transplantation in rat.
Directory of Open Access Journals (Sweden)
Ying Zhang
Full Text Available The animal model of the whole-size and reduced-size liver transplantation in both rat and mouse has been successfully established. Because of the difficulties and complexities in microsurgical technology, the animal model of dual liver transplantation was still not established for twelve years since the first human dual liver transplantation has been made a success. There is an essential need to establish this animal model to lay a basic foundation for clinical practice. To study the physiological and histopathological changes of dual liver transplantation, "Y" type vein from the cross part between vena cava and two iliac of donor and "Y' type prosthesis were employed to recanalize portal vein and the bile duct between dual liver grafts and recipient. The dual right upper lobes about 45-50% of the recipient liver volume were taken as donor, one was orthotopically implanted at its original position, the other was rotated 180° sagitally and heterotopically positioned in the left upper quadrant. Microcirculation parameters, liver function, immunohistochemistry and survival were analyzed to evaluate the function of dual liver grafts. No significant difference in the hepatic microcirculatory flow was found between two grafts in the first 90 minutes after reperfusion. Light and electronic microscope showed the liver architecture was maintained without obvious features of cellular destruction and the continuity of the endothelium was preserved. Only 3 heterotopically positioned graft appeared patchy desquamation of endothelial cell, mitochondrial swelling and hepatocytes cytoplasmic vacuolization. Immunohistochemistry revealed there is no difference in hepatocyte activity and the ability of endothelia to contract and relax after reperfusion between dual grafts. Dual grafts made a rapid amelioration of liver function after reperfusion. 7 rats survived more than 7 days with survival rate of 58.3.%. Using "Y" type vein and bile duct prosthesis, we
Animal Modeling and Neurocircuitry of Dual Diagnosis
Chambers, R. Andrew
2010-01-01
Dual diagnosis is a problem of tremendous depth and scope, spanning many classes of mental disorders and addictive drugs. Animal models of psychiatric disorders studied in addiction paradigms suggest a unitary nature of mental illness and addiction vulnerability both on the neurocircuit and clinical-behavioral levels. These models provide platforms for exploring the interactive roles of biological, environmental and developmental factors on neurocircuits commonly involved in psychiatric and addiction diseases. While suggestive of the artifice of segregated research, training, and clinical cultures between psychiatric and addiction fields, this research may lead to more parsimonious, integrative and preventative treatments for dual diagnosis. PMID:20585464
International Nuclear Information System (INIS)
Jang, Haeyun; Lee, Chaedong; Nam, Gi-Eun; Quan, Bo; Choi, Hyuck Jae; Yoo, Jung Sun; Piao, Yuanzhe
2016-01-01
The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex ® with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.
Energy Technology Data Exchange (ETDEWEB)
Jang, Haeyun; Lee, Chaedong [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Nam, Gi-Eun [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Quan, Bo [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Choi, Hyuck Jae [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Yoo, Jung Sun [Seoul National University, Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Smart Humanity Convergence Center (Korea, Republic of); Piao, Yuanzhe, E-mail: parkat9@snu.ac.kr [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of)
2016-02-15
The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex{sup ®} with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.
Geometrical optics model of Mie resonances
Roll; Schweiger
2000-07-01
The geometrical optics model of Mie resonances is presented. The ray path geometry is given and the resonance condition is discussed with special emphasis on the phase shift that the rays undergo at the surface of the dielectric sphere. On the basis of this model, approximate expressions for the positions of first-order resonances are given. Formulas for the cavity mode spacing are rederived in a simple manner. It is shown that the resonance linewidth can be calculated regarding the cavity losses. Formulas for the mode density of Mie resonances are given that account for the different width of resonances and thus may be adapted to specific experimental situations.
Dual processing model of medical decision-making
2012-01-01
Background Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I) and/or an analytical, deliberative (system II) processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administered to the patient who may or may not have a disease. Methods We developed a mathematical model in which we linked a recently proposed descriptive psychological model of cognition with the threshold model of medical decision-making and show how this approach can be used to better understand decision-making at the bedside and explain the widespread variation in treatments observed in clinical practice. Results We show that physician’s beliefs about whether to treat at higher (lower) probability levels compared to the prescriptive therapeutic thresholds obtained via system II processing is moderated by system I and the ratio of benefit and harms as evaluated by both system I and II. Under some conditions, the system I decision maker’s threshold may dramatically drop below the expected utility threshold derived by system II. This can explain the overtreatment often seen in the contemporary practice. The opposite can also occur as in the situations where empirical evidence is considered unreliable, or when cognitive processes of decision-makers are biased through recent experience: the threshold will increase relative to the normative threshold value derived via system II using expected utility threshold. This inclination for the higher diagnostic certainty may, in turn, explain undertreatment that is also documented in the current medical practice. Conclusions We have developed the first dual processing model of medical decision-making that has potential to enrich the current medical
Dual processing model of medical decision-making.
Djulbegovic, Benjamin; Hozo, Iztok; Beckstead, Jason; Tsalatsanis, Athanasios; Pauker, Stephen G
2012-09-03
Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I) and/or an analytical, deliberative (system II) processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administered to the patient who may or may not have a disease. We developed a mathematical model in which we linked a recently proposed descriptive psychological model of cognition with the threshold model of medical decision-making and show how this approach can be used to better understand decision-making at the bedside and explain the widespread variation in treatments observed in clinical practice. We show that physician's beliefs about whether to treat at higher (lower) probability levels compared to the prescriptive therapeutic thresholds obtained via system II processing is moderated by system I and the ratio of benefit and harms as evaluated by both system I and II. Under some conditions, the system I decision maker's threshold may dramatically drop below the expected utility threshold derived by system II. This can explain the overtreatment often seen in the contemporary practice. The opposite can also occur as in the situations where empirical evidence is considered unreliable, or when cognitive processes of decision-makers are biased through recent experience: the threshold will increase relative to the normative threshold value derived via system II using expected utility threshold. This inclination for the higher diagnostic certainty may, in turn, explain undertreatment that is also documented in the current medical practice. We have developed the first dual processing model of medical decision-making that has potential to enrich the current medical decision-making field, which is still to the
A Dual System Model of Preferences under Risk
Mukherjee, Kanchan
2010-01-01
This article presents a dual system model (DSM) of decision making under risk and uncertainty according to which the value of a gamble is a combination of the values assigned to it independently by the affective and deliberative systems. On the basis of research on dual process theories and empirical research in Hsee and Rottenstreich (2004) and…
Hu, Lingzhi; Hockett, Frank D; Chen, Junjie; Zhang, Lei; Caruthers, Shelton D; Lanza, Gregory M; Wickline, Samuel A
2011-07-01
To propose and test a universal strategy for building (19) F/(1) H dual-frequency RF coil that permits multiple coil geometries. The feasibility to design (19) F/(1) H dual-frequency RF coil based on coupled resonator model was investigated. A series capacitive matching network enables robust impedance matching for both harmonic oscillating modes of the coupled resonator. Two typical designs of (19) F/(1) H volume coils (birdcage and saddle) at 4.7T were implemented and evaluated with electrical bench test and in vivo (19) F/(1) H dual-nuclei imaging. For various combinations of internal resistances of the sample coil and secondary resonator, numerical solutions for the tunable capacitors to optimize impedance matching were obtained using a root-seeking program. Identical and homogeneous B1 field distribution at (19) F and (1) H frequencies were observed in bench test and phantom image. Finally, in vivo mouse imaging confirmed the sensitivity and homogeneity of the (19) F/(1) H dual-frequency coil design. A generalized strategy for designing (19) F/(1) H dual-frequency coils based on the coupled resonator approach was developed and validated. A unique feature of this design is that it preserves the B1 field homogeneity of the RF coil at both resonant frequencies. Thus it minimizes the susceptibility effect on image co-registration. Copyright © 2011 Wiley-Liss, Inc.
Anderson, Christian E; Donnola, Shannon B; Jiang, Yun; Batesole, Joshua; Darrah, Rebecca; Drumm, Mitchell L; Brady-Kalnay, Susann M; Steinmetz, Nicole F; Yu, Xin; Griswold, Mark A; Flask, Chris A
2017-08-16
Injectable Magnetic Resonance Imaging (MRI) contrast agents have been widely used to provide critical assessments of disease for both clinical and basic science imaging research studies. The scope of available MRI contrast agents has expanded over the years with the emergence of molecular imaging contrast agents specifically targeted to biological markers. Unfortunately, synergistic application of more than a single molecular contrast agent has been limited by MRI's ability to only dynamically measure a single agent at a time. In this study, a new Dual Contrast - Magnetic Resonance Fingerprinting (DC - MRF) methodology is described that can detect and independently quantify the local concentration of multiple MRI contrast agents following simultaneous administration. This "multi-color" MRI methodology provides the opportunity to monitor multiple molecular species simultaneously and provides a practical, quantitative imaging framework for the eventual clinical translation of molecular imaging contrast agents.
Directory of Open Access Journals (Sweden)
Ye Chang
2018-01-01
Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.
Cultural differences of a dual-motivation model on health risk behaviour
Ohtomo, S.; Hirose, Y.; Midden, C.J.H.
2011-01-01
This study investigated the cultural differences of a dual-motivation model of unhealthy risk behaviour in the Netherlands and Japan. Our model assumes dual motivations involved in unhealthy eating behaviour, a behavioural willingness that leads behaviour unintentionally or subconsciously and a
Superoperators in the dual model with coloured quarks
International Nuclear Information System (INIS)
Manida, S.N.
1978-01-01
The derivation of the dual model with coloured quarks is considered. The model is represented as a superoperator generalization of the Bardakci-Halpern model. It is shown that the three-regeon vertex of the model appears to be more compact and transparent
Dual processing model of medical decision-making
Directory of Open Access Journals (Sweden)
Djulbegovic Benjamin
2012-09-01
Full Text Available Abstract Background Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I and/or an analytical, deliberative (system II processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administered to the patient who may or may not have a disease. Methods We developed a mathematical model in which we linked a recently proposed descriptive psychological model of cognition with the threshold model of medical decision-making and show how this approach can be used to better understand decision-making at the bedside and explain the widespread variation in treatments observed in clinical practice. Results We show that physician’s beliefs about whether to treat at higher (lower probability levels compared to the prescriptive therapeutic thresholds obtained via system II processing is moderated by system I and the ratio of benefit and harms as evaluated by both system I and II. Under some conditions, the system I decision maker’s threshold may dramatically drop below the expected utility threshold derived by system II. This can explain the overtreatment often seen in the contemporary practice. The opposite can also occur as in the situations where empirical evidence is considered unreliable, or when cognitive processes of decision-makers are biased through recent experience: the threshold will increase relative to the normative threshold value derived via system II using expected utility threshold. This inclination for the higher diagnostic certainty may, in turn, explain undertreatment that is also documented in the current medical practice. Conclusions We have developed the first dual processing model of medical decision-making that has potential to
Martin, S J; Bandey, H L; Cernosek, R W; Hillman, A R; Brown, M J
2000-01-01
We derive a lumped-element, equivalent-circuit model for the thickness-shear mode (TSM) resonator with a viscoelastic film. This modified Butterworth-Van Dyke model includes in the motional branch a series LCR resonator, representing the quartz resonance, and a parallel LCR resonator, representing the film resonance. This model is valid in the vicinity of film resonance, which occurs when the acoustic phase shift across the film is an odd multiple of pi/2 rad. For low-loss films, this model accurately predicts the frequency changes and damping that arise at resonance and is a reasonable approximation away from resonance. Elements of the parallel LCR resonator are explicitly related to film properties and can be interpreted in terms of elastic energy storage and viscous power dissipation. The model leads to a simple graphical interpretation of the coupling between the quartz and film resonances and facilitates understanding of the resulting responses. These responses are compared with predictions from the transmission-line and Sauerbrey models.
The Complexity of Developmental Predictions from Dual Process Models
Stanovich, Keith E.; West, Richard F.; Toplak, Maggie E.
2011-01-01
Drawing developmental predictions from dual-process theories is more complex than is commonly realized. Overly simplified predictions drawn from such models may lead to premature rejection of the dual process approach as one of many tools for understanding cognitive development. Misleading predictions can be avoided by paying attention to several…
Jiansen Li; Jianqi Sun; Ying Song; Yanran Xu; Jun Zhao
2014-01-01
An effective way to improve the data acquisition speed of magnetic resonance imaging (MRI) is using under-sampled k-space data, and dictionary learning method can be used to maintain the reconstruction quality. Three-dimensional dictionary trains the atoms in dictionary in the form of blocks, which can utilize the spatial correlation among slices. Dual-dictionary learning method includes a low-resolution dictionary and a high-resolution dictionary, for sparse coding and image updating respectively. However, the amount of data is huge for three-dimensional reconstruction, especially when the number of slices is large. Thus, the procedure is time-consuming. In this paper, we first utilize the NVIDIA Corporation's compute unified device architecture (CUDA) programming model to design the parallel algorithms on graphics processing unit (GPU) to accelerate the reconstruction procedure. The main optimizations operate in the dictionary learning algorithm and the image updating part, such as the orthogonal matching pursuit (OMP) algorithm and the k-singular value decomposition (K-SVD) algorithm. Then we develop another version of CUDA code with algorithmic optimization. Experimental results show that more than 324 times of speedup is achieved compared with the CPU-only codes when the number of MRI slices is 24.
A dual-trace model for visual sensory memory.
Cappiello, Marcus; Zhang, Weiwei
2016-11-01
Visual sensory memory refers to a transient memory lingering briefly after the stimulus offset. Although previous literature suggests that visual sensory memory is supported by a fine-grained trace for continuous representation and a coarse-grained trace of categorical information, simultaneous separation and assessment of these traces can be difficult without a quantitative model. The present study used a continuous estimation procedure to test a novel mathematical model of the dual-trace hypothesis of visual sensory memory according to which visual sensory memory could be modeled as a mixture of 2 von Mises (2VM) distributions differing in standard deviation. When visual sensory memory and working memory (WM) for colors were distinguished using different experimental manipulations in the first 3 experiments, the 2VM model outperformed Zhang and Luck (2008) standard mixture model (SM) representing a mixture of a single memory trace and random guesses, even though SM outperformed 2VM for WM. Experiment 4 generalized 2VM's advantages of fitting visual sensory memory data over SM from color to orientation. Furthermore, a single trace model and 4 other alternative models were ruled out, suggesting the necessity and sufficiency of dual traces for visual sensory memory. Together these results support the dual-trace model of visual sensory memory and provide a preliminary inquiry into the nature of information loss from visual sensory memory to WM. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
Comparing single- and dual-process models of memory development.
Hayes, Brett K; Dunn, John C; Joubert, Amy; Taylor, Robert
2017-11-01
This experiment examined single-process and dual-process accounts of the development of visual recognition memory. The participants, 6-7-year-olds, 9-10-year-olds and adults, were presented with a list of pictures which they encoded under shallow or deep conditions. They then made recognition and confidence judgments about a list containing old and new items. We replicated the main trends reported by Ghetti and Angelini () in that recognition hit rates increased from 6 to 9 years of age, with larger age changes following deep than shallow encoding. Formal versions of the dual-process high threshold signal detection model and several single-process models (equal variance signal detection, unequal variance signal detection, mixture signal detection) were fit to the developmental data. The unequal variance and mixture signal detection models gave a better account of the data than either of the other models. A state-trace analysis found evidence for only one underlying memory process across the age range tested. These results suggest that single-process memory models based on memory strength are a viable alternative to dual-process models for explaining memory development. © 2016 John Wiley & Sons Ltd.
Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin
2017-06-01
The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.
Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan
2018-04-01
Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.
Directory of Open Access Journals (Sweden)
Alfakih Khaled
2011-05-01
Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined
An AdS3 dual for minimal model CFTs
International Nuclear Information System (INIS)
Gaberdiel, Matthias R.; Gopakumar, Rajesh
2011-01-01
We propose a duality between the 2d W N minimal models in the large N't Hooft limit, and a family of higher spin theories on AdS 3 . The 2d conformal field theories (CFTs) can be described as Wess-Zumino-Witten coset models, and include, for N=2, the usual Virasoro unitary series. The dual bulk theory contains, in addition to the massless higher spin fields, two complex scalars (of equal mass). The mass is directly related to the 't Hooft coupling constant of the dual CFT. We give convincing evidence that the spectra of the two theories match precisely for all values of the 't Hooft coupling. We also show that the renormalization group flows in the 2d CFT agree exactly with the usual AdS/CFT prediction of the gravity theory. Our proposal is in many ways analogous to the Klebanov-Polyakov conjecture for an AdS 4 dual for the singlet sector of large N vector models.
Directory of Open Access Journals (Sweden)
E. S. Ahmed
2012-06-01
Full Text Available A new class of dual mode microstrip fractal resonator is proposed and developed for miniaturization of the dual band bandpass filter. The perimeter of the proposed resonator is increased by employing fourth iteration T-square fractal shape. Consequently the lower resonant frequency of the filter is decreased without increasing the usable space. The self similarity of the usable structure enables it to produce the two degenerate modes which are coupled using the proper perturbation technique. The shorting pin is placed at the null in the surface current distribution at the center of the resonator. This shorting pin is coactively coupled to the resonant circuit of the resonator, effectively coupled to the lower degenerate mode and reduces the lower edge band resonant frequency. By adjusting the resonator dimensions and the size of the shorting pin, the resonant frequency and the out-of-band rejection around the transmission bands can be controlled to meet the design requirements. The simulated response of the designed filter has two transmission bands, the first band is from 2.34-3.65 GHz with resonant frequencies at 2.47GHz and 3.55GHz, the second band is from 4.37-5.324GHz with resonant frequencies at 4.5GHz and 5.13GHz. In the pass bands, the group delay is less than 0.65 ns. The proposed filter can be applied to WLAN (2.4 GHz and 5.2 GHz and WiMAX (3.5 GHz and Bluetooth and ZigBee (4.9 GHz.
Intrinsically radiolabelled [59Fe]-SPIONs for dual MRI/radionuclide detection
Hoffman, David; Sun, Minghao; Yang, Likun; McDonagh, Philip R; Corwin, Frank; Sundaresan, Gobalakrishnan; Wang, Li; Vijayaragavan, Vimalan; Thadigiri, Celina; Lamichhane, Narottam; Zweit, Jamal
2014-01-01
Towards the development of iron oxide nanoparticles with intrinsically incorporated radionuclides for dual Positron Emission Tomography/Magnetic Resonance Imaging (PET/MRI) and more recently of Single Photon Emission Computed Tomography/Magnetic Resonance Imaging (SPECT/MRI), we have developed intrinsically radiolabeled [59Fe]-superparamagnetic iron oxide nanoparticles ([59Fe]-SPIONs) as a proof of concept for an intrinsic dual probe strategy. 59Fe was incorporated into Fe3O4 nanoparticle cry...
Physically based model for extracting dual permeability parameters using non-Newtonian fluids
Abou Najm, M. R.; Basset, C.; Stewart, R. D.; Hauswirth, S.
2017-12-01
Dual permeability models are effective for the assessment of flow and transport in structured soils with two dominant structures. The major challenge to those models remains in the ability to determine appropriate and unique parameters through affordable, simple, and non-destructive methods. This study investigates the use of water and a non-Newtonian fluid in saturated flow experiments to derive physically-based parameters required for improved flow predictions using dual permeability models. We assess the ability of these two fluids to accurately estimate the representative pore sizes in dual-domain soils, by determining the effective pore sizes of macropores and micropores. We developed two sub-models that solve for the effective macropore size assuming either cylindrical (e.g., biological pores) or planar (e.g., shrinkage cracks and fissures) pore geometries, with the micropores assumed to be represented by a single effective radius. Furthermore, the model solves for the percent contribution to flow (wi) corresponding to the representative macro and micro pores. A user-friendly solver was developed to numerically solve the system of equations, given that relevant non-Newtonian viscosity models lack forms conducive to analytical integration. The proposed dual-permeability model is a unique attempt to derive physically based parameters capable of measuring dual hydraulic conductivities, and therefore may be useful in reducing parameter uncertainty and improving hydrologic model predictions.
Integrated nanohole array surface plasmon resonance sensing device using a dual-wavelength source
International Nuclear Information System (INIS)
Escobedo, C; Vincent, S; Choudhury, A I K; Campbell, J; Gordon, R; Brolo, A G; Sinton, D
2011-01-01
In this paper, we demonstrate a compact integrated nanohole array-based surface plasmon resonance sensing device. The unit includes a LED light source, driving circuitry, CCD detector, microfluidic network and computer interface, all assembled from readily available commercial components. A dual-wavelength LED scheme was implemented to increase spectral diversity and isolate intensity variations to be expected in the field. The prototype shows bulk sensitivity of 266 pixel intensity units/RIU and a limit of detection of 6 × 10 −4 RIU. Surface binding tests were performed, demonstrating functionality as a surface-based sensing system. This work is particularly relevant for low-cost point-of-care applications, especially those involving multiple tests and field studies. While nanohole arrays have been applied to many sensing applications, and their suitability to device integration is well established, this is the first demonstration of a fully integrated nanohole array-based sensing device.
Predicting sugar consumption: Application of an integrated dual-process, dual-phase model.
Hagger, Martin S; Trost, Nadine; Keech, Jacob J; Chan, Derwin K C; Hamilton, Kyra
2017-09-01
Excess consumption of added dietary sugars is related to multiple metabolic problems and adverse health conditions. Identifying the modifiable social cognitive and motivational constructs that predict sugar consumption is important to inform behavioral interventions aimed at reducing sugar intake. We tested the efficacy of an integrated dual-process, dual-phase model derived from multiple theories to predict sugar consumption. Using a prospective design, university students (N = 90) completed initial measures of the reflective (autonomous and controlled motivation, intentions, attitudes, subjective norm, perceived behavioral control), impulsive (implicit attitudes), volitional (action and coping planning), and behavioral (past sugar consumption) components of the proposed model. Self-reported sugar consumption was measured two weeks later. A structural equation model revealed that intentions, implicit attitudes, and, indirectly, autonomous motivation to reduce sugar consumption had small, significant effects on sugar consumption. Attitudes, subjective norm, and, indirectly, autonomous motivation to reduce sugar consumption predicted intentions. There were no effects of the planning constructs. Model effects were independent of the effects of past sugar consumption. The model identified the relative contribution of reflective and impulsive components in predicting sugar consumption. Given the prominent role of the impulsive component, interventions that assist individuals in managing cues-to-action and behavioral monitoring are likely to be effective in regulating sugar consumption. Copyright © 2017 Elsevier Ltd. All rights reserved.
Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L
This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.
Dual coding: a cognitive model for psychoanalytic research.
Bucci, W
1985-01-01
Four theories of mental representation derived from current experimental work in cognitive psychology have been discussed in relation to psychoanalytic theory. These are: verbal mediation theory, in which language determines or mediates thought; perceptual dominance theory, in which imagistic structures are dominant; common code or propositional models, in which all information, perceptual or linguistic, is represented in an abstract, amodal code; and dual coding, in which nonverbal and verbal information are each encoded, in symbolic form, in separate systems specialized for such representation, and connected by a complex system of referential relations. The weight of current empirical evidence supports the dual code theory. However, psychoanalysis has implicitly accepted a mixed model-perceptual dominance theory applying to unconscious representation, and verbal mediation characterizing mature conscious waking thought. The characterization of psychoanalysis, by Schafer, Spence, and others, as a domain in which reality is constructed rather than discovered, reflects the application of this incomplete mixed model. The representations of experience in the patient's mind are seen as without structure of their own, needing to be organized by words, thus vulnerable to distortion or dissolution by the language of the analyst or the patient himself. In these terms, hypothesis testing becomes a meaningless pursuit; the propositions of the theory are no longer falsifiable; the analyst is always more or less "right." This paper suggests that the integrated dual code formulation provides a more coherent theoretical framework for psychoanalysis than the mixed model, with important implications for theory and technique. In terms of dual coding, the problem is not that the nonverbal representations are vulnerable to distortion by words, but that the words that pass back and forth between analyst and patient will not affect the nonverbal schemata at all. Using the dual code
Connection between Einstein equations, nonlinear sigma models, and self-dual Yang-Mills theory
International Nuclear Information System (INIS)
Sanchez, N.; Whiting, B.
1986-01-01
The authors analyze the connection between nonlinear sigma models self-dual Yang-Mills theory, and general relativity (self-dual and non-self-dual, with and without killing vectors), both at the level of the equations and at the level of the different type of solutions (solitons and calorons) of these theories. They give a manifestly gauge invariant formulation of the self-dual gravitational field analogous to that given by Yang for the self-dual Yang-Mills field. This formulation connects in a direct and explicit way the self-dual Yang-Mills and the general relativity equations. They give the ''R gauge'' parametrization of the self-dual gravitational field (which corresponds to modified Yang's-type and Ernst equations) and analyze the correspondence between their different types of solutions. No assumption about the existence of symmetries in the space-time is needed. For the general case (non-self-dual), they show that the Einstein equations contain an O nonlinear sigma model. This connection with the sigma model holds irrespective of the presence of symmetries in the space-time. They found a new class of solutions of Einstein equations depending on holomorphic and antiholomorphic functions and we relate some subclasses of these solutions to solutions of simpler nonlinear field equations that are well known in other branches of physics, like sigma models, SineGordon, and Liouville equations. They include gravitational plane wave solutions. They analyze the response of different accelerated quantum detector models, compare them to the case when the detectors are linterial in an ordinary Planckian gas at a given temperature, and discuss the anisotropy of the detected response for Rindler observers
Directory of Open Access Journals (Sweden)
Pawel Boguslawski
2016-02-01
Full Text Available There is an increasing need for building models that permit interior navigation, e.g., for escape route analysis. This paper presents a non-manifold Computer-Aided Design (CAD data structure, the dual half-edge based on the Poincaré duality that expresses both the geometric representations of individual rooms and their topological relationships. Volumes and faces are expressed as vertices and edges respectively in the dual space, permitting a model just based on the storage of primal and dual vertices and edges. Attributes may be attached to all of these entities permitting, for example, shortest path queries between specified rooms, or to the exterior. Storage costs are shown to be comparable to other non-manifold models, and construction with local Euler-type operators is demonstrated with two large university buildings. This is intended to enhance current developments in 3D Geographic Information Systems for interior and exterior city modelling.
Real-time biodetection using a smartphone-based dual-color surface plasmon resonance sensor
Liu, Qiang; Yuan, Huizhen; Liu, Yun; Wang, Jiabin; Jing, Zhenguo; Peng, Wei
2018-04-01
We proposed a compact and cost-effective red-green dual-color fiber optic surface plasmon resonance (SPR) sensor based on the smartphone. Inherent color selectivity of phone cameras was utilized for real-time monitoring of red and green color channels simultaneously, which can reduce the chance of false detection and improve the sensitivity. Because there are no external prisms, complex optical lenses, or diffraction grating, simple optical configuration is realized. It has a linear response in a refractive index range of 1.326 to 1.351 (R2 = 0.991) with a resolution of 2.3 × 10 - 4 RIU. We apply it for immunoglobulin G (IgG) concentration measurement. Experimental results demonstrate that a linear SPR response was achieved for IgG concentrations varying from 0.02 to 0.30 mg / ml with good repeatability. It may find promising applications in the fields of public health and environment monitoring owing to its simple optics design and applicability in real-time, label-free biodetection.
[The dual process model of addiction. Towards an integrated model?].
Vandermeeren, R; Hebbrecht, M
2012-01-01
Neurobiology and cognitive psychology have provided us with a dual process model of addiction. According to this model, behavior is considered to be the dynamic result of a combination of automatic and controlling processes. In cases of addiction the balance between these two processes is severely disturbed. Automated processes will continue to produce impulses that ensure the continuance of addictive behavior. Weak, reflective or controlling processes are both the reason for and the result of the inability to forgo addiction. To identify features that are common to current neurocognitive insights into addiction and psychodynamic views on addiction. The picture that emerges from research is not clear. There is some evidence that attentional bias has a causal effect on addiction. There is no evidence that automatic associations have a causal effect, but there is some evidence that automatic action-tendencies do have a causal effect. Current neurocognitive views on the dual process model of addiction can be integrated with an evidence-based approach to addiction and with psychodynamic views on addiction.
Model tracking dual stochastic controller design under irregular internal noises
International Nuclear Information System (INIS)
Lee, Jong Bok; Heo, Hoon; Cho, Yun Hyun; Ji, Tae Young
2006-01-01
Although many methods about the control of irregular external noise have been introduced and implemented, it is still necessary to design a controller that will be more effective and efficient methods to exclude for various noises. Accumulation of errors due to model tracking, internal noises (thermal noise, shot noise and l/f noise) that come from elements such as resistor, diode and transistor etc. in the circuit system and numerical errors due to digital process often destabilize the system and reduce the system performance. New stochastic controller is adopted to remove those noises using conventional controller simultaneously. Design method of a model tracking dual controller is proposed to improve the stability of system while removing external and internal noises. In the study, design process of the model tracking dual stochastic controller is introduced that improves system performance and guarantees robustness under irregular internal noises which can be created internally. The model tracking dual stochastic controller utilizing F-P-K stochastic control technique developed earlier is implemented to reveal its performance via simulation
Distributed Model Predictive Control via Dual Decomposition
DEFF Research Database (Denmark)
Biegel, Benjamin; Stoustrup, Jakob; Andersen, Palle
2014-01-01
This chapter presents dual decomposition as a means to coordinate a number of subsystems coupled by state and input constraints. Each subsystem is equipped with a local model predictive controller while a centralized entity manages the subsystems via prices associated with the coupling constraints...
Dual elaboration models in attitude change processes
Directory of Open Access Journals (Sweden)
Žeželj Iris
2005-01-01
Full Text Available This article examines empirical and theoretical developments in research on attitude change in the past 50 years. It focuses the period from 1980 till present as well as cognitive response theories as the dominant theoretical approach in the field. The postulates of Elaboration Likelihood Model, as most-researched representative of dual process theories are studied, based on review of accumulated research evidence. Main research findings are grouped in four basic factors: message source, message content, message recipient and its context. Most influential criticisms of the theory are then presented regarding its empirical base and dual process assumption. Some possible applications and further research perspectives are discussed at the end.
Yu, Mengqun; Wang, Hong; Fu, Fei; Li, Linyao; Li, Jing; Li, Gan; Song, Yang; Swihart, Mark T; Song, Erqun
2017-04-04
The effective monitoring, identification, and quantification of pathogenic bacteria is essential for addressing serious public health issues. In this study, we present a universal and facile one-step strategy for sensitive and selective detection of pathogenic bacteria using a dual-molecular affinity-based Förster (fluorescence) resonance energy transfer (FRET) platform based on the recognition of bacterial cell walls by antibiotic and aptamer molecules, respectively. As a proof of concept, Vancomycin (Van) and a nucleic acid aptamer were employed in a model dual-recognition scheme for detecting Staphylococcus aureus (Staph. aureus). Within 30 min, by using Van-functionalized gold nanoclusters and aptamer-modified gold nanoparticles as the energy donor and acceptor, respectively, the FRET signal shows a linear variation with the concentration of Staph. aureus in the range from 20 to 10 8 cfu/mL with a detection limit of 10 cfu/mL. Other nontarget bacteria showed negative results, demonstrating the good specificity of the approach. When employed to assay Staph. aureus in real samples, the dual-recognition FRET strategy showed recoveries from 99.00% to the 109.75% with relative standard derivations (RSDs) less than 4%. This establishes a universal detection platform for sensitive, specific, and simple pathogenic bacteria detection, which could have great impact in the fields of food/public safety monitoring and infectious disease diagnosis.
A dual model approach to ground water recovery trench design
International Nuclear Information System (INIS)
Clodfelter, C.L.; Crouch, M.S.
1992-01-01
The design of trenches for contaminated ground water recovery must consider several variables. This paper presents a dual-model approach for effectively recovering contaminated ground water migrating toward a trench by advection. The approach involves an analytical model to determine the vertical influence of the trench and a numerical flow model to determine the capture zone within the trench and the surrounding aquifer. The analytical model is utilized by varying trench dimensions and head values to design a trench which meets the remediation criteria. The numerical flow model is utilized to select the type of backfill and location of sumps within the trench. The dual-model approach can be used to design a recovery trench which effectively captures advective migration of contaminants in the vertical and horizontal planes
Dyon Condensation and Dual Superconductivity in Abelian Higgs Model of QCD
Directory of Open Access Journals (Sweden)
B. S. Rajput
2010-01-01
Full Text Available Constructing the effective action for dyonic field in Abelian projection of QCD, it has been demonstrated that any charge (electrical or magnetic of dyon screens its own direct potential to which it minimally couples and antiscreens the dual potential leading to dual superconductivity in accordance with generalized Meissner effect. Taking the Abelian projection of QCD, an Abelian Higgs model, incorporating dual superconductivity and confinement, has been constructed and its representation has been obtained in terms of average of Wilson loop.
Functional Dual Adaptive Control with Recursive Gaussian Process Model
International Nuclear Information System (INIS)
Prüher, Jakub; Král, Ladislav
2015-01-01
The paper deals with dual adaptive control problem, where the functional uncertainties in the system description are modelled by a non-parametric Gaussian process regression model. Current approaches to adaptive control based on Gaussian process models are severely limited in their practical applicability, because the model is re-adjusted using all the currently available data, which keeps growing with every time step. We propose the use of recursive Gaussian process regression algorithm for significant reduction in computational requirements, thus bringing the Gaussian process-based adaptive controllers closer to their practical applicability. In this work, we design a bi-criterial dual controller based on recursive Gaussian process model for discrete-time stochastic dynamic systems given in an affine-in-control form. Using Monte Carlo simulations, we show that the proposed controller achieves comparable performance with the full Gaussian process-based controller in terms of control quality while keeping the computational demands bounded. (paper)
A dual porosity model of nutrient uptake by root hairs
Zygalakis, K. C.; Kirk, G. J. D.; Jones, D. L.; Wissuwa, M.; Roose, T.
2011-01-01
Summary: • The importance of root hairs in the uptake of sparingly soluble nutrients is understood qualitatively, but not quantitatively, and this limits efforts to breed plants tolerant of nutrient-deficient soils. • Here, we develop a mathematical model of nutrient uptake by root hairs allowing for hair geometry and the details of nutrient transport through soil, including diffusion within and between soil particles. We give illustrative results for phosphate uptake. • Compared with conventional 'single porosity' models, this 'dual porosity' model predicts greater root uptake because more nutrient is available by slow release from within soil particles. Also the effect of soil moisture is less important with the dual porosity model because the effective volume available for diffusion in the soil is larger, and the predicted effects of hair length and density are different. • Consistent with experimental observations, with the dual porosity model, increases in hair length give greater increases in uptake than increases in hair density per unit main root length. The effect of hair density is less in dry soil because the minimum concentration in solution for net influx is reached more rapidly. The effect of hair length is much less sensitive to soil moisture. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.
A dual porosity model of nutrient uptake by root hairs
Zygalakis, K. C.
2011-08-09
Summary: • The importance of root hairs in the uptake of sparingly soluble nutrients is understood qualitatively, but not quantitatively, and this limits efforts to breed plants tolerant of nutrient-deficient soils. • Here, we develop a mathematical model of nutrient uptake by root hairs allowing for hair geometry and the details of nutrient transport through soil, including diffusion within and between soil particles. We give illustrative results for phosphate uptake. • Compared with conventional \\'single porosity\\' models, this \\'dual porosity\\' model predicts greater root uptake because more nutrient is available by slow release from within soil particles. Also the effect of soil moisture is less important with the dual porosity model because the effective volume available for diffusion in the soil is larger, and the predicted effects of hair length and density are different. • Consistent with experimental observations, with the dual porosity model, increases in hair length give greater increases in uptake than increases in hair density per unit main root length. The effect of hair density is less in dry soil because the minimum concentration in solution for net influx is reached more rapidly. The effect of hair length is much less sensitive to soil moisture. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.
International Nuclear Information System (INIS)
Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M.
2006-01-01
Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma
Energy Technology Data Exchange (ETDEWEB)
Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M. [Policlinico San Donato, San Donato Milanese, Milan (Italy). Depts. of Radiology, Arrhythmia and Electrophysiology Center
2006-02-15
Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma.
International Nuclear Information System (INIS)
Xiang Xing-Ye; Wang Kui-Ru; Yuan Jin-Hui; Jin Bo-Yuan; Sang Xin-Zhu; Yu Chong-Xiu
2014-01-01
We propose a novel high-performance digital optical sensor based on the Mach—Zehnder interferential effect and the dual-microring resonators with the waveguide-coupled feedback. The simulation results show that the sensitivity of the sensor can be orders of magnitude higher than that of a conventional sensor, and high quality factor is not critical in it. Moreover, by optimizing the length of the feedback waveguide to be equal to the perimeter of the ring, the measurement range of the proposed sensor is twice as much as that of the conventional sensor in the weak coupling case
Directory of Open Access Journals (Sweden)
Zhang Y
2013-12-01
Full Text Available Yue Zhang,1 Bin Zhang,1 Fei Liu,1,2 Jianwen Luo,1,3 Jing Bai1 1Department of Biomedical Engineering, School of Medicine, 2Tsinghua-Peking Center for Life Sciences, 3Center for Biomedical Imaging Research, Tsinghua University, Beijing, People's Republic of China Abstract: Dual-modality imaging combines the complementary advantages of different modalities, and offers the prospect of improved preclinical research. The combination of fluorescence imaging and magnetic resonance imaging (MRI provides cross-validated information and direct comparison between these modalities. Here, we report on the application of a novel tumor-targeted, dual-labeled nanoparticle (NP, utilizing iron oxide as the MRI contrast agent and near infrared (NIR dye Cy5.5 as the fluorescent agent. Results of in vitro experiments verified the specificity of the NP to tumor cells. In vivo tumor targeting and uptake of the NPs in a mouse model were visualized by fluorescence and MR imaging collected at different time points. Quantitative analysis was carried out to evaluate the efficacy of MRI contrast enhancement. Furthermore, tomographic images were also acquired using both imaging modalities and cross-validated information of tumor location and size between these two modalities was revealed. The results demonstrate that the use of dual-labeled NPs can facilitate the dual-modal detection of tumors, information cross-validation, and direct comparison by combing fluorescence molecular tomography (FMT and MRI. Keywords: dual-modality, fluorescence molecular tomography (FMT, magnetic resonance imaging (MRI, nanoparticle
High effective inverse dynamics modelling for dual-arm robot
Shen, Haoyu; Liu, Yanli; Wu, Hongtao
2018-05-01
To deal with the problem of inverse dynamics modelling for dual arm robot, a recursive inverse dynamics modelling method based on decoupled natural orthogonal complement is presented. In this model, the concepts and methods of Decoupled Natural Orthogonal Complement matrices are used to eliminate the constraint forces in the Newton-Euler kinematic equations, and the screws is used to express the kinematic and dynamics variables. On this basis, the paper has developed a special simulation program with symbol software of Mathematica and conducted a simulation research on the a dual-arm robot. Simulation results show that the proposed method based on decoupled natural orthogonal complement can save an enormous amount of CPU time that was spent in computing compared with the recursive Newton-Euler kinematic equations and the results is correct and reasonable, which can verify the reliability and efficiency of the method.
Directory of Open Access Journals (Sweden)
Yonghua Zhan
2017-12-01
Full Text Available Multifunctional manganese oxide nanoparticles (NPs with impressive enhanced T1 contrast ability show great promise in biomedical diagnosis. Herein, we developed a dual-modality imaging agent system based on polyethylene glycol (PEG-coated manganese oxide NPs conjugated with organic dye (Cy7.5, which functions as a fluorescence imaging (FI agent as well as a magnetic resonance imaging (MRI imaging agent. The formed Mn3O4@PEG-Cy7.5 NPs with the size of ~10 nm exhibit good colloidal stability in different physiological media. Serial FI and MRI studies that non-invasively assessed the bio-distribution pattern and the feasibility for in vivo dual-modality imaging-guided lymph node mapping have been investigated. In addition, histological and biochemical analyses exhibited low toxicity even at a dose of 20 mg/kg in vivo. Since Mn3O4@PEG-Cy7.5 NPs exhibited desirable properties as imaging agents and good biocompatibility, this work offers a robust, safe, and accurate diagnostic platform based on manganese oxide NPs for tumor metastasis diagnosis.
A plug’n’play WiFi surface-mount dual-loop antenna
Directory of Open Access Journals (Sweden)
Pedro Chamorro-Posada
2017-04-01
Full Text Available We present the design, modelling and characterization in the 2.4 GHz band of a B-shaped antenna consisting of a dual circular loop over a conductor plane. The proposed design is intrinsically unbalanced and features a very good match to a 50 Ω line at resonance, which makes our device essentially plug’n’play for a coaxial cable feed. Another interesting property of the proposed antenna is its simplicity of construction. The antenna has been modelled using the moment method. A prototype resonant at 2.4 GHz has been built and we have measured its impedance in this spectral region. The radiation pattern and the gain at resonance have also been characterized and the device has been shown to provide 6.31 dBi gain. The overall properties of the device make it an excellent option to provide WiFi connectivity when required in open hardware implementations.
DEFF Research Database (Denmark)
Niemann, Hans Henrik
2003-01-01
A different aspect of using the parameterisation of all systems stabilised by a given controller, i.e. the dual Youla parameterisation, is considered. The relation between system change and the dual Youla parameter is derived in explicit form. A number of standard uncertain model descriptions...... are considered and the relation with the dual Youla parameter given. Some applications of the dual Youla parameterisation are considered in connection with the design of controllers and model/performance validation....
On-chip dual comb source for spectroscopy
Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L.; Lipson, Michal
2016-01-01
Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high-quality-factor microcavities has hindered the development of an on-chip dual comb source. Here, we report the first simultaneous generation of two microresonator comb...
International Family Migration and the Dual-Earner Model
DEFF Research Database (Denmark)
Munk, Martin D.; Nikolka, Till; Poutvaara, Panu
2018-01-01
Gender differences in labor force participation are exceptionally small in Nordic countries. We investigate how couples emigrating from Denmark self-select and sort into different destinations and whether couples pursue the dual-earner model, in which both partners work, when abroad. Female labor...
Chrystal and Proudman resonances simulated with three numerical models
Bubalo, Maja; Janeković, Ivica; Orlić, Mirko
2018-05-01
The aim of this work was to study Chrystal and Proudman resonances in a simple closed basin and to explore and compare how well the two resonant mechanisms are reproduced with different, nowadays widely used, numerical ocean models. The test case was based on air pressure disturbances of two commonly used shapes (a sinusoidal and a boxcar), having various wave lengths, and propagating at different speeds. Our test domain was a closed rectangular basin, 300 km long with a uniform depth of 50 m, with the theoretical analytical solution available for benchmark. In total, 2250 simulations were performed for each of the three different numerical models: ADCIRC, SCHISM and ROMS. During each of the simulations, we recorded water level anomalies and computed the integral of the energy density spectrum for a number of points distributed along the basin. We have successfully documented the transition from Proudman to Chrystal resonance that occurs for a sinusoidal air pressure disturbance having a wavelength between one and two basin lengths. An inter-model comparison of the results shows that different models represent the two resonant phenomena in a slightly different way. For Chrystal resonance, all the models showed similar behavior; however, ADCIRC model providing slightly higher values of the mean resonant period than the other two models. In the case of Proudman resonance, the most consistent results, closest to the analytical solution, were obtained using ROMS model, which reproduced the mean resonant speed equal to 22.00 m/s— i.e., close to the theoretical value of 22.15 m/s. ADCIRC and SCHISM models showed small deviations from that value, with the mean speed being slightly lower—21.97 m/s (ADCIRC) and 21.93 m/s (SCHISM). The findings may seem small but could play an important role when resonance is a crucial process producing enhancing effects by two orders of magnitude (i.e., meteotsunamis).
Firpo, M.-C.; Constantinescu, D.
2011-03-01
The issue of magnetic confinement in magnetic fusion devices is addressed within a purely magnetic approach. Using some Hamiltonian models for the magnetic field lines, the dual impact of low magnetic shear is shown in a unified way. Away from resonances, it induces a drastic enhancement of magnetic confinement that favors robust internal transport barriers (ITBs) and stochastic transport reduction. When low shear occurs for values of the winding of the magnetic field lines close to low-order rationals, the amplitude thresholds of the resonant modes that break internal transport barriers by allowing a radial stochastic transport of the magnetic field lines may be quite low. The approach can be applied to assess the robustness versus magnetic perturbations of general (almost) integrable magnetic steady states, including nonaxisymmetric ones such as the important single-helicity steady states. This analysis puts a constraint on the tolerable mode amplitudes compatible with ITBs and may be proposed as a possible explanation of diverse experimental and numerical signatures of their collapses.
International Nuclear Information System (INIS)
Koyumdjieva, N.
2006-01-01
A statistical model for the resonant cross section structure in the Unresolved Resonance Region has been developed in the framework of the R-matrix formalism in Reich Moore approach with effective accounting of the resonance parameters fluctuations. The model uses only the average resonance parameters and can be effectively applied for analyses of cross sections functional, averaged over many resonances. Those are cross section moments, transmission and self-indication functions measured through thick sample. In this statistical model the resonant cross sections structure is accepted to be periodic and the R-matrix is a function of ε=E/D with period 0≤ε≤N; R nc (ε)=π/2√(S n *S c )1/NΣ(i=1,N)(β in *β ic *ctg[π(ε i - = ε-iS i )/N]; Here S n ,S c ,S i is respectively neutron strength function, strength function for fission or inelastic channel and strength function for radiative capture, N is the number of resonances (ε i ,β i ) that obey the statistic of Porter-Thomas and Wigner's one. The simple case of this statistical model concerns the resonant cross section structure for non-fissile nuclei under the threshold for inelastic scattering - the model of the characteristic function with HARFOR program. In the above model some improvements of calculation of the phases and logarithmic derivatives of neutron channels have been done. In the parameterization we use the free parameter R l ∞ , which accounts the influence of long-distant resonances. The above scheme for statistical modelling of the resonant cross section structure has been applied for evaluation of experimental data for total, capture and inelastic cross sections for 232 Th in the URR (4-150) keV and also the transmission and self-indication functions in (4-175) keV. The set of evaluated average resonance parameters have been obtained. The evaluated average resonance parameters in the URR are consistent with those in the Resolved Resonance Region (CRP for Th-U cycle, Vienna, 2006
The Friedrichs model and its use in resonance phenomena
Energy Technology Data Exchange (ETDEWEB)
Gadella, M. [Departamento de Fisica Teorica, Atomica y Optica, Facultad de Ciencias, 47071 Valladolid (Spain); Pronko, G.P. [Institute for High Energy Physics, Protvino 142284, Moscow Region (Russian Federation)
2011-09-15
We present here a relation of different types of Friedrichs models and their use in the description and comprehension of resonance phenomena. We first discuss the basic Friedrichs model and obtain its resonance in the case that this is simple or doubly degenerated. Next, we discuss the model with N levels and show how the probability amplitude has an oscillatory behavior. Two generalizations of the Friedrichs model are suitable to introduce resonance behavior in quantum field theory. We also discuss a discrete version of the Friedrichs model and also a resonant interaction between two systems both with continuous spectrum. In an appendix, we review the mathematics of rigged Hilbert spaces. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
An integrated treatment model for dual diagnosis of psychosis and addiction.
Minkoff, K
1989-10-01
A model that integrates the treatment of patients with a dual diagnosis of psychosis and addiction has been developed on a general hospital psychiatric unit. The model emphasizes the parallels between the standard biopsychosocial illness-and-rehabilitation model for treatment of serious psychiatric disorders and the 12-step disease-and-recovery model of Alcoholics Anonymous for treatment of addiction. Dual-diagnosis patients are viewed as having two primary, chronic, biologic mental illnesses, each requiring specific treatment to stabilize acute symptoms and engage the patient in a recovery process. An integrated treatment program is described, as are the steps taken to alleviate psychiatric clinicians' concerns about patient involvement in AA and addiction clinicians' discomfort with patients' use of medication.
An extended dual search space model of scientific discovery learning
van Joolingen, Wouter; de Jong, Anthonius J.M.
1997-01-01
This article describes a theory of scientific discovery learning which is an extension of Klahr and Dunbar''s model of Scientific Discovery as Dual Search (SDDS) model. We present a model capable of describing and understanding scientific discovery learning in complex domains in terms of the SDDS
Self-dual form of Ruijsenaars–Schneider models and ILW equation with discrete Laplacian
Directory of Open Access Journals (Sweden)
A. Zabrodin
2018-02-01
Full Text Available We discuss a self-dual form or the Bäcklund transformations for the continuous (in time variable glN Ruijsenaars–Schneider model. It is based on the first order equations in N+M complex variables which include N positions of particles and M dual variables. The latter satisfy equations of motion of the glM Ruijsenaars–Schneider model. In the elliptic case it holds M=N while for the rational and trigonometric models M is not necessarily equal to N. Our consideration is similar to the previously obtained results for the Calogero–Moser models which are recovered in the non-relativistic limit. We also show that the self-dual description of the Ruijsenaars–Schneider models can be derived from complexified intermediate long wave equation with discrete Laplacian by means of the simple pole ansatz likewise the Calogero–Moser models arise from ordinary intermediate long wave and Benjamin–Ono equations.
Scale-invariant inclusive spectra in a dual model
International Nuclear Information System (INIS)
Chikovani, Z.E.; Jenkovsky, L.L.; Martynov, E.S.
1979-01-01
One-particle inclusive distributions at large transverse momentum phisub(tr) are shown to scale, Edσ/d 3 phi approximately phisub(tr)sup(-N)(1-Xsub(tr))sup(1+N/2)lnphisub(tr), in a dual model with Mandelstam analyticity if the Regge trajectories are logarithmic asymptotically
Osman, Kariman I.; Joshi, Amitabh
2017-01-01
The optical trapping phenomenon is investigated in the probe absorptive susceptibility spectra, during the interaction of four-level N-type atomic system with three transverse Gaussian fields, in a Doppler broadened medium. The system was studied under different temperature settings of 87Rb atomic vapor as well as different non-radiative decay rate. The system exhibits a combination of dual electromagnetically induced transparency with electromagnetically induced absorption (EIA) or transparency (EIT) resonances simultaneously in near/far field. Also, the optical trapping phenomenon is considerably affected by the non-radiative decay rate.
A dual system model of preferences under risk.
Mukherjee, Kanchan
2010-01-01
This article presents a dual system model (DSM) of decision making under risk and uncertainty according to which the value of a gamble is a combination of the values assigned to it independently by the affective and deliberative systems. On the basis of research on dual process theories and empirical research in Hsee and Rottenstreich (2004) and Rottenstreich and Hsee (2001) among others, the DSM incorporates (a) individual differences in disposition to rational versus emotional decision making, (b) the affective nature of outcomes, and (c) different task construals within its framework. The model has good descriptive validity and accounts for (a) violation of nontransparent stochastic dominance, (b) fourfold pattern of risk attitudes, (c) ambiguity aversion, (d) common consequence effect, (e) common ratio effect, (f) isolation effect, and (g) coalescing and event-splitting effects. The DSM is also used to make several novel predictions of conditions under which specific behavior patterns may or may not occur.
Dual deep modeling: multi-level modeling with dual potencies and its formalization in F-Logic.
Neumayr, Bernd; Schuetz, Christoph G; Jeusfeld, Manfred A; Schrefl, Michael
2018-01-01
An enterprise database contains a global, integrated, and consistent representation of a company's data. Multi-level modeling facilitates the definition and maintenance of such an integrated conceptual data model in a dynamic environment of changing data requirements of diverse applications. Multi-level models transcend the traditional separation of class and object with clabjects as the central modeling primitive, which allows for a more flexible and natural representation of many real-world use cases. In deep instantiation, the number of instantiation levels of a clabject or property is indicated by a single potency. Dual deep modeling (DDM) differentiates between source potency and target potency of a property or association and supports the flexible instantiation and refinement of the property by statements connecting clabjects at different modeling levels. DDM comes with multiple generalization of clabjects, subsetting/specialization of properties, and multi-level cardinality constraints. Examples are presented using a UML-style notation for DDM together with UML class and object diagrams for the representation of two-level user views derived from the multi-level model. Syntax and semantics of DDM are formalized and implemented in F-Logic, supporting the modeler with integrity checks and rich query facilities.
Hyperon resonances in SU(3) soliton models
International Nuclear Information System (INIS)
Scoccola, N.N.
1990-01-01
Hyperon resonances excited in kaon-nucleon scattering are investigated in the framework of an SU(3) soliton model in which kaon degrees of freedom are treated as small fluctuations around an SU(2) soliton. For partial waves l≥2 the model predicts correctly the quantum numbers and average excitation energies of most of the experimentally observed Λ and Σ resonances. Some disagreements are found for lower partial waves. (orig.)
3D modeling of dual wind-up extensional rheometers
DEFF Research Database (Denmark)
Yu, Kaijia; Román Marín, José Manuel; Rasmussen, Henrik K.
2010-01-01
Fully three-dimensional numerical simulations of a dual wind-up drum rheometer of the Sentmanat Extensional Rheometer (SER; Sentmanat, 2004 [1]) or the Extensional Viscosity Fixture (EVF; Garritano and Berting, 2006 [2]) type have been performed. In the SER and EVF a strip of rectangular shape...... is attached onto two drums, followed by a rotation of both drums in opposite direction. The numerical modeling is based on integral constitutive equations of the K-BKZ type. Generally, to ensure a proper uni-axial extensional deformation in dual wind-up drum rheometers the simulations show that a very small...
Dual-band left-handed metamaterials fabricated by using tree-shaped fractal
International Nuclear Information System (INIS)
Xu He-Xiu; Wang Guang-Ming; Yang Zi-Mu; Wang Jia-Fu
2012-01-01
A method of fabricating dual-band left-handed metematerials (LHMs) is investigated numerically and experimentally by single-sided tree-like fractals. The resulting structure features multiband magnetic resonances and two electric resonances. By appropriately adjusting the dimensions, two left-handed (LH) bands with simultaneous negative permittivity and permeability are engineered and are validated by full-wave eigenmode analysis and measurement as well in the microwave frequency range. To study the multi-resonant mechanism in depth, the LHM is analysed from three different perspectives of field distribution analysis, circuit model analysis, and geometrical parameters evaluation. The derived formulae are consistent with all simulated results and resulting electromagnetic phenomena, indicating the effectiveness of the established theory. The method provides an alternative to the design of multi-band LHM and has the advantage of not requiring two individual resonant particles and electrically continuous wires, which in turn facilitates planar design and considerably simplifies the fabrication. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Modeling of supermodes in coupled unstable resonators
International Nuclear Information System (INIS)
Townsend, S.S.
1986-01-01
A general formalism describing the supermodes of an array of N identical, circulantly coupled resonators is presented. The symmetry of the problem results in a reduction of the N coupled integral equations to N decoupled integral equations. Each independent integral equation defines a set of single-resonator modes derived for a hypothetical resonator whose geometry resembles a member of the real array with the exception that all coupling beams are replaced by feedback beams, each with a prescribed constant phase. A given array supermode consists of a single equivalent resonator mode appearing repetitively in each resonator with a prescribed relative phase between individual resonators. The specific array design chosen for example is that of N adjoint coupled confocal unstable resonators. The impact of coupling on the computer modeling of this system is discussed and computer results for the cases of two- and four-laser coupling are presented
The dual-electrode DC arc furnace-modelling brush arc conditions
Reynolds, Q.G.
2012-01-01
The dual-electrode DC arc furnace, an alternative design using an anode and cathode electrode instead of a hearth anode, was studied at small scale using computational modelling methods. Particular attention was paid to the effect of two key design variables, the arc length and the electrode separation, on the furnace behaviour. It was found that reducing the arc length to brush arc conditions was a valid means of overcoming several of the limitations of the dual-electrode design, namely high...
Dual regression physiological modeling of resting-state EPI power spectra: Effects of healthy aging.
Viessmann, Olivia; Möller, Harald E; Jezzard, Peter
2018-02-02
Aging and disease-related changes in the arteriovasculature have been linked to elevated levels of cardiac cycle-induced pulsatility in the cerebral microcirculation. Functional magnetic resonance imaging (fMRI), acquired fast enough to unalias the cardiac frequency contributions, can be used to study these physiological signals in the brain. Here, we propose an iterative dual regression analysis in the frequency domain to model single voxel power spectra of echo planar imaging (EPI) data using external recordings of the cardiac and respiratory cycles as input. We further show that a data-driven variant, without external physiological traces, produces comparable results. We use this framework to map and quantify cardiac and respiratory contributions in healthy aging. We found a significant increase in the spatial extent of cardiac modulated white matter voxels with age, whereas the overall strength of cardiac-related EPI power did not show an age effect. Copyright © 2018. Published by Elsevier Inc.
A Dual-Stage Two-Phase Model of Selective Attention
Hubner, Ronald; Steinhauser, Marco; Lehle, Carola
2010-01-01
The dual-stage two-phase (DSTP) model is introduced as a formal and general model of selective attention that includes both an early and a late stage of stimulus selection. Whereas at the early stage information is selected by perceptual filters whose selectivity is relatively limited, at the late stage stimuli are selected more efficiently on a…
Phase-field modeling of corrosion kinetics under dual-oxidants
Wen, You-Hai; Chen, Long-Qing; Hawk, Jeffrey A.
2012-04-01
A phase-field model is proposed to simulate corrosion kinetics under a dual-oxidant atmosphere. It will be demonstrated that the model can be applied to simulate corrosion kinetics under oxidation, sulfidation and simultaneous oxidation/sulfidation processes. Phase-dependent diffusivities are incorporated in a natural manner and allow more realistic modeling as the diffusivities usually differ by many orders of magnitude in different phases. Simple free energy models are then used for testing the model while calibrated free energy models can be implemented for quantitative modeling.
Chen, Ning; Shao, Chen; Li, Shuai; Wang, Zihao; Qu, Yanming; Gu, Wei; Yu, Chunjiang; Ye, Ling
2015-11-01
The fusion of molecular and anatomical modalities facilitates more reliable and accurate detection of tumors. Herein, we prepared the PEG-Cy5.5 conjugated MnO nanoparticles (MnO-PEG-Cy5.5 NPs) with magnetic resonance (MR) and near-infrared fluorescence (NIRF) imaging modalities. The applicability of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe for the detection of brain gliomas was investigated. In vivo MR contrast enhancement of the MnO-PEG-Cy5.5 nanoprobe in the tumor region was demonstrated. Meanwhile, whole-body NIRF imaging of glioma bearing nude mouse exhibited distinct tumor localization upon injection of MnO-PEG-Cy5.5 NPs. Moreover, ex vivo CLSM imaging of the brain slice hosting glioma indicated the preferential accumulation of MnO-PEG-Cy5.5 NPs in the glioma region. Our results therefore demonstrated the potential of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe in improving the diagnostic efficacy by simultaneously providing anatomical information from deep inside the body and more sensitive information at the cellular level. Copyright © 2015 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Sharma, S; Turner, M M
2013-01-01
Dual-frequency capacitive discharges are widespread in the semiconductor industry and are used, for example, in etching of semiconductor materials to manufacture microchips. In low-pressure dual radio-frequency capacitive discharges, stochastic heating is an important phenomenon. Recent theoretical work on this problem using several different approaches has produced results that are broadly in agreement insofar as scaling with the discharge parameters is concerned, but there remains some disagreement in detail concerning the absolute size of the effect for the case of dual-frequency capacitive discharges. In this work, we investigate the dependence of stochastic heating on various discharge parameters with the help of particle-in-cell (PIC) simulation. The dual-frequency analytical models are in fair agreement with PIC results for values of the low-frequency current density amplitude J lf (or dimensionless control parameter H lf ∼ 5) typical of many modern experiments. However, for higher values of J lf (or higher H lf ), new physical phenomena (like field reversal, reflection of ions, etc) appear and the simulation results deviate from existing dual-frequency analytical models. On the other hand, for lower J lf (or lower H lf ) again the simulation results deviate from analytical models. So this research work produces a relatively extensive set of simulation data that may be used to validate theories over a wide range of parameters. (paper)
Model for resonant plasma probe.
Energy Technology Data Exchange (ETDEWEB)
Warne, Larry Kevin; Johnson, William Arthur; Hebner, Gregory Albert; Jorgenson, Roy E.; Coats, Rebecca Sue
2007-04-01
This report constructs simple circuit models for a hairpin shaped resonant plasma probe. Effects of the plasma sheath region surrounding the wires making up the probe are determined. Electromagnetic simulations of the probe are compared to the circuit model results. The perturbing effects of the disc cavity in which the probe operates are also found.
Markov Chain Models for Stochastic Behavior in Resonance Overlap Regions
McCarthy, Morgan; Quillen, Alice
2018-01-01
We aim to predict lifetimes of particles in chaotic zoneswhere resonances overlap. A continuous-time Markov chain model isconstructed using mean motion resonance libration timescales toestimate transition times between resonances. The model is applied todiffusion in the co-rotation region of a planet. For particles begunat low eccentricity, the model is effective for early diffusion, butnot at later time when particles experience close encounters to the planet.
International Nuclear Information System (INIS)
Menezes, R.; Nascimento, J.R.S.; Ribeiro, R.F.; Wotzasek, C.
2002-01-01
We study the dual equivalence between the non-linear generalization of the self-dual (NSD BF ) and the topologically massive B and F models with particular emphasis on the non-linear electrodynamics proposed by Born and Infeld. This is done through a dynamical gauge embedding of the non-linear self-dual model yielding to a gauge invariant and dynamically equivalent theory. We clearly show that non-polinomial NSD BF models can be map, through a properly defined duality transformation into TM BF actions. The general result obtained is then particularized for a number of examples, including the Born-Infeld-BF (BIBF) model that has experienced a revival in the recent literature
3D modeling of dual-gate FinFET.
Mil'shtein, Samson; Devarakonda, Lalitha; Zanchi, Brian; Palma, John
2012-11-13
The tendency to have better control of the flow of electrons in a channel of field-effect transistors (FETs) did lead to the design of two gates in junction field-effect transistors, field plates in a variety of metal semiconductor field-effect transistors and high electron mobility transistors, and finally a gate wrapping around three sides of a narrow fin-shaped channel in a FinFET. With the enhanced control, performance trends of all FETs are still challenged by carrier mobility dependence on the strengths of the electrical field along the channel. However, in cases when the ratio of FinFET volume to its surface dramatically decreases, one should carefully consider the surface boundary conditions of the device. Moreover, the inherent non-planar nature of a FinFET demands 3D modeling for accurate analysis of the device performance. Using the Silvaco modeling tool with quantization effects, we modeled a physical FinFET described in the work of Hisamoto et al. (IEEE Tran. Elec. Devices 47:12, 2000) in 3D. We compared it with a 2D model of the same device. We demonstrated that 3D modeling produces more accurate results. As 3D modeling results came close to experimental measurements, we made the next step of the study by designing a dual-gate FinFET biased at Vg1 >Vg2. It is shown that the dual-gate FinFET carries higher transconductance than the single-gate device.
Design of high power solid-state pulsed laser resonators
International Nuclear Information System (INIS)
Narro, R.; Ponce, L.; Arronte, M.
2009-01-01
Methods and configurations for the design of high power solid-state pulsed laser resonators, operating in free running, are presented. For fundamental mode high power resonators, a method is proposed for the design of a resonator with joined stability zones. In the case of multimode resonators, two configurations are introduced for maximizing the laser overall efficiency due to the compensation of the astigmatism induced by the excitation. The first configuration consists in a triangular ring resonator. The results for this configuration are discussed theoretically, showing that it is possible to compensate the astigmatism of the thermal lens virtually in a 100%; however this is only possible for a specific pumping power. The second configuration proposes a dual-active medium resonator, rotated 90 degree one from the other around the optical axis, where each active medium acts as an astigmatic lens of the same dioptric power. The reliability of this configuration is corroborated experimentally using a Nd:YAG dual-active medium resonator. It is found that in the pumping power range where the astigmatism compensation is possible, the overall efficiency is constant, even when increasing the excitation power with the consequent increase of the thermal lens dioptric power. (Author)
Doorway-resonance model for pion-nucleon D- and F-wave scattering
International Nuclear Information System (INIS)
Ernst, D.J.; Parnell, G.E.; Assad, C.; Texas A and M Univ., College Station, TX
1990-01-01
A model for the resonant pion-nucleon D- and F-waves is developed which assumes that the pion-plus-nucleon couples to a resonance and that the resonance can serve as a doorway to the inelastic channels. With the use of simple form factors, the model is capable of reproducing the pion-nucleon phase shifts up to an energy of T π =1.4 GeV if the coupling of the elastic channel to the inelastic channels is taken from data as input into the model. A value for the mass of the resonance that would result in the absence of the coupling to decay channels is extracted from the data utilizing the model. This is the mass that is most easily modeled by bag models. For the non-resonant D- and F-wave channels a separable potential model is used. This model, like the resonance model, is developed utilizing the invariant amplitude which is free of kinematic singularities and uses invariant norms and phase spaces. The model is also applied to the S-wave channels. A relation between the resonance model and the Chew-Low model is discovered and used to derive an extended Chew-Low model which is applied to the P 13 , P 31 and P 33 channels. Implications of the model for understanding the range of the pion-nucleon interaction and the dynamic structure of the interaction are presented. (orig.)
Modeling of nanofabricated paddle bridges for resonant mass sensing
International Nuclear Information System (INIS)
Lobontiu, N.; Ilic, B.; Garcia, E.; Reissman, T.; Craighead, H. G.
2006-01-01
The modeling of nanopaddle bridges is studied in this article by proposing a lumped-parameter mathematical model which enables structural characterization in the resonant domain. The distributed compliance and inertia of all three segments composing a paddle bridge are taken into consideration in order to determine the equivalent lumped-parameter stiffness and inertia fractions, and further on the bending and torsion resonant frequencies. The approximate model produces results which are confirmed by finite element analysis and experimental measurements. The model is subsequently utilized to quantify the amount of mass which attaches to the bridge by predicting the modified resonant frequencies in either bending or torsion
A Test of Two Alternative Cognitive Processing Models: Learning Styles and Dual Coding
Cuevas, Joshua; Dawson, Bryan L.
2018-01-01
This study tested two cognitive models, learning styles and dual coding, which make contradictory predictions about how learners process and retain visual and auditory information. Learning styles-based instructional practices are common in educational environments despite a questionable research base, while the use of dual coding is less…
Nanodiamond-Manganese dual mode MRI contrast agents for enhanced liver tumor detection.
Hou, Weixin; Toh, Tan Boon; Abdullah, Lissa Nurrul; Yvonne, Tay Wei Zheng; Lee, Kuan J; Guenther, Ilonka; Chow, Edward Kai-Hua
2017-04-01
Contrast agent-enhanced magnetic resonance (MR) imaging is critical for the diagnosis and monitoring of a number of diseases, including cancer. Certain clinical applications, including the detection of liver tumors, rely on both T1 and T2-weighted images even though contrast agent-enhanced MR imaging is not always reliable. Thus, there is a need for improved dual mode contrast agents with enhanced sensitivity. We report the development of a nanodiamond-manganese dual mode contrast agent that enhanced both T1 and T2-weighted MR imaging. Conjugation of manganese to nanodiamonds resulted in improved longitudinal and transverse relaxivity efficacy over unmodified MnCl 2 as well as clinical contrast agents. Following intravenous administration, nanodiamond-manganese complexes outperformed current clinical contrast agents in an orthotopic liver cancer mouse model while also reducing blood serum concentration of toxic free Mn 2+ ions. Thus, nanodiamond-manganese complexes may serve as more effective dual mode MRI contrast agent, particularly in cancer. Copyright © 2016 Elsevier Inc. All rights reserved.
Entanglement Evolution of Jaynes-Cummings Model in Resonance Case and Non-resonance Case
Cheng, Jing; Chen, Xi; Shan, Chuan-Jia
2018-03-01
We investigate the entanglement evolution of a two-level atom and a quantized single model electromagnetic filed in the resonance and non-resonance cases. The effects of the initial state, detuning degree, photon number on the entanglement are shown in detail. The results show that the atom-cavity entanglement state appears with periodicity. The increasing of the photon number can make the period of quantum entanglement be shorter. In the non-resonant case, if we choose the suitable initial state the entanglement of atom-cavity can be 1.0
Model predictive control for a dual active bridge inverter with a floating bridge
Chowdhury, Shajjad; Wheeler, Patrick W.; Gerada, C.; Patel, Chintan
2016-01-01
This paper presents a Model Predictive Control technique applied to a dual active bridge inverter where one of the bridges is floating. The proposed floating bridge topology eliminates the need for isolation transformer in a dual inverter system and therefore reduces the size, weight and losses in the system. To achieve multilevel output voltage waveforms the floating inverter DC link capacitor is charged to the half of the main DC link voltage. A finite-set Model Predictive Control technique...
Dual Education: The Win-Win Model of Collaboration between Universities and Industry
Directory of Open Access Journals (Sweden)
Monika Pogatsnik
2018-05-01
Full Text Available The purpose of this paper is to describe the new experiences of the dual training model in engineering education in Hungary. This new model has been introduced recently in the higher education and has become a focus of interest. This is a fa-vorable program for the students to experience the real industry environment pri-or to graduation and it is a good tool to motivate them to study harder. The dual education students study in the institutional academic period together with the regular full-time students at their higher education institute, and parallel to their academic education they participate in the practical training. It gives the students an opportunity to join a specific training program at an enterprise. Being involved in specific "operational" practical tasks and project-oriented work enhances inde-pendent work, learning soft skills and experiencing the culture of work. Our ob-jectives are to analyze the benefits of the dual training for all three parties: the stu-dent, the company and university. The study confirms earlier results from prior studies which show, for example, that students who choose the dual option achieve better program outcomes.
Brain activations during bimodal dual tasks depend on the nature and combination of component tasks
Directory of Open Access Journals (Sweden)
Emma eSalo
2015-02-01
Full Text Available We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or simple (speaker-gender or font-shade discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley’s model modality atypical, that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.
Dual-Extrusion 3D Printing of Anatomical Models for Education
Smith, Michelle L.; Jones, James F. X.
2018-01-01
Two material 3D printing is becoming increasingly popular, inexpensive and accessible. In this paper, freely available printable files and dual extrusion fused deposition modelling were combined to create a number of functional anatomical models. To represent muscle and bone FilaFlex[superscript 3D] flexible filament and polylactic acid (PLA)…
Modeling and Control of a Dual-Input Isolated Full-Bridge Boost Converter
DEFF Research Database (Denmark)
Zhang, Zhe; Thomsen, Ole Cornelius; Andersen, Michael A. E.
2012-01-01
In this paper, a steady-state model, a large-signal (LS) model and an ac small-signal (SS) model for a recently proposed dual-input transformer-isolated boost converter are derived respectively by the switching flow-graph (SFG) nonlinear modeling technique. Based upon the converter’s model...
Two-Mode Resonator and Contact Model for Standing Wave Piezomotor
DEFF Research Database (Denmark)
Andersen, B.; Blanke, Mogens; Helbo, J.
2001-01-01
The paper presents a model for a standing wave piezoelectric motor with a two bending mode resonator. The resonator is modelled using Hamilton's principle and the Rayleigh-Ritz method. The contact is modelled using the Lagrange Multiplier method under the assumption of slip and it is showed how...... to solve the set of differential-algebraic equations. Detailed simulations show resonance frequencies as function of the piezoelement's position, tip trajectories and contact forces. The paper demonstrates that contact stiffness and stick should be included in such model to obtain physically realistic...
Vertically-Integrated Dual-Continuum Models for CO2 Injection in Fractured Aquifers
Tao, Y.; Guo, B.; Bandilla, K.; Celia, M. A.
2017-12-01
Injection of CO2 into a saline aquifer leads to a two-phase flow system, with supercritical CO2 and brine being the two fluid phases. Various modeling approaches, including fully three-dimensional (3D) models and vertical-equilibrium (VE) models, have been used to study the system. Almost all of that work has focused on unfractured formations. 3D models solve the governing equations in three dimensions and are applicable to generic geological formations. VE models assume rapid and complete buoyant segregation of the two fluid phases, resulting in vertical pressure equilibrium and allowing integration of the governing equations in the vertical dimension. This reduction in dimensionality makes VE models computationally more efficient, but the associated assumptions restrict the applicability of VE model to formations with moderate to high permeability. In this presentation, we extend the VE and 3D models for CO2 injection in fractured aquifers. This is done in the context of dual-continuum modeling, where the fractured formation is modeled as an overlap of two continuous domains, one representing the fractures and the other representing the rock matrix. Both domains are treated as porous media continua and can be modeled by either a VE or a 3D formulation. The transfer of fluid mass between rock matrix and fractures is represented by a mass transfer function connecting the two domains. We have developed a computational model that combines the VE and 3D models, where we use the VE model in the fractures, which typically have high permeability, and the 3D model in the less permeable rock matrix. A new mass transfer function is derived, which couples the VE and 3D models. The coupled VE-3D model can simulate CO2 injection and migration in fractured aquifers. Results from this model compare well with a full-3D model in which both the fractures and rock matrix are modeled with 3D models, with the hybrid VE-3D model having significantly reduced computational cost. In
Self-dual configurations in Abelian Higgs models with k-generalized gauge field dynamics
Energy Technology Data Exchange (ETDEWEB)
Casana, R.; Cavalcante, A. [Departamento de Física, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil); Hora, E. da [Departamento de Física, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil); Coordenadoria Interdisciplinar de Ciência e Tecnologia, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil)
2016-12-14
We have shown the existence of self-dual solutions in new Maxwell-Higgs scenarios where the gauge field possesses a k-generalized dynamic, i.e., the kinetic term of gauge field is a highly nonlinear function of F{sub μν}F{sup μν}. We have implemented our proposal by means of a k-generalized model displaying the spontaneous symmetry breaking phenomenon. We implement consistently the Bogomol’nyi-Prasad-Sommerfield formalism providing highly nonlinear self-dual equations whose solutions are electrically neutral possessing total energy proportional to the magnetic flux. Among the infinite set of possible configurations, we have found families of k-generalized models whose self-dual equations have a form mathematically similar to the ones arising in the Maxwell-Higgs or Chern-Simons-Higgs models. Furthermore, we have verified that our proposal also supports infinite twinlike models with |ϕ|{sup 4}-potential or |ϕ|{sup 6}-potential. With the aim to show explicitly that the BPS equations are able to provide well-behaved configurations, we have considered a test model in order to study axially symmetric vortices. By depending of the self-dual potential, we have shown that the k-generalized model is able to produce solutions that for long distances have a exponential decay (as Abrikosov-Nielsen-Olesen vortices) or have a power-law decay (characterizing delocalized vortices). In all cases, we observe that the generalization modifies the vortex core size, the magnetic field amplitude and the bosonic masses but the total energy remains proportional to the quantized magnetic flux.
Dual states estimation of a subsurface flow-transport coupled model using ensemble Kalman filtering
El Gharamti, Mohamad
2013-10-01
Modeling the spread of subsurface contaminants requires coupling a groundwater flow model with a contaminant transport model. Such coupling may provide accurate estimates of future subsurface hydrologic states if essential flow and contaminant data are assimilated in the model. Assuming perfect flow, an ensemble Kalman filter (EnKF) can be used for direct data assimilation into the transport model. This is, however, a crude assumption as flow models can be subject to many sources of uncertainty. If the flow is not accurately simulated, contaminant predictions will likely be inaccurate even after successive Kalman updates of the contaminant model with the data. The problem is better handled when both flow and contaminant states are concurrently estimated using the traditional joint state augmentation approach. In this paper, we introduce a dual estimation strategy for data assimilation into a one-way coupled system by treating the flow and the contaminant models separately while intertwining a pair of distinct EnKFs, one for each model. The presented strategy only deals with the estimation of state variables but it can also be used for state and parameter estimation problems. This EnKF-based dual state-state estimation procedure presents a number of novel features: (i) it allows for simultaneous estimation of both flow and contaminant states in parallel; (ii) it provides a time consistent sequential updating scheme between the two models (first flow, then transport); (iii) it simplifies the implementation of the filtering system; and (iv) it yields more stable and accurate solutions than does the standard joint approach. We conducted synthetic numerical experiments based on various time stepping and observation strategies to evaluate the dual EnKF approach and compare its performance with the joint state augmentation approach. Experimental results show that on average, the dual strategy could reduce the estimation error of the coupled states by 15% compared with the
Dual lattice representations for O(N and CP(N−1 models with a chemical potential
Directory of Open Access Journals (Sweden)
Falk Bruckmann
2015-10-01
Full Text Available We derive dual representations for O(N and CP(N−1 models on the lattice. In terms of the dual variables the partition sums have only real and positive contributions also at finite chemical potential. Thus the complex action problem of the conventional formulation is overcome and using the dual variables Monte Carlo simulations are possible at arbitrary chemical potential.
Nonlinear analysis for dual-frequency concurrent energy harvesting
Yan, Zhimiao; Lei, Hong; Tan, Ting; Sun, Weipeng; Huang, Wenhu
2018-05-01
The dual-frequency responses of the hybrid energy harvester undergoing the base excitation and galloping were analyzed numerically. In this work, an approximate dual-frequency analytical method is proposed for the nonlinear analysis of such a system. To obtain the approximate analytical solutions of the full coupled distributed-parameter model, the forcing interactions is first neglected. Then, the electromechanical decoupled governing equation is developed using the equivalent structure method. The hybrid mechanical response is finally separated to be the self-excited and forced responses for deriving the analytical solutions, which are confirmed by the numerical simulations of the full coupled model. The forced response has great impacts on the self-excited response. The boundary of Hopf bifurcation is analytically determined by the onset wind speed to galloping, which is linearly increased by the electrical damping. Quenching phenomenon appears when the increasing base excitation suppresses the galloping. The theoretical quenching boundary depends on the forced mode velocity. The quenching region increases with the base acceleration and electrical damping, but decreases with the wind speed. Superior to the base-excitation-alone case, the existence of the aerodynamic force protects the hybrid energy harvester at resonance from damages caused by the excessive large displacement. From the view of the harvested power, the hybrid system surpasses the base-excitation-alone system or the galloping-alone system. This study advances our knowledge on intrinsic nonlinear dynamics of the dual-frequency energy harvesting system by taking advantage of the analytical solutions.
Forward-backward correlations in pp interactions in a dual model
International Nuclear Information System (INIS)
Fialkowsky, K.; Kotanski, A.; Uniwersytet Jagiellonski, Krakow
1982-01-01
Forward-backward correlations in lepton and hadron induced processes are compared according to the dual model. It is indicated that the effect of the chain energy spread in hadron processes is important. After including this effect the model is shown to explain the forward-backward correlations in pp data assuming no dynamical correlations within a single chain. (orig.)
Slow Steps towards Dual Earner/Dual Carer Family Model: Why Do Fathers Not Take Parental Leave
Directory of Open Access Journals (Sweden)
Marre Karu
2011-06-01
Full Text Available The article looks at the transition of Estonian society towards dual earner/dual carer family model and focuses on fathers’ decision regarding taking their parental leave. Based on theory of planned behaviour by Ajzen, data from 20 qualitative interviews with fathers of small children are analysed to explore the beliefs fathers have when it comes to parental leave. The analysis distinguishes between two images of ‘good parenting’ that play a role in the fathers’ intention to take parental leave. First, there is an image of an outcome-oriented ‘project manager’ affected by failure anxiety, and second, there is a much more relaxed image of a ‘good parent’ as a ‘companion’ who values everyday contact and a close relationship with the child(ren.
Energy Technology Data Exchange (ETDEWEB)
Di Leo, Giovanni; Fina, Laura [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Bandirali, Michele; Messina, Carmelo [Universita degli Studi di Milano, Scuola di Specializzazione in Radiodiagnostica, Milan (Italy); Sardanelli, Francesco [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Universita degli Studi di Milano, Dipartimento di Scienze Biomediche per la Salute, San Donato Milanese (Italy)
2014-08-15
Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.
International Nuclear Information System (INIS)
Di Leo, Giovanni; Fina, Laura; Bandirali, Michele; Messina, Carmelo; Sardanelli, Francesco
2014-01-01
Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.
Directory of Open Access Journals (Sweden)
E. Majchrzak
2008-12-01
Full Text Available The dual reciprocity boundary element method is applied for numerical modelling of solidification process. This variant of the BEM is connected with the transformation of the domain integral to the boundary integrals. In the paper the details of the dual reciprocity boundary element method are presented and the usefulness of this approach to solidification process modelling is demonstrated. In the final part of the paper the examples of computations are shown.
Probabilistic Modeling of Seismic Risk Based Design for a Dual System Structure
Sidi, Indra Djati
2017-01-01
The dual system structure concept has gained popularity in the construction of high-rise buildings over the last decades. Meanwhile, earthquake engineering design provisions for buildings have moved from the uniform hazard concept to the uniform risk concept upon recognizing the uncertainties involved in the earthquake resistance of concrete structures. In this study, a probabilistic model for the evaluation of such risk is proposed for a dual system structure consisting of shear walls or cor...
Nanda, Tarun; Kumar, B. Ravi; Singh, Vishal
2017-11-01
Micromechanical modeling is used to predict material's tensile flow curve behavior based on microstructural characteristics. This research develops a simplified micromechanical modeling approach for predicting flow curve behavior of dual-phase steels. The existing literature reports on two broad approaches for determining tensile flow curve of these steels. The modeling approach developed in this work attempts to overcome specific limitations of the existing two approaches. This approach combines dislocation-based strain-hardening method with rule of mixtures. In the first step of modeling, `dislocation-based strain-hardening method' was employed to predict tensile behavior of individual phases of ferrite and martensite. In the second step, the individual flow curves were combined using `rule of mixtures,' to obtain the composite dual-phase flow behavior. To check accuracy of proposed model, four distinct dual-phase microstructures comprising of different ferrite grain size, martensite fraction, and carbon content in martensite were processed by annealing experiments. The true stress-strain curves for various microstructures were predicted with the newly developed micromechanical model. The results of micromechanical model matched closely with those of actual tensile tests. Thus, this micromechanical modeling approach can be used to predict and optimize the tensile flow behavior of dual-phase steels.
A Dual Coding Theoretical Model of Decoding in Reading: Subsuming the LaBerge and Samuels Model
Sadoski, Mark; McTigue, Erin M.; Paivio, Allan
2012-01-01
In this article we present a detailed Dual Coding Theory (DCT) model of decoding. The DCT model reinterprets and subsumes The LaBerge and Samuels (1974) model of the reading process which has served well to account for decoding behaviors and the processes that underlie them. However, the LaBerge and Samuels model has had little to say about…
Directory of Open Access Journals (Sweden)
T N Hagawane
2016-01-01
Results: It was noted that the respiratory rate, and tumour necrosis factor-α (TNF-α levels were significantly higher at 4 h in the dual hit group as compared to LPS, OA and control groups. Interleukin-6 (IL-6 levels were significantly higher in the dual hit group as compared to LPS at 8 and 24 h, OA at 8 h and control (at all time intervals group. IL-1β levels were significantly higher in LPS and dual hit groups at all time intervals, but not in OA and control groups. The injury induced in dual hit group was earlier and more sustained as compared to LPS and OA alone. Interpretation & conclusions: The lung pathology and changes in respiration functions produced by the dual hit model were closer to the diagnostic criteria of ALI/ARDS in terms of clinical manifestations and pulmonary injury and the injury persisted longer as compared to LPS and OA single hit model. Therefore, the ARDS model produced by the dual hit method was closer to the diagnostic criteria of ARDS in terms of clinical manifestations and pulmonary injury.
Dual structure in the charge excitation spectrum of electron-doped cuprates
Bejas, Matías; Yamase, Hiroyuki; Greco, Andrés
2017-12-01
Motivated by the recent resonant x-ray scattering (RXS) and resonant inelastic x-ray scattering (RIXS) experiments for electron-doped cuprates, we study the charge excitation spectrum in a layered t -J model with the long-range Coulomb interaction. We show that the spectrum is not dominated by a specific type of charge excitations, but by different kinds of charge fluctuations, and is characterized by a dual structure in the energy space. Low-energy charge excitations correspond to various types of bond-charge fluctuations driven by the exchange term (J term), whereas high-energy charge excitations are due to usual on-site charge fluctuations and correspond to plasmon excitations above the particle-hole continuum. The interlayer coupling, which is frequently neglected in many theoretical studies, is particularly important to the high-energy charge excitations.
Directory of Open Access Journals (Sweden)
Yaqeen S Mezaal
Full Text Available A compact dual-mode microstrip bandpass filter using geometrical slot is presented in this paper. The adopted geometrical slot is based on first iteration of Cantor square fractal curve. This filter has the benefits of possessing narrower and sharper frequency responses as compared to microstrip filters that use single mode resonators and traditional dual-mode square patch resonators. The filter has been modeled and demonstrated by Microwave Office EM simulator designed at a resonant frequency of 2 GHz using a substrate of εr = 10.8 and thickness of h = 1.27 mm. The output simulated results of the proposed filter exhibit 22 dB return loss, 0.1678 dB insertion loss and 12 MHz bandwidth in the passband region. In addition to the narrow band gained, miniaturization properties as well as weakened spurious frequency responses and blocked second harmonic frequency in out of band regions have been acquired. Filter parameters including insertion loss, return loss, bandwidth, coupling coefficient and external quality factor have been compared with different values of perturbation dimension (d. Also, a full comparative study of this filter as compared with traditional square patch filter has been considered.
Design and experimental verification of a dual-band metamaterial filter
Zhu, Hong-Yang; Yao, Ai-Qin; Zhong, Min
2016-10-01
In this paper, we present the design, simulation, and experimental verification of a dual-band free-standing metamaterial filter operating in a frequency range of 1 THz-30 THz. The proposed structure consists of periodically arranged composite air holes, and exhibits two broad and flat transmission bands. To clarify the effects of the structural parameters on both resonant transmission bands, three sets of experiments are performed. The first resonant transmission band shows a shift towards higher frequency when the side width w 1 of the main air hole is increased. In contrast, the second resonant transmission band displays a shift towards lower frequency when the side width w 2 of the sub-holes is increased, while the first resonant transmission band is unchanged. The measured results indicate that these resonant bands can be modulated individually by simply optimizing the relevant structural parameters (w 1 or w 2) for the required band. In addition, these resonant bands merge into a single resonant band with a bandwidth of 7.7 THz when w 1 and w 2 are optimized simultaneously. The structure proposed in this paper adopts different resonant mechanisms for transmission at different frequencies and thus offers a method to achieve a dual-band and low-loss filter. Project supported by the Doctorate Scientific Research Foundation of Hezhou University, China (Grant No. HZUBS201503), the Promotion of the Basic Ability of Young and Middle-aged Teachers in Universities Project of Guangxi Zhuang Autonomous Region, China (Grant No. KY2016YB453), the Guangxi Colleges and Universities Key Laboratory Symbolic Computation, China, Engineering Data Processing and Mathematical Support Autonomous Discipline Project of Hezhou University, China (Grant No. 2016HZXYSX01).
Logical Reasoning versus Information Processing in the Dual-Strategy Model of Reasoning
Markovits, Henry; Brisson, Janie; de Chantal, Pier-Luc
2017-01-01
One of the major debates concerning the nature of inferential reasoning is between counterexample-based strategies such as mental model theory and statistical strategies underlying probabilistic models. The dual-strategy model, proposed by Verschueren, Schaeken, & d'Ydewalle (2005a, 2005b), which suggests that people might have access to both…
Jogiya, Roy; Schuster, Andreas; Zaman, Arshad; Motwani, Manish; Kouwenhoven, Marc; Nagel, Eike; Kozerke, Sebastian; Plein, Sven
2014-11-28
The purpose of this study was to establish the feasibility of three-dimensional (3D) balanced steady-state-free-precession (bSSFP) myocardial perfusion cardiovascular magnetic resonance (CMR) at 3T using local RF shimming with dual-source RF transmission, and to compare it with spoiled gradient echo (TGRE) acquisition. Dynamic contrast-enhanced 3D bSSFP perfusion imaging was performed on a 3T MRI scanner equipped with dual-source RF transmission technology. Images were reconstructed using k-space and time broad-use linear acquisition speed-up technique (k-t BLAST) and compartment based principle component analysis (k-t PCA). In phantoms and volunteers, local RF shimming with dual source RF transmission significantly improved B1 field homogeneity compared with single source transmission (P=0.01). 3D bSSFP showed improved signal-to-noise, contrast-to-noise and signal homogeneity compared with 3D TGRE (29.8 vs 26.9, P=0.045; 23.2 vs 21.6, P=0.049; 14.9% vs 12.4%, p=0.002, respectively). Image quality was similar between bSSFP and TGRE but there were more dark rim artefacts with bSSFP. k-t PCA reconstruction reduced artefacts for both sequences compared with k-t BLAST. In a subset of five patients, both methods correctly identified those with coronary artery disease. Three-dimensional bSSFP myocardial perfusion CMR using local RF shimming with dual source parallel RF transmission at 3T is feasible and improves signal characteristics compared with TGRE. Image artefact remains an important limitation of bSSFP imaging at 3T but can be reduced with k-t PCA.
Charm production in the dual topological unitarization model
International Nuclear Information System (INIS)
Batunin, A.V.
1986-01-01
The open and hidden charm hadroproduction has been traced up to the SPS energies in the framework of the dual parton model. The free parameter (the suppression of the charmed sea) comes from the experiments on D-meson hadroproduction. Then the hidden-charm production data are described assuming that the J/ψ-meson production suggests only one cc-bar pair in the string, while the pair ψψ production suggests two cc-bar pairs
A photo-excited broadband to dual-band tunable terahertz prefect metamaterial polarization converter
Zhu, Jianfeng; Yang, Yang; Li, Shufang
2018-04-01
A new and simple design of photo-excited broadband to dual-band tunable terahertz (THz) metamaterial cross polarization converter is proposed in this paper. The tunable converter is a sandwich structure with the center-cut cross-shaped metallic patterned structure as a resonator, the middle dielectric layer as a spacer and the bottom metallic film as the ground. The conductivity of the photoconductive semiconductor (Silicon) filled in the gap of the cross-shaped metallic resonator can be tuned by the incident pump power, leading to an easy modulation of the electromagnetic response of the proposed converter. The results show that the proposed cross-polarization converter can be tuned from a broadband with polarization conversion ratio (PCR) beyond 95% (1.86-2.94 THz) to dual frequency bands (fl = 1 . 46 THz &fh = 2 . 9 THz). The conversion peaks can reach 99.9% for the broadband and, 99.5% (fl) and 99.7% (fh) for the dual-band, respectively. Most importantly, numerical simulations demonstrate that the broadband/dual-band polarization conversion mechanism of the converter originates from the localized surface plasmon modes, which make the design simple and different from previous designs. With these good features, the proposed broadband to dual-band tunable polarization converter is expected to be used in widespread applications.
Energy Technology Data Exchange (ETDEWEB)
Chhipa, Mayur Kumar, E-mail: mayurchhipa1@gmail.com [Deptt. of Electronics and Communication Engineering, Government Engineering College Ajmer Rajasthan INDIA (India); Dusad, Lalit Kumar [Rajasthan Technical University Kota, Rajasthan (India)
2016-05-06
In this paper channel drop filter (CDF) is designed using dual curved photonic crystal ring resonator (PCRR). The photonic band gap (PBG) is calculated by plane wave expansion (PWE) method and the photonic crystal (PhC) based on two dimensional (2D) square lattice periodic arrays of silicon (Si) rods in air structure have been investigated using finite difference time domain (FDTD) method. The number of rods in Z and X directions is 21 and 20 respectively with lattice constant 0.540 nm and rod radius r = 0.1 µm. The channel drop filter has been optimized for telecommunication wavelengths λ = 1.591 µm with refractive indices 3.533. In the designed structure further analysis is also done by changing whole rods refractive index and it has been observed that this filter may be used for filtering several other channels also. The designed structure is useful for CWDM systems. This device may serve as a key component in photonic integrated circuits. The device is ultra compact with the overall size around 123 µm{sup 2}.
Validation of an Acoustic Impedance Prediction Model for Skewed Resonators
Howerton, Brian M.; Parrott, Tony L.
2009-01-01
An impedance prediction model was validated experimentally to determine the composite impedance of a series of high-aspect ratio slot resonators incorporating channel skew and sharp bends. Such structures are useful for packaging acoustic liners into constrained spaces for turbofan noise control applications. A formulation of the Zwikker-Kosten Transmission Line (ZKTL) model, incorporating the Richards correction for rectangular channels, is used to calculate the composite normalized impedance of a series of six multi-slot resonator arrays with constant channel length. Experimentally, acoustic data was acquired in the NASA Langley Normal Incidence Tube over the frequency range of 500 to 3500 Hz at 120 and 140 dB OASPL. Normalized impedance was reduced using the Two-Microphone Method for the various combinations of channel skew and sharp 90o and 180o bends. Results show that the presence of skew and/or sharp bends does not significantly alter the impedance of a slot resonator as compared to a straight resonator of the same total channel length. ZKTL predicts the impedance of such resonators very well over the frequency range of interest. The model can be used to design arrays of slot resonators that can be packaged into complex geometries heretofore unsuitable for effective acoustic treatment.
Multiparticle production in a two-component dual parton model
International Nuclear Information System (INIS)
Aurenche, P.; Bopp, F.W.; Capella, A.; Kwiecinski, J.; Maire, M.; Ranft, J.; Tran Thanh Van, J.
1992-01-01
The dual parton model (DPM) describes soft and semihard multiparticle production. The version of the DPM presented in this paper includes soft and hard mechanisms as well as diffractive processes. The model is formulated as a Monte Carlo event generator. We calculate in this model, in the energy range of the hadron colliders, rapidity distributions and the rise of the rapidity plateau with the collision energy, transverse-momentum distributions and the rise of average transverse momenta with the collision energy, multiplicity distributions in different pseudorapidity regions, and transverse-energy distributions. For most of these quantities we find a reasonable agreement with experimental data
A Dual-Process Model of the Alcohol-Behavior Link for Social Drinking
Moss, Antony C.; Albery, Ian P.
2009-01-01
A dual-process model of the alcohol-behavior link is presented, synthesizing 2 of the major social-cognitive approaches: expectancy and myopia theories. Substantial evidence has accrued to support both of these models, and recent neurocognitive models of the effects of alcohol on thought and behavior have provided evidence to support both as well.…
Flavor universal resonances and warped gravity
Energy Technology Data Exchange (ETDEWEB)
Agashe, Kaustubh; Du, Peizhi; Hong, Sungwoo; Sundrum, Raman [Maryland Center for Fundamental Physics, Department of Physics,University of Maryland, College Park, MD 20742 (United States)
2017-01-04
Warped higher-dimensional compactifications with “bulk” standard model, or their AdS/CFT dual as the purely 4D scenario of Higgs compositeness and partial compositeness, offer an elegant approach to resolving the electroweak hierarchy problem as well as the origins of flavor structure. However, low-energy electroweak/flavor/CP constraints and the absence of non-standard physics at LHC Run 1 suggest that a “little hierarchy problem” remains, and that the new physics underlying naturalness may lie out of LHC reach. Assuming this to be the case, we show that there is a simple and natural extension of the minimal warped model in the Randall-Sundrum framework, in which matter, gauge and gravitational fields propagate modestly different degrees into the IR of the warped dimension, resulting in rich and striking consequences for the LHC (and beyond). The LHC-accessible part of the new physics is AdS/CFT dual to the mechanism of “vectorlike confinement”, with TeV-scale Kaluza-Klein excitations of the gauge and gravitational fields dual to spin-0,1,2 composites. Unlike the minimal warped model, these low-lying excitations have predominantly flavor-blind and flavor/CP-safe interactions with the standard model. Remarkably, this scenario also predicts small deviations from flavor-blindness originating from virtual effects of Higgs/top compositeness at ∼O(10) TeV, with subdominant resonance decays into Higgs/top-rich final states, giving the LHC an early “preview” of the nature of the resolution of the hierarchy problem. Discoveries of this type at LHC Run 2 would thereby anticipate (and set a target for) even more explicit explorations of Higgs compositeness at a 100 TeV collider, or for next-generation flavor tests.
Hybrid model for the decay of nuclear giant resonances
International Nuclear Information System (INIS)
Hussein, M.S.
1986-12-01
The decay properties of nuclear giant multipole resonances are discussed within a hybrid model that incorporates, in a unitary consistent way, both the coherent and statistical features. It is suggested that the 'direct' decay of the GR is described with continuum first RPA and the statistical decay calculated with a modified Hauser-Feshbach model. Application is made to the decay of the giant monopole resonance in 208 Pb. Suggestions are made concerning the calculation of the mixing parameter using the statistical properties of the shell model eigenstates at high excitation energies. (Author) [pt
Fast response double series resonant high-voltage DC-DC converter
International Nuclear Information System (INIS)
Lee, S S; Iqbal, S; Kamarol, M
2012-01-01
In this paper, a novel double series resonant high-voltage dc-dc converter with dual-mode pulse frequency modulation (PFM) control scheme is proposed. The proposed topology consists of two series resonant tanks and hence two resonant currents flow in each switching period. Moreover, it consists of two high-voltage transformer with the leakage inductances are absorbed as resonant inductor in the series resonant tanks. The secondary output of both transformers are rectified and mixed before supplying to load. In the resonant mode operation, the series resonant tanks are energized alternately by controlling two Insulated Gate Bipolar Transistor (IGBT) switches with pulse frequency modulation (PFM). This topology operates in discontinuous conduction mode (DCM) with all IGBT switches operating in zero current switching (ZCS) condition and hence no switching loss occurs. To achieve fast rise in output voltage, a dual-mode PFM control during start-up of the converter is proposed. In this operation, the inverter is started at a high switching frequency and as the output voltage reaches 90% of the target value, the switching frequency is reduced to a value which corresponds to the target output voltage. This can effectively reduce the rise time of the output voltage and prevent overshoot. Experimental results collected from a 100-W laboratory prototype are presented to verify the effectiveness of the proposed system.
One dimensional modeling of a diesel-CNG dual fuel engine
Azman, Putera Adam; Fawzi, Mas; Ismail, Muammar Mukhsin; Osman, Shahrul Azmir
2017-04-01
Some of the previous studies have shown that the use of compressed natural gas (CNG) in diesel engines potentially produce engine performance improvement and exhaust gas emission reduction, especially nitrogen oxides, unburned hydrocarbons, and carbon dioxide. On the other hand, there are other researchers who claimed that the use of CNG increases exhaust gas emissions, particularly nitrogen oxides. In this study, a one-dimensional model of a diesel-CNG dual fuel engine was made based on a 4-cylinder 2.5L common rail direct injection diesel engine. The software used is GT-Power, and it was used to analyze the engine performance and exhaust gas emissions of several diesel-CNG dual fuel blend ratios, i.e. 100:0, 90:10, 80:20, 70:30, 60:40 and 50:50. The effect of 100%, 75%, 50% engine loads on the exhaust gas emissions were also studied. The result shows that all diesel-CNG fuel blends produces higher brake torque and brake power at engine speed of 2000-3000 rpm compared with 100% diesel. The 50:50 diesel-CNG blend produces the highest brake torque and brake power, but also has the highest brake specific fuel consumption. As a higher percentage of CNG added to the dual fuel blend, unburned hydrocarbons and carbon monoxide emission increased while carbon dioxide emission decreased. The nitrogen oxides emission concentration is generally unaffected by any change of the dual fuel ratio.
Alqadami, Abdulrahman Shueai Mohsen; Jamlos, Mohd Faizal; Soh, Ping Jack; Rahim, Sharul Kamal Abdul; Vandenbosch, Guy A. E.; Narbudowicz, Adam
2017-01-01
A miniaturized dual-band antenna array using a negative index metamaterial is presented for WiMAX, LTE, and WLAN applications. This left-handed metamaterial plane is located behind the antenna array, and its unit cell is a combination of split-ring resonator, square electric ring resonator, and rectangular electrical coupled resonator. This enables the achievement of a metamaterial structure exhibiting both negative permittivity and permeability, which results in antenna size miniaturization, efficiency, and gain enhancement. Moreover, the proposed metamaterial antenna has realized dual-band operating frequencies compared to a single frequency for normal antenna. The measured reflection coefficient (S11) shows a 50.25% bandwidth in the lower band (from 2.119 to 3.058 GHz) and 4.27% in the upper band (from 5.058 to 5.276 GHz). Radiation efficiency obtained in the lower and upper band are >95 and 80%, respectively.
Miao, Luyang; Zhu, Chengzhou; Jiao, Lei; Li, He; Du, Dan; Lin, Yuehe; Wei, Qin
2018-02-06
Numerous analytical techniques have been undertaken for the detection of protein biomarkers because of their extensive and significant applications in clinical diagnosis, whereas there are few strategies to develop dual-readout immunosensors to achieve more accurate results. To the best of our knowledge, inspired by smart drug delivery system (DDS), a novel pH-responsive modified enzyme-linked immunosorbent assay (ELISA) was innovatively developed for the first time, realizing dual-modal colorimetric and fluorescent detection of cardiac troponin I (cTnI). Curcumin (CUR) was elaborately selected as a reporter molecule, which played the same role of drugs in DDS based on the following considerations: (1) CUR can be used as a kind of pH indicator by the inherited allochroic effect induced by basic pH value; (2) the fluorescence of CUR can be quenched by certain nanocarriers as the acceptor because of the occurrence of fluorescence resonance energy transfer (FRET), while recovered by the stimuli of basic pH value, which can produce "signal-on" fluorescence detection. Three-dimensional MoS 2 nanoflowers (3D-MoS 2 NFs) were employed in immobilizing CUR to constitute a nanoprobe for the determination of cTnI by virtue of good biocompatibility, high absorption capacity, and fluorescence quench efficiency toward CUR. The proposed DDS-inspired ELISA offered dual-modal colorimetric and fluorescent detection of cTnI, thereby meeting the reliable and precise analysis requirements. We believe that the developed dual-readout ELISA will create a new avenue and bring innovative inspirations for biological detections.
Compact Microstrip Triple-Mode Bandpass Filters Using Dual-Stub-Loaded Spiral Resonators
Directory of Open Access Journals (Sweden)
K. D. Xu
2017-04-01
Full Text Available Two new microstrip triple-mode resonators loaded with T-shaped open stubs using axially and centrally symmetric spiral structures, respectively, are presented. Spiraled for circuit size reduction, these two half-wavelength resonators can both generate three resonant modes over a wide frequency band by loading two T-stubs with different lengths. Due to the structural symmetry, they can be analyzed by odd- and even-mode method. To validate the design concept, two compact bandpass filters (BPFs using these two novel resonators with center frequencies of 1.76 GHz and 2.44 GHz for the GSM1800 and WLAN/Zigbee applications, respectively, have been designed, fabricated and tested. The center frequencies and bandwidths can be tunable through the analysis of resonant frequency responses, fractional bandwidths and external quality factor versus the resonator parameters. The final measured results have achieved good consistence with the simulations of these two BPFs.
Ferrero, Andrea; Chen, Baiyu; Li, Zhoubo; Yu, Lifeng; McCollough, Cynthia
2017-05-01
To compare algorithms performing material decomposition and classification in dual-energy CT, it is desirable to know the ground truth of the lesion to be analyzed in real patient data. In this work, we developed and validated a framework to insert digital lesions of arbitrary chemical composition into patient projection data acquired on a dual-source, dual-energy CT system. A model that takes into account beam-hardening effects was developed to predict the CT number of objects with known chemical composition. The model utilizes information about the x-ray energy spectra, the patient/phantom attenuation, and the x-ray detector energy response. The beam-hardening model was validated on samples of iodine (I) and calcium (Ca) for a second-generation dual-source, dual-energy CT scanner for all tube potentials available and a wide range of patient sizes. The seven most prevalent mineral components of renal stones were modeled and digital stones were created with CT numbers computed for each patient/phantom size and x-ray energy spectra using the developed beam-hardening model. Each digital stone was inserted in the dual-energy projection data of a water phantom scanned on a dual-source scanner and reconstructed with the routine algorithms in use in our practice. The geometry of the forward projection for dual-energy data was validated by comparing CT number accuracy and high-contrast resolution of simulated dual-energy CT data of the ACR phantom with experimentally acquired data. The beam-hardening model and forward projection method accurately predicted the CT number of I and Ca over a wide range of tube potentials and phantom sizes. The images reconstructed after the insertion of digital kidney stones were consistent with the images reconstructed from the scanner, and the CT number ratios for different kidney stone types were consistent with data in the literature. A sample application of the proposed tool was also demonstrated. A framework was developed and validated
Stochastic resonance in models of neuronal ensembles
International Nuclear Information System (INIS)
Chialvo, D.R.; Longtin, A.; Mueller-Gerkin, J.
1997-01-01
Two recently suggested mechanisms for the neuronal encoding of sensory information involving the effect of stochastic resonance with aperiodic time-varying inputs are considered. It is shown, using theoretical arguments and numerical simulations, that the nonmonotonic behavior with increasing noise of the correlation measures used for the so-called aperiodic stochastic resonance (ASR) scenario does not rely on the cooperative effect typical of stochastic resonance in bistable and excitable systems. Rather, ASR with slowly varying signals is more properly interpreted as linearization by noise. Consequently, the broadening of the open-quotes resonance curveclose quotes in the multineuron stochastic resonance without tuning scenario can also be explained by this linearization. Computation of the input-output correlation as a function of both signal frequency and noise for the model system further reveals conditions where noise-induced firing with aperiodic inputs will benefit from stochastic resonance rather than linearization by noise. Thus, our study clarifies the tuning requirements for the optimal transduction of subthreshold aperiodic signals. It also shows that a single deterministic neuron can perform as well as a network when biased into a suprathreshold regime. Finally, we show that the inclusion of a refractory period in the spike-detection scheme produces a better correlation between instantaneous firing rate and input signal. copyright 1997 The American Physical Society
Shahamat, Yadollah; Vahedi, Mohammad
2017-06-01
An ultracompact double eight-shaped plasmonic structure for the realization of plasmon-induced transparency (PIT) in the terahertz (THz) region has been studied. The device consists of a semiconductor-insulator-semiconductor bus waveguide coupled to the dual-disk resonators. Indium antimonide is employed to excite SPP in the THz region. The transmission characteristics of the proposed device are simulated numerically by the finite-difference time-domain method. In addition, a theoretical analysis based on the coupled-mode theory for transmission features is presented and compared with the numerical results. Results are in good agreement. Also, the dependence of PIT frequency characteristics on the radius of the outer disk is discussed in detail. In addition, by removing one of the outer disk resonators, double-PIT peaks can be observed in the transmission spectrum, and the physical mechanism of the appeared peaks is investigated. Finally, an application of the proposed structure for distinguishing different states of DNA molecules is discussed. Results show that the maximum sensitivity with 654 GHz/RIU-1 could be obtained for a single PIT structure. The frequency shifts equal to 37 and 99 GHz could be observed for the denatured and the hybridized DNA states, respectively.
Dual-axis resonance testing of wind turbine blades
Hughes, Scott; Musial, Walter; White, Darris
2014-01-07
An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.
Directory of Open Access Journals (Sweden)
Heliani Berlato
2017-01-01
Full Text Available Couples who live a dual career, in general, are characterized by their continuing professional engagement and their desire for personal growth together. It is a synergy between career aspirations and family sphere, so that they co-exist; reflecting nowadays, a challenge for people who seek to live this duality. Not exempt from it, it is possible to understand the need for management models of people who are in harmony with the desires of dual career couples who are part of organizations. If in the 1980s the existence of dual career couples was not so common in Brazil, nowadays organizations increasingly receive these couples, which impacts the need for people management models to keep up with these social changes. Therefore, the model recognizes that the personal dimension (impacts on the organizational context cannot be avoided, and also that other factors affect both spheres (personal and organizational when referring to the normative roles that permeate these areas. The main intention of this essay is to construct a theoretical model of dual career to consider the factor - organization, as vital to understand (and accept the need to consider other dimensions on the dual career analytical perspective. The first evidences of dual career studies in Brazil revealed that the look at this movement only from the individual's margin is limited. This way, to consider the existence of other dimensions and consequently the influences they may cause, favors an expansion of the perspective, and also brings a detailing about the external factors (organization, society and culture that influence the dual career couple. To consider that this couple, as well as having personal challenges in the relationship between work and family, is subject to the culture that regulates their roles (men and women and that directly influences how organizations will handle that topic reveals the merit of this study. This, in turn, draws attention to the organizational sphere
Giant resonance of electrical multipole from droplet model
International Nuclear Information System (INIS)
Tauhata, L.
1984-01-01
The formalism of the electrical multipole resonance developed from the Droplet nuclear model is presented. It combines the approaches of Goldhaber-Teller (GT) and Steinwedel-Jensen (SJ) and it shows the relative contribution of Coulomb, superficial and neutron excess energies. It also discusses the calculation of half-width. The model evaluates correctly the resonance energies as a function of nuclear mass and allows, through the Mixture Index, the prediction of the complementary participation of modes SJ and GT in the giant nuclear resonance. Values of the mixture index, for each multipolarity, reproduce well the form factors obtained from experiments of charged particle inelastic scattering. The formalism presented for the calculation of the half-width gives a macroscopic description of the friction mechanism. The establishment of the macroscopic structure of the Dissipation Function is used as a reference in the comparison of microscopic calculations. (Author) [pt
Systematic assignment of Feshbach resonances via an asymptotic bound state model
Goosen, M.; Kokkelmans, SJ.J.M.F.
2008-01-01
We present an Asymptotic Bound state Model (ABM), which is useful to predict Feshbach resonances. The model utilizes asymptotic properties of the interaction potentials to represent coupled molecular wavefunctions. The bound states of this system give rise to Feshbach resonances, localized at the
Modeling and simulation of a dual-junction CIGS solar cell using Silvaco ATLAS
Fotis, Konstantinos
2012-01-01
Approved for public release; distribution is unlimited. The potential of designing a dual-junction Copper Indium Gallium Selenide (CIGS) photovoltaic cell is investigated in this thesis. Research into implementing a dual-junction solar cell, using a CIGS bottom cell and different thin-film designs as a top cell, was conducted in order to increase the current record efficiency of 20.3% for a single CIGS cell. This was accomplished through modeling and simulation using Silvaco ATLASTM, an ad...
International Nuclear Information System (INIS)
Haymaker, Richard W.; Matsuki, Takayuki
2007-01-01
We address the problem of determining the type I, type II or borderline dual superconductor behavior in maximal Abelian gauge SU(2) through the study of the dual Abrikosov vortex. We find that significant electric currents in the simulation data call into question the use of the dual Ginzburg-Landau Higgs model in interpreting the data. Further, two definitions of the penetration depth parameter take two different values. The splitting of this parameter into two is intricately connected to the existence of electric currents. It is important in our approach that we employ definitions of flux and electric and magnetic currents that respect Maxwell equations exactly for lattice averages independent of lattice spacings. Applied to specific Wilson loop sizes, our conclusions differ from those that use the dual GLH model
Rapcsak, Steven Z; Henry, Maya L; Teague, Sommer L; Carnahan, Susan D; Beeson, Pélagie M
2007-06-18
Coltheart and co-workers [Castles, A., Bates, T. C., & Coltheart, M. (2006). John Marshall and the developmental dyslexias. Aphasiology, 20, 871-892; Coltheart, M., Rastle, K., Perry, C., Langdon, R., & Ziegler, J. (2001). DRC: A dual route cascaded model of visual word recognition and reading aloud. Psychological Review, 108, 204-256] have demonstrated that an equation derived from dual-route theory accurately predicts reading performance in young normal readers and in children with reading impairment due to developmental dyslexia or stroke. In this paper, we present evidence that the dual-route equation and a related multiple regression model also accurately predict both reading and spelling performance in adult neurological patients with acquired alexia and agraphia. These findings provide empirical support for dual-route theories of written language processing.
Assessment of CO2 Storage Potential in Naturally Fractured Reservoirs With Dual-Porosity Models
March, Rafael; Doster, Florian; Geiger, Sebastian
2018-03-01
Naturally Fractured Reservoirs (NFR's) have received little attention as potential CO2 storage sites. Two main facts deter from storage projects in fractured reservoirs: (1) CO2 tends to be nonwetting in target formations and capillary forces will keep CO2 in the fractures, which typically have low pore volume; and (2) the high conductivity of the fractures may lead to increased spatial spreading of the CO2 plume. Numerical simulations are a powerful tool to understand the physics behind brine-CO2 flow in NFR's. Dual-porosity models are typically used to simulate multiphase flow in fractured formations. However, existing dual-porosity models are based on crude approximations of the matrix-fracture fluid transfer processes and often fail to capture the dynamics of fluid exchange accurately. Therefore, more accurate transfer functions are needed in order to evaluate the CO2 transfer to the matrix. This work presents an assessment of CO2 storage potential in NFR's using dual-porosity models. We investigate the impact of a system of fractures on storage in a saline aquifer, by analyzing the time scales of brine drainage by CO2 in the matrix blocks and the maximum CO2 that can be stored in the rock matrix. A new model to estimate drainage time scales is developed and used in a transfer function for dual-porosity simulations. We then analyze how injection rates should be limited in order to avoid early spill of CO2 (lost control of the plume) on a conceptual anticline model. Numerical simulations on the anticline show that naturally fractured reservoirs may be used to store CO2.
Petoussi-Henss, Nina; Becker, Janine; Greiter, Matthias; Schlattl, Helmut; Zankl, Maria; Hoeschen, Christoph
2014-03-01
In radiography there is generally a conflict between the best image quality and the lowest possible patient dose. A proven method of dosimetry is the simulation of radiation transport in virtual human models (i.e. phantoms). However, while the resolution of these voxel models is adequate for most dosimetric purposes, they cannot provide the required organ fine structures necessary for the assessment of the imaging quality. The aim of this work is to develop hybrid/dual-lattice voxel models (called also phantoms) as well as simulation methods by which patient dose and image quality for typical radiographic procedures can be determined. The results will provide a basis to investigate by means of simulations the relationships between patient dose and image quality for various imaging parameters and develop methods for their optimization. A hybrid model, based on NURBS (Non Linear Uniform Rational B-Spline) and PM (Polygon Mesh) surfaces, was constructed from an existing voxel model of a female patient. The organs of the hybrid model can be then scaled and deformed in a non-uniform way i.e. organ by organ; they can be, thus, adapted to patient characteristics without losing their anatomical realism. Furthermore, the left lobe of the lung was substituted by a high resolution lung voxel model, resulting in a dual-lattice geometry model. "Dual lattice" means in this context the combination of voxel models with different resolution. Monte Carlo simulations of radiographic imaging were performed with the code EGS4nrc, modified such as to perform dual lattice transport. Results are presented for a thorax examination.
Dual process interaction model of HIV-risk behaviors among drug offenders.
Ames, Susan L; Grenard, Jerry L; Stacy, Alan W
2013-03-01
This study evaluated dual process interaction models of HIV-risk behavior among drug offenders. A dual process approach suggests that decisions to engage in appetitive behaviors result from a dynamic interplay between a relatively automatic associative system and an executive control system. One synergistic type of interplay suggests that executive functions may dampen or block effects of spontaneously activated associations. Consistent with this model, latent variable interaction analyses revealed that drug offenders scoring higher in affective decision making were relatively protected from predictive effects of spontaneous sex associations promoting risky sex. Among drug offenders with lower levels of affective decision making ability, spontaneous sexually-related associations more strongly predicted risky sex (lack of condom use and greater number of sex partners). These findings help elucidate associative and control process effects on appetitive behaviors and are important for explaining why some individuals engage in risky sex, while others are relatively protected.
Toward A Dual-Learning Systems Model of Speech Category Learning
Directory of Open Access Journals (Sweden)
Bharath eChandrasekaran
2014-07-01
Full Text Available More than two decades of work in vision posits the existence of dual-learning systems of category learning. The reflective system uses working memory to develop and test rules for classifying in an explicit fashion, while the reflexive system operates by implicitly associating perception with actions that lead to reinforcement. Dual-learning systems models hypothesize that in learning natural categories, learners initially use the reflective system and, with practice, transfer control to the reflexive system. The role of reflective and reflexive systems in auditory category learning and more specifically in speech category learning has not been systematically examined. In this article we describe a neurobiologically-constrained dual-learning systems theoretical framework that is currently being developed in speech category learning and review recent applications of this framework. Using behavioral and computational modeling approaches, we provide evidence that speech category learning is predominantly mediated by the reflexive learning system. In one application, we explore the effects of normal aging on non-speech and speech category learning. We find an age related deficit in reflective-optimal but not reflexive-optimal auditory category learning. Prominently, we find a large age-related deficit in speech learning. The computational modeling suggests that older adults are less likely to transition from simple, reflective, uni-dimensional rules to more complex, reflexive, multi-dimensional rules. In a second application we summarize a recent study examining auditory category learning in individuals with elevated depressive symptoms. We find a deficit in reflective-optimal and an enhancement in reflexive-optimal auditory category learning. Interestingly, individuals with elevated depressive symptoms also show an advantage in learning speech categories. We end with a brief summary and description of a number of future directions.
Self-dual nonsupersymmetric Type II String Compactifications
International Nuclear Information System (INIS)
Kachru, Shamit; Silverstein, Eva
1998-01-01
It has recently been proposed that certain nonsupersymmetric type II orbifolds have vanishing perturbative contributions to the cosmological constant. We show that techniques of Sen and Vafa allow one to construct dual type II descriptions of these models (some of which have no weakly coupled heterotic dual). The dual type II models are given by the same orbifolds with the string coupling S and a T 2 volume T exchanged. This allows us to argue that in various strongly coupled limits of the original type II models, there are weakly coupled duals which exhibit the same perturbative cancellations as the original models
Analytical Model of Planar Double Split Ring Resonator
DEFF Research Database (Denmark)
Zhurbenko, Vitaliy; Jensen, Thomas; Krozer, Viktor
2007-01-01
This paper focuses on accurate modelling of microstrip double split ring resonators. The impedance matrix representation for coupled lines is applied for the first time to model the SRR, resulting in excellent model accuracy over a wide frequency range. Phase compensation is implemented to take i...
Global Model for Asymmetric, Diode-Type Dual Frequency Capacitive Discharge
Kim, Jisoo; Lieberman, M. A.; Lichtenberg, A. J.
2003-10-01
Dual frequency capacitive reactors can have desirable properties for dielectric etch: low cost, robust uniformity over large areas, and control of dissociation. In the ideal case, the high frequency power controls the plasma density (ion flux) and the low frequency voltage controls the ion bombarding energy. Typical operating conditions are: discharge radius 15-30 cm, length 1-3 cm, pressure 30-200 mTorr, high frequency 27.1-160 MHz, low frequency 2-13.6 MHz, and powers of 500-3000 W for both high and low frequencies. The decoupling of the high and low frequencies is an important feature of dual frequency capacitive discharges. In this work, we describe a global (volume-averaged) model having different top and bottom plate areas that incorporates particle balance, and ohmic and stochastic heating for high and low frequencies. The model is used to obtain the decoupling of high and low frequencies and to investigate limitations to ideal decoupling. Support provided by Lam Research, NSF Grant ECS-0139956, California industries, and UC-SMART Contract SM99-10051.
Directory of Open Access Journals (Sweden)
Risheng Ding
Full Text Available The dual-source Shuttleworth-Wallace model has been widely used to estimate and partition crop evapotranspiration (λET. Canopy stomatal conductance (Gsc, an essential parameter of the model, is often calculated by scaling up leaf stomatal conductance, considering the canopy as one single leaf in a so-called "big-leaf" model. However, Gsc can be overestimated or underestimated depending on leaf area index level in the big-leaf model, due to a non-linear stomatal response to light. A dual-leaf model, scaling up Gsc from leaf to canopy, was developed in this study. The non-linear stomata-light relationship was incorporated by dividing the canopy into sunlit and shaded fractions and calculating each fraction separately according to absorbed irradiances. The model includes: (1 the absorbed irradiance, determined by separately integrating the sunlit and shaded leaves with consideration of both beam and diffuse radiation; (2 leaf area for the sunlit and shaded fractions; and (3 a leaf conductance model that accounts for the response of stomata to PAR, vapor pressure deficit and available soil water. In contrast to the significant errors of Gsc in the big-leaf model, the predicted Gsc using the dual-leaf model had a high degree of data-model agreement; the slope of the linear regression between daytime predictions and measurements was 1.01 (R2 = 0.98, with RMSE of 0.6120 mm s-1 for four clear-sky days in different growth stages. The estimates of half-hourly λET using the dual-source dual-leaf model (DSDL agreed well with measurements and the error was within 5% during two growing seasons of maize with differing hydrometeorological and management strategies. Moreover, the estimates of soil evaporation using the DSDL model closely matched actual measurements. Our results indicate that the DSDL model can produce more accurate estimation of Gsc and λET, compared to the big-leaf model, and thus is an effective alternative approach for estimating and
Realistic Gamow shell model for resonance and continuum in atomic nuclei
Xu, F. R.; Sun, Z. H.; Wu, Q.; Hu, B. S.; Dai, S. J.
2018-02-01
The Gamow shell model can describe resonance and continuum for atomic nuclei. The model is established in the complex-moment (complex-k) plane of the Berggren coordinates in which bound, resonant and continuum states are treated on equal footing self-consistently. In the present work, the realistic nuclear force, CD Bonn, has been used. We have developed the full \\hat{Q}-box folded-diagram method to derive the realistic effective interaction in the model space which is nondegenerate and contains resonance and continuum channels. The CD-Bonn potential is renormalized using the V low-k method. With choosing 16O as the inert core, we have applied the Gamow shell model to oxygen isotopes.
Cui, Zhiping; Hu, Xiaoli; Liu, Shaopu; Liu, Zhongfang
2011-12-01
A dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) method was developed to detect chondroitin sulfate (CS) with nile blue sulfate (NBS). At pH 3.0-4.0 Britton-Robinson (BR) buffer medium, CS interacted with NBS to form an ion-association complex. As a result, the new spectra of resonance Rayleigh scattering (RRS), second order scattering (SOS) and frequence doubling scattering (FDS) appeared and their intensities were enhanced greatly. Their maximum wavelengths were located at 303 nm (RRS), 362 nm (RRS), 588 nm (SOS) and 350 nm (FDS), respectively. The scattering intensities of the three methods were proportional to the concentration of CS in certain ranges. The methods had high sensitivity and the detection limits were between 1.5 and 7.1 ng mL -1. The DWO-RRS method had the highest sensitivity with the detection limit being 1.5 ng mL -1. The characteristics of the spectra and optimal reaction conditions of RRS method were investigated. The effects of coexistent substances on the determination of CS were evaluated. Owing to the high sensitivity, RRS method had been applied to the determination of CS in eye drops with satisfactory results. The recovery range was between 99.4% and 104.6% and the relative standard deviation (RSD) was between 0.4% and 0.8%. In addition, the reasons for RRS enhancement were discussed and the shape of ion-association complex was characterized by atomic force microscopy (AFM).
DUAL TIMELIKE NORMAL AND DUAL TIMELIKE SPHERICAL CURVES IN DUAL MINKOWSKI SPACE
ÖNDER, Mehmet
2009-01-01
Abstract: In this paper, we give characterizations of dual timelike normal and dual timelike spherical curves in the dual Minkowski 3-space and we show that every dual timelike normal curve is also a dual timelike spherical curve. Keywords: Normal curves, Dual Minkowski 3-Space, Dual Timelike curves. Mathematics Subject Classifications (2000): 53C50, 53C40. DUAL MINKOWSKI UZAYINDA DUAL TIMELIKE NORMAL VE DUAL TIMELIKE KÜRESEL EĞRİLER Özet: Bu çalışmada, dual Minkowski 3-...
Energy Technology Data Exchange (ETDEWEB)
Bilcan, A.; Le Corre, O.; Tazerout, M. [Ecole des Mines de Nantes, 44 (France); Ramesh, A. [Indian Institute of Technology Madras (India)
2002-07-01
Dual-fuel engines are modified diesel engines burning simultaneously two fuels inside the cylinder: a gaseous one, called the primary fuel and a liquid one, called the pilot fuel. The thermal efficiency of the dual-fuel engine and of the diesel engine are comparable; the level of emissions is lower compared to the diesel one. This article presents a new procedure for the combustion modeling in a LPG-diesel dual-fuel engine. The procedures deals with the ignition delay period and with the rate of heat release inside the cylinder. This procedure is validated using experimental data issued front a collaboration with the Indian Institute of Technology from Madras, India. The used engine is a single-cylinder one, air-cooled. The pilot fuel is direct injected inside the cylinder The engine was run at constant load and with different diesel substitutions, i.e. for different air to fuel ratios of the primary fuel-air mixture. The general error of the procedure is below 10%. (authors)
Analytical model for double split ring resonators with arbitrary ring width
DEFF Research Database (Denmark)
Zhurbenko, Vitaliy; Jensen, Thomas; Krozer, Viktor
2008-01-01
For the first time, the analytical model for a double split ring resonator with unequal width rings is developed. The proposed models for the resonators with equal and unequal widths are based on an impedance matrix representation and provide the prediction of performance in a wide frequency range...
The sympletic model for giant monopole resonances
International Nuclear Information System (INIS)
Oliveira, M.M.B.M.
1985-01-01
Following recently published articles, it's investigated how to apply the sympletic model to the study of giant monopole resonances in spherical nuclei. The results obtained agree with those already published for monopole mode energies, wave functions, radii and nuclear incompressibility of 16 O and 40 Ca nuclei. An analyse of how the spurious center-of-mass motion influence resonance energies is made. The sum rules of the monopole operator, m-bar e , o ≤ e ≤ 3, are calculated, demonstrating at first that they are conserved in the sympletic model. Then it's studied, for those sum rules, the importance of n-boson correlations in the fundamental state, which is an extension of those sum rules, of the analysis for the nuclear incompressibility, performed in above mentioned articles. (Author) [pt
On-chip dual-comb source for spectroscopy.
Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L; Lipson, Michal
2018-03-01
Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra, which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high quality-factor microcavities has hindered the development of on-chip dual combs. We report the simultaneous generation of two microresonator combs on the same chip from a single laser, drastically reducing experimental complexity. We demonstrate broadband optical spectra spanning 51 THz and low-noise operation of both combs by deterministically tuning into soliton mode-locked states using integrated microheaters, resulting in narrow (lasers or microwave oscillators. We demonstrate high signal-to-noise ratio absorption spectroscopy spanning 170 nm using the dual-comb source over a 20-μs acquisition time. Our device paves the way for compact and robust spectrometers at nanosecond time scales enabled by large beat-note spacings (>1 GHz).
Noh, Seong Jin; Tachikawa, Yasuto; Shiiba, Michiharu; Kim, Sunmin
Applications of data assimilation techniques have been widely used to improve upon the predictability of hydrologic modeling. Among various data assimilation techniques, sequential Monte Carlo (SMC) filters, known as "particle filters" provide the capability to handle non-linear and non-Gaussian state-space models. This paper proposes a dual state-parameter updating scheme (DUS) based on SMC methods to estimate both state and parameter variables of a hydrologic model. We introduce a kernel smoothing method for the robust estimation of uncertain model parameters in the DUS. The applicability of the dual updating scheme is illustrated using the implementation of the storage function model on a middle-sized Japanese catchment. We also compare performance results of DUS combined with various SMC methods, such as SIR, ASIR and RPF.
Dual-temperature acoustic levitation and sample transport apparatus
Trinh, E.; Robey, J.; Jacobi, N.; Wang, T.
1986-01-01
The properties of a dual-temperature resonant chamber to be used for acoustical levitation and positioning have been theoretically and experimentally studied. The predictions of a first-order dissipationless treatment of the generalized wave equation for an inhomogeneous medium are in close agreement with experimental results for the temperature dependence of the resonant mode spectrum and the acoustic pressure distribution, although the measured magnitude of the pressure variations does not correlate well with the calculated one. Ground-based levitation of low-density samples has been demonstrated at 800 C, where steady-state forces up to 700 dyn were generated.
Dual-wavelength erbium-doped fiber laser with asymmetric fiber Bragg grating Fabry-Perot cavity
Chen, Cong; Xu, Zhi-wei; Wang, Meng; Chen, Hai-yan
2014-11-01
A novel dual-wavelength fiber laser with asymmetric fiber Bragg grating (FBG) Fabry-Perot (FP) cavity is proposed and experimentally demonstrated. A couple of uniform FBGs are used as the cavity mirrors, and the third FBG is used as intracavity wavelength selector by changing its operation temperature. Experimental results show that by adjusting the operation temperature of the intracavity wavelength selector, a tunable dual-wavelength laser emission can be achieved. The results demonstrate the new concept of dual-wavelength lasing with asymmetric FBG FP resonator and its technical feasibility.
International Nuclear Information System (INIS)
Budak, M.G.; Karadag, M.; Yuecel, H.
2010-01-01
The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r
Semi classical model of the neutron resonance compound nucleus
International Nuclear Information System (INIS)
Ohkubo, Makio
1995-01-01
A Semi-classical model of compound nucleus is developed, where time evolution and recurrence for many degrees of freedom (oscillators) excited simultaneously are explicitly considered. The effective number of oscillators plays the role in the compound nucleus, and the nuclear temperatures are derived, which are in good agreement with the traditional values. Time structures of the compound nucleus at resonance are considered, from which equidistant level series with an envelope of strength function of giant resonance nature is obtained. S-matrix formulation for fine structure resonance is derived. (author)
A three-dimensional model for calculating the micro disk laser resonant-modes
International Nuclear Information System (INIS)
Sabetjoo, H.; Bahrampor, A.; Farrahi-Moghaddam, R.
2006-01-01
In this article, a semi-analytical model for theoretical analysis of micro disk lasers is presented. Using this model, the necessary conditions for the existence of loss less and low-loss modes of micro-resonators are obtained. The resonance frequency of the resonant modes and also the attenuation of low-loss modes are calculated. By comparing the results with results of finite difference method, their validity is certified.
Hagawane, T N; Gaikwad, R V; Kshirsagar, N A
2016-05-01
Despite advances in therapy and overall medical care, acute lung injury (ALI)/acute respiratory distress syndrome (ARDS) management remains a problem. Hence the objective of this study was to develop a rat model that mimics human ALI/ARDS. Four groups of Wistar rats, 48 per group were treated with (i) intratracheal (IT) lipopolysaccharide (LPS) (5 mg/kg) dissolved in normal saline (NS), (ii) intravenous (iv) oleic acid (OA) (250 μl/kg) suspension in bovine serum albumin (BSA), (iii) dual hit: IT LPS (2 mg/kg) dissolved in NS and iv OA (100 μl/kg) and (iv) control group: IT NS and iv BSA. From each group at set periods of time various investigations like chest x-rays, respiratory rate (RR), tidal volume (TV), total cell count, differential cell count, total protein count and cytokine levels in bronchoalveolar lavage fluid (BALF), lung wet/dry weight ratio and histopathological examination were done. It was noted that the respiratory rate, and tumour necrosis factor-α (TNF-α) levels were significantly higher at 4 h in the dual hit group as compared to LPS, OA and control groups. Interleukin-6 (IL-6) levels were significantly higher in the dual hit group as compared to LPS at 8 and 24 h, OA at 8 h and control (at all time intervals) group. IL-1β levels were significantly higher in LPS and dual hit groups at all time intervals, but not in OA and control groups. The injury induced in dual hit group was earlier and more sustained as compared to LPS and OA alone. The lung pathology and changes in respiration functions produced by the dual hit model were closer to the diagnostic criteria of ALI/ARDS in terms of clinical manifestations and pulmonary injury and the injury persisted longer as compared to LPS and OA single hit model. Therefore, the ARDS model produced by the dual hit method was closer to the diagnostic criteria of ARDS in terms of clinical manifestations and pulmonary injury.
Interference of Spin-2 Self-Dual Modes
Ilha, Anderson; Wotzasek, Clovis
2001-01-01
We study the effects of interference between the self-dual and anti self-dual massive modes of the linearized Einstein-Chern-Simons topological gravity. The dual models to be used in the interference process are carefully analyzed with special emphasis on their propagating spectrum. We identify the opposite dual aspects, necessary for the application of the interference formalism on this model. The soldered theory so obtained displays explicitly massive modes of the Proca type. It may also be...
Rectifier Current Control for an LLC Resonant Converter Based on a Simplified Linearized Model
Zhijian Fang; Junhua Wang; Shanxu Duan; Liangle Xiao; Guozheng Hu; Qisheng Liu
2018-01-01
In this paper, a rectifier current control for an LLC resonant converter is proposed, based on a simplified, two-order, linearized model that adds a rectifier current feedback inner loop to improve dynamic performance. Compared to the traditional large-signal model with seven resonant states, this paper utilizes a rectifier current state to represent the characteristics of the resonant states, simplifying the LLC resonant model from seven orders to two orders. Then, the rectifier current feed...
Common window resonance features in K and heavier alkaline atoms Rb and Cs
International Nuclear Information System (INIS)
Koide, Michi; Koike, Fumihiro; Nagata, Tetsuo
2002-01-01
A previous study of subvalence s-shell photoionization of potassium [Koide et al.: J. Phys. Soc. Jpn. 71 (2002) 1676] has been extended to the cases of heavier alkaline atoms Rb and Cs. We have measured the photoion time-of-flight spectra using monochromatized synchrotron radiation. Dual windows resonance structure previously observed in K was also found in Rb and Cs, suggesting that those structure are general features in alkaline atoms. We have observed also the Rydberg series of resonances that appear in dual windows. Our data analysis shows that the resonance widths are broad when compared with its rare gas neighbors. Based on multiconfiguration Dirac-Fock calculations, the Rydberg series of resonances were assigned to the 4s 1 4p 6 5s5p excitations embedded in the 4p 5 5s continua for Rb and to the 5s 1 5p 6 6s6p excitations embedded in the 5p 5 6s continua for Cs. (author)
International Nuclear Information System (INIS)
Yu Qingjuan; Lu Youjun; Mohayaee, Roya; Colin, Jacques
2011-01-01
Dual active galactic nuclei (AGNs) are natural byproducts of hierarchical mergers of galaxies in the ΛCDM cosmogony. Recent observations have shown that only a small fraction (∼0.1%-2.5%) of AGNs at redshift z ∼< 0.3 are dual with kpc-scale separations, which is rather low compared to the high merger rate of galaxies. Here we construct a phenomenological model to estimate the number density of dual AGNs and its evolution according to the observationally estimated major merger rates of galaxies and various scaling relations on the properties of galaxies and their central massive black holes. We show that our model reproduces the observed frequency and separation distribution of dual AGNs provided that significant nuclear activities are triggered only in gas-rich progenitor galaxies with central massive black holes and only when the nuclei of these galaxies are roughly within the half-light radii of their companion galaxies. Under these constraints, the observed low dual AGN frequency is consistent with the relatively high merger rate of galaxies and supports the hypothesis that major mergers lead to AGN/QSO activities. We also predict that the number of kpc-scale dual AGNs decreases with increasing redshift and only about 0.02%-0.06% of AGNs are dual AGNs with double-peaked narrow line features at redshifts of z ∼ 0.5-1.2. Future observations of high-redshift dual AGNs would provide a solid test for this prediction.
Relativistic Coulomb excitation of giant resonances in the hydrodynamic model
International Nuclear Information System (INIS)
Vasconcellos Gomes, Ana Cristina de.
1990-05-01
We investigate the Coulomb excitation of giant dipole resonances in relativistic heavy ion collisions using a macroscopic hydrodynamical model for the harmonic vibrations of the nuclear fluid. The motion is treated as a combination of the Goldhaber-Teller displacement mode and the Steinwedel-Jensen acoustic mode, and the restoring forces are calculated using the droplet model. This model is used as input to study the characteristics of multiple excitation of giant dipole resonances in nuclei. Possible signatures for the existence of such states are also discussed quantitatively. (author). 52 refs., 14 figs., 3 tabs
Glöckner, A.; Witteman, C.L.M.
2010-01-01
Intuitive-automatic processes are crucial for making judgements and decisions. The fascinating complexity of these processes has attracted many decision researchers, prompting them to start investigating intuition empirically and to develop numerous models. Dual-process models assume a clear
Directory of Open Access Journals (Sweden)
Li Guo
2018-06-01
Full Text Available In this paper, a circular polarizer comprising dual semicircular split-rings (DSSRs is presented. By placing it above an elliptical radiator that radiates linearly polarized (LP waves, dual-layer patch antennas capable of radiating right-hand (RH or left-hand (LH circularly polarized (CP waves are achieved in terms of the different offset direction of the bottom splits of the DSSRs. Because of both the capacitive coupling to the radiator and the degenerate modes existing in the excited DSSRs, the DSSRs collaboratively result in a circularly polarized radiation, successfully converting incident LP waves into CP ones. Simulated results show that the impedance, axial ratio (AR, and gain frequency response of both proposed CP antennas are identical, with a simulated 3-dB AR bandwidth of 72 MHz covering 2.402–2.474 GHz and a gain enhanced by 3.9 dB. The proposed antennas were fabricated and measured, revealing an operational bandwidth of 65 MHz (2.345–2.41 GHz and a peak gain up to 9 dBi. Moreover, a low profile of 0.063λ0 is maintained. The proposed CP antennas could be as a candidate for wireless target detection applications in terms of their identical frequency response property.
Exchange mechanisms for single photo- and electroproduction using the dual fermion model
International Nuclear Information System (INIS)
Becker, L.; Weigt, G.
1976-01-01
Single pion real and virtual photoproduction data are compared with phenomenological dual fermion amplitudes, which were previously applied to quasi-two body vector and tensor meson production. The similar structures of the photon and the corresponding vector meson data (in the s-channel helicity system) such as spikes and dips, usually described by Regge pole/Regge cut interferences, are reproduced by the dual Born amplitudes. Predictions of the model for the differential cross sections, in particular their parts for natural and unnatural spin-parity t-channel exchanges as well as their mass dependence, and photon and target asymmetries are in reasonable agreement with the experimental data. (author)
Dual-mode plasmonic nanorod type antenna based on the concept of a trapped dipole.
Panaretos, Anastasios H; Werner, Douglas H
2015-04-06
In this paper we theoretically investigate the feasibility of creating a dual-mode plasmonic nanorod antenna. The proposed design methodology relies on adapting to optical wavelengths the principles of operation of trapped dipole antennas, which have been widely used in the low MHz frequency range. This type of antenna typically employs parallel LC circuits, also referred to as "traps", which are connected along the two arms of the dipole. By judiciously choosing the resonant frequency of these traps, as well as their position along the arms of the dipole, it is feasible to excite the λ/2 resonance of both the original dipole as well as the shorter section defined by the length of wire between the two traps. This effectively enables the dipole antenna to have a dual-mode of operation. Our analysis reveals that the implementation of this concept at the nanoscale requires that two cylindrical pockets (i.e. loading volumes) be introduced along the length of the nanoantenna, inside which plasmonic core-shell particles are embedded. By properly selecting the geometry and constitution of the core-shell particle as well as the constitution of the host material of the two loading volumes and their position along the nanorod, the equivalent effect of a resonant parallel LC circuit can be realized. This effectively enables a dual-mode operation of the nanorod antenna. The proposed methodology introduces a compact approach for the realization of dual-mode optical sensors while at the same time it clearly illustrates the inherent tuning capabilities that core-shell particles can offer in a practical framework.
Performance Enhancements Under Dual-task Conditions
Kramer, A. F.; Wickens, C. D.; Donchin, E.
1984-01-01
Research on dual-task performance has been concerned with delineating the antecedent conditions which lead to dual-task decrements. Capacity models of attention, which propose that a hypothetical resource structure underlies performance, have been employed as predictive devices. These models predict that tasks which require different processing resources can be more successfully time shared than tasks which require common resources. The conditions under which such dual-task integrality can be fostered were assessed in a study in which three factors likely to influence the integrality between tasks were manipulated: inter-task redundancy, the physical proximity of tasks and the task relevant objects. Twelve subjects participated in three experimental sessions in which they performed both single and dual-tasks. The primary task was a pursuit step tracking task. The secondary tasks required the discrimination between different intensities or different spatial positions of a stimulus. The results are discussed in terms of a model of dual-task integrality.
Greve, Andrea; Donaldson, David I; van Rossum, Mark C W
2010-02-01
Dual-process theories of episodic memory state that retrieval is contingent on two independent processes: familiarity (providing a sense of oldness) and recollection (recovering events and their context). A variety of studies have reported distinct neural signatures for familiarity and recollection, supporting dual-process theory. One outstanding question is whether these signatures reflect the activation of distinct memory traces or the operation of different retrieval mechanisms on a single memory trace. We present a computational model that uses a single neuronal network to store memory traces, but two distinct and independent retrieval processes access the memory. The model is capable of performing familiarity and recollection-based discrimination between old and new patterns, demonstrating that dual-process models need not to rely on multiple independent memory traces, but can use a single trace. Importantly, our putative familiarity and recollection processes exhibit distinct characteristics analogous to those found in empirical data; they diverge in capacity and sensitivity to sparse and correlated patterns, exhibit distinct ROC curves, and account for performance on both item and associative recognition tests. The demonstration that a single-trace, dual-process model can account for a range of empirical findings highlights the importance of distinguishing between neuronal processes and the neuronal representations on which they operate.
War and peace: morphemes and full forms in a noninteractive activation parallel dual-route model.
Baayen, H; Schreuder, R
This article introduces a computational tool for modeling the process of morphological segmentation in visual and auditory word recognition in the framework of a parallel dual-route model. Copyright 1999 Academic Press.
The dual pathway model of overeating. Replication and extension with actual food consumption
Ouwens, Machteld A; van Strien, T; Leeuwe, J.F.J.; van der Staak, C P F
van Strien et al. [van Strien, T., Engels, R. C. M. E., van Leeuwe, J., Snoek, H. M. (2005). The Stice model of overeating: tests in clinical and non-clinical samples. Appetite, 45, 205-213] extended the negative affect pathway of Stice's dual pathway model of overeating Stice [Stice, E. (1994).
International Nuclear Information System (INIS)
Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong
2015-01-01
A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)
Modeling and analysis of a resonant nanosystem
Calvert, Scott L.
The majority of investigations into nanoelectromechanical resonators focus on a single area of the resonator's function. This focus varies from the development of a model for a beam's vibration, to the modeling of electrostatic forces, to a qualitative explanation of experimentally-obtained currents. Despite these efforts, there remains a gap between these works, and the level of sophistication needed to truly design nanoresonant systems for efficient commercial use. Towards this end, a comprehensive system model for both a nanobeam resonator and its related experimental setup is proposed. Furthermore, a simulation arrangement is suggested as a method for facilitating the study of the system-level behavior of these devices in a variety of cases that could not be easily obtained experimentally or analytically. The dynamics driving the nanoresonator's motion, as well as the electrical interactions influencing the forcing and output of the system, are modeled, experimentally validated, and studied. The model seeks to develop both a simple circuit representation of the nanoresonator, and to create a mathematical system that can be used to predict and interpret the observed behavior. Due to the assumptions used to simplify the model to a point of reasonable comprehension, the model is most accurate for small beam deflections near the first eigenmode of the beam. The process and results of an experimental investigation are documented, and compared with a circuit simulation modeling the full test system. The comparison qualitatively proves the functionality of the model, while a numerical analysis serves to validate the functionality and setup of the circuit simulation. The use of the simulation enables a much broader investigation of both the electrical behavior and the physical device's dynamics. It is used to complement an assessment of the tuning behavior of the system's linear natural frequency by demonstrating the tuning behavior of the full nonlinear response. The
The fusion rate in the transmission resonance model
International Nuclear Information System (INIS)
Jaendel, M.
1992-01-01
Resonant transmission of deuterons through a chain of target deuterons in a metal matrix has been suggested as an explanation for the cold fusion phenomena. In this paper the fusion rate in such transmission resonance models is estimated, and the basic physical constraints are discussed. The dominating contribution to the fusion yield is found to come from metastable states. The fusion rate is well described by the Wentzel-Kramer-Brillouin approximation and appears to be much too small to explain the experimental anomalies
Lee Jae Won; Choi Jin Ho; Jin Dae Ho
2014-01-01
In this paper, we give the explicit determinations of dual plane curves, general dual helices and dual slant helices in terms of its dual curvature and dual torsion as a fundamental theory of dual curves in a dual 3-space
Nontopological bare solutions in the relativistic self-dual Maxwell-Chern-Simons-Higgs model
International Nuclear Information System (INIS)
Han, Jongmin; Jang, Jaeduk
2005-01-01
In this paper we prove the existence of the radially symmetric nontopological bare solutions in the relativistic self-dual Maxwell-Chern-Simons-Higgs model. We also verify the Chern-Simons limit for those solutions
Computer aided design of Langasite resonant cantilevers: analytical models and simulations
Tellier, C. R.; Leblois, T. G.; Durand, S.
2010-05-01
Analytical models for the piezoelectric excitation and for the wet micromachining of resonant cantilevers are proposed. Firstly, computations of metrological performances of micro-resonators allow us to select special cuts and special alignment of the cantilevers. Secondly the self-elaborated simulator TENSOSIM based on the kinematic and tensorial model furnishes etching shapes of cantilevers. As the result the number of selected cuts is reduced. Finally the simulator COMSOL® is used to evaluate the influence of final etching shape on metrological performances and especially on the resonance frequency. Changes in frequency are evaluated and deviating behaviours of structures with less favourable built-ins are tested showing that the X cut is the best cut for LGS resonant cantilevers vibrating in flexural modes (type 1 and type 2) or in torsion mode.
Mothers Coping With Bereavement in the 2008 China Earthquake: A Dual Process Model Analysis.
Chen, Lin; Fu, Fang; Sha, Wei; Chan, Cecilia L W; Chow, Amy Y M
2017-01-01
The purpose of this study is to explore the grief experiences of mothers after they lost their children in the 2008 China earthquake. Informed by the Dual Process Model, this study conducted in-depth interviews to explore how six bereaved mothers coped with such grief over a 2-year period. Right after the earthquake, these mothers suffered from intensive grief. They primarily coped with loss-oriented stressors. As time passed, these mothers began to focus on restoration-oriented stressors to face changes in life. This coping trajectory was a dynamic and integral process, which bereaved mothers oscillated between loss- and restoration-oriented stressors. This study offers insight in extending the existing empirical evidence of the Dual Process Model.
Estimating dual deposit insurance premium rates and forecasting non-performing loans: Two new models
Yoshino, Naoyuki; Taghizadeh-Hesary, Farhad; Nili, Farhad
2015-01-01
Risky banks that endanger the stability of the financial system should pay higher deposit insurance premiums than healthy banks and other financial institutions that have shown good financial performance. It is necessary, therefore, to have at least a dual fair premium rate system. In this paper, we develop a model for calculating dual fair premium rates. Our definition of a fair premium rate in this paper is a rate that could cover the operational expenditures of the deposit insuring organiz...
The dual pathway model of overeating. Replication and extension with actual food consumption
Ouwens, M.A.; Strien, T. van; Leeuwe, J.F.J. van; Staak, C.P.F. van der
2009-01-01
van Strien et al. [van Strien, T., Engels, R. C. M. E., van Leeuwe, J., Snoek, H. M. (2005). The Stice model of overeating: tests in clinical and non-clinical samples. Appetite, 45, 205–213] extended the negative affect pathway of Stice's dual pathway model of overeating Stice [Stice, E. (1994).
Rectifier Current Control for an LLC Resonant Converter Based on a Simplified Linearized Model
Directory of Open Access Journals (Sweden)
Zhijian Fang
2018-03-01
Full Text Available In this paper, a rectifier current control for an LLC resonant converter is proposed, based on a simplified, two-order, linearized model that adds a rectifier current feedback inner loop to improve dynamic performance. Compared to the traditional large-signal model with seven resonant states, this paper utilizes a rectifier current state to represent the characteristics of the resonant states, simplifying the LLC resonant model from seven orders to two orders. Then, the rectifier current feedback inner loop is proposed to increase the control system damping, improving dynamic performance. The modeling and design methodology for the LLC resonant converter are also presented in this paper. A frequency analysis is conducted to verify the accuracy of the simplified model. Finally, a 200 W LLC resonant converter prototype is built to verify the effectiveness of the proposed control strategy. Compared to a traditional single-loop controller, the settling time and voltage droop were reduced from 10.8 ms to 8.6 ms and from 6.8 V to 4.8 V, respectively, using the proposed control strategy.
A Superconducting Dual-Channel Photonic Switch.
Srivastava, Yogesh Kumar; Manjappa, Manukumara; Cong, Longqing; Krishnamoorthy, Harish N S; Savinov, Vassili; Pitchappa, Prakash; Singh, Ranjan
2018-06-05
The mechanism of Cooper pair formation and its underlying physics has long occupied the investigation into high temperature (high-T c ) cuprate superconductors. One of the ways to unravel this is to observe the ultrafast response present in the charge carrier dynamics of a photoexcited specimen. This results in an interesting approach to exploit the dissipation-less dynamic features of superconductors to be utilized for designing high-performance active subwavelength photonic devices with extremely low-loss operation. Here, dual-channel, ultrafast, all-optical switching and modulation between the resistive and the superconducting quantum mechanical phase is experimentally demonstrated. The ultrafast phase switching is demonstrated via modulation of sharp Fano resonance of a high-T c yttrium barium copper oxide (YBCO) superconducting metamaterial device. Upon photoexcitation by femtosecond light pulses, the ultrasensitive cuprate superconductor undergoes dual dissociation-relaxation dynamics, with restoration of superconductivity within a cycle, and thereby establishes the existence of dual switching windows within a timescale of 80 ps. Pathways are explored to engineer the secondary dissociation channel which provides unprecedented control over the switching speed. Most importantly, the results envision new ways to accomplish low-loss, ultrafast, and ultrasensitive dual-channel switching applications that are inaccessible through conventional metallic and dielectric based metamaterials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
The Droplet model of the Giant Fipole Resonance
International Nuclear Information System (INIS)
Myers, W.D.; Kodama, T.; El-Jaick, L.J.; Hilf, E.R.
1976-10-01
The nuclear Giant Dipole Resonance (GDR) energies are calculated using a macroscopic hydronamical model with two new features. The motion is treated as a combination of the usual Goldhaber-Teller (GT) and Steinwedel-Jensen (SJ) modes, and the restoring forces are all calculated using the Droplet Model. The A dependence of the resonance energies is well reproduced without any adjustable parameters, and the measured magnitude of the energies serves to fix the value of the effective mass m* used in the theory. The GDR is found to consist mainly of a GT-type motion with the SJ-mode becoming more important for heavy nuclei. The width P of the GDR is also estimated on the basis of an expression for one-body damping [pt
Compact extended model for doppler broadening of neutron absorption resonances in solids
International Nuclear Information System (INIS)
Villanueva, A. J; Granada, J.R
2009-01-01
We present a simplified compact model for calculating Doppler broadening of neutron absorption resonances in an incoherent Debye solid. Our model extends the effective temperature gas model to cover the whole range of energies and temperatures, and reduces the information of the dynamical system to a minimum content compatible with a much better accuracy of the calculation. This model is thus capable of replacing the existing algorithm in standard codes for resonance cross sections preparation aimed at neutron and reactor physics calculations. The model is applied to the 238 U 6.671 eV effective broadened cross section. We also show how this model can be used for thermometry in an improved fashion compared to the effective temperature gas model. Experimental data of the same resonance at low and high temperatures are also shown and the performances of each model are put to the test on this basis. [es
Improved dual sided doped memristor: modelling and applications
Directory of Open Access Journals (Sweden)
Anup Shrivastava
2014-05-01
Full Text Available Memristor as a novel and emerging electronic device having vast range of applications suffer from poor frequency response and saturation length. In this paper, the authors present a novel and an innovative device structure for the memristor with two active layers and its non-linear ionic drift model for an improved frequency response and saturation length. The authors investigated and compared the I–V characteristics for the proposed model with the conventional memristors and found better results in each case (different window functions for the proposed dual sided doped memristor. For circuit level simulation, they developed a SPICE model of the proposed memristor and designed some logic gates based on hybrid complementary metal oxide semiconductor memristive logic (memristor ratioed logic. The proposed memristor yields improved results in terms of noise margin, delay time and dynamic hazards than that of the conventional memristors (single active layer memristors.
Kodippili, Kasun; Hakim, Chady H; Pan, Xiufang; Yang, Hsiao T; Yue, Yongping; Zhang, Yadong; Shin, Jin-Hong; Yang, N Nora; Duan, Dongsheng
2018-03-01
Dual adeno-associated virus (AAV) technology was developed in 2000 to double the packaging capacity of the AAV vector. The proof of principle has been demonstrated in various mouse models. Yet, pivotal evidence is lacking in large animal models of human diseases. Here we report expression of a 7-kb canine ΔH2-R15 mini-dystrophin gene using a pair of dual AAV vectors in the canine model of Duchenne muscular dystrophy (DMD). The ΔH2-R15 minigene is by far the most potent synthetic dystrophin gene engineered for DMD gene therapy. We packaged minigene dual vectors in Y731F tyrosine-modified AAV-9 and delivered to the extensor carpi ulnaris muscle of a 12-month-old affected dog at the dose of 2 × 10 13 viral genome particles/vector/muscle. Widespread mini-dystrophin expression was observed 2 months after gene transfer. The missing dystrophin-associated glycoprotein complex was restored. Treatment also reduced muscle degeneration and fibrosis and improved myofiber size distribution. Importantly, dual AAV therapy greatly protected the muscle from eccentric contraction-induced force loss. Our data provide the first clear evidence that dual AAV therapy can be translated to a diseased large mammal. Further development of dual AAV technology may lead to effective therapies for DMD and many other diseases in human patients.
A statistical model for combustion resonance from a DI diesel engine with applications
Bodisco, Timothy; Low Choy, Samantha; Masri, Assaad; Brown, Richard J.
2015-08-01
Introduced in this paper is a Bayesian model for isolating the resonant frequency from combustion chamber resonance. The model shown in this paper focused on characterising the initial rise in the resonant frequency to investigate the rise of in-cylinder bulk temperature associated with combustion. By resolving the model parameters, it is possible to determine: the start of pre-mixed combustion, the start of diffusion combustion, the initial resonant frequency, the resonant frequency as a function of crank angle, the in-cylinder bulk temperature as a function of crank angle and the trapped mass as a function of crank angle. The Bayesian method allows for individual cycles to be examined without cycle-averaging-allowing inter-cycle variability studies. Results are shown for a turbo-charged, common-rail compression ignition engine run at 2000 rpm and full load.
Directory of Open Access Journals (Sweden)
Junhai Ma
2016-01-01
Full Text Available In order to explore how the manufacturers make decisions when two manufacturers compete for local advertising investment, we examine two noncooperative models (Stackelberg and Nash game and propose a cost sharing contract to investigate channel competition of dual-channel supply chain. The dominant power between manufacturer and retailer and the effect of channel competition strategy on price are mainly discussed. In addition, dynamic system concepts are integrated into Stackelberg game model based on bounded rational mechanism. We analyze the local stability and find that the stability level of the dual-channel supply chains depends crucially on the price adjustment speed, the level of demand uncertainty, and the risk preference. The outcome shows that, under the master-slave game model, the profits of manufacturers are greater than that under decentralized decision-making mode, and the profits of retailers under master-slave game model are less than that under decentralized decision-making mode. The profits of manufacturers and retailers in the stable region are greater than that in unstable region. Finally, the delay feedback control method is utilized and effectively controls the chaotic behavior of dual-channel supply chain model. The results have theoretical and practical significance for the game models in terms of advertising and price competition.
Small-signal model for the series resonant converter
King, R. J.; Stuart, T. A.
1985-01-01
The results of a previous discrete-time model of the series resonant dc-dc converter are reviewed and from these a small signal dynamic model is derived. This model is valid for low frequencies and is based on the modulation of the diode conduction angle for control. The basic converter is modeled separately from its output filter to facilitate the use of these results for design purposes. Experimental results are presented.
Capacitance of circular patch resonator
International Nuclear Information System (INIS)
Miano, G.; Verolino, L.; Naples Univ.; Panariello, G.; Vaccaro, V.G.; Naples Univ.
1995-11-01
In this paper the capacitance of the circular microstrip patch resonator is computed. It is shown that the electrostatic problem can be formulated as a system of dual integral equations, and the most interesting techniques of solutions of these systems are reviewed. Some useful approximated formulas for the capacitance are derived and plots of the capacitance are finally given in a wide range of dielectric constants
High Selectivity Dual-Band Bandpass Filter with Tunable Lower Passband
Directory of Open Access Journals (Sweden)
Wei-Qiang Pan
2015-01-01
Full Text Available This paper presents a novel method to design dual-band bandpass filters with tunable lower passband and fixed upper passband. It utilizes a trimode resonator with three controllable resonant modes. Discriminating coupling is used to suppress the unwanted mode to avoid the interference. Varactors are utilized to realize tunable responses. The bandwidth of the two bands can be controlled individually. Transmission zeros are generated near the passband edges, resulting in high selectivity. For demonstration, a tunable bandpass filter is implemented. Good agreement between the prediction and measurement validates the proposed method.
Wei, Kuo-Chen; Lin, Feng-Wei; Huang, Chiung-Yin; Ma, Chen-Chi M; Chen, Ju-Yu; Feng, Li-Ying; Yang, Hung-Wei
To date, knowing how to identify the location of chemotherapeutic agents in the human body after injection is still a challenge. Therefore, it is urgent to develop a drug delivery system with molecular imaging tracking ability to accurately understand the distribution, location, and concentration of a drug in living organisms. In this study, we developed bovine serum albumin (BSA)-based nanoparticles (NPs) with dual magnetic resonance (MR) and fluorescence imaging modalities (fluorescein isothiocyanate [FITC]-BSA-Gd/1,3-bis(2-chloroethyl)-1-nitrosourea [BCNU] NPs) to deliver BCNU for inhibition of brain tumor cells (MBR 261-2). These BSA-based NPs are water dispersible, stable, and biocompatible as confirmed by XTT cell viability assay. In vitro phantoms and in vivo MR and fluorescence imaging experiments show that the developed FITC-BSA-Gd/BCNU NPs enable dual MR and fluorescence imaging for monitoring cellular uptake and distribution in tumors. The T1 relaxivity (R1) of FITC-BSA-Gd/BCNU NPs was 3.25 mM(-1) s(-1), which was similar to that of the commercial T1 contrast agent (R1 =3.36 mM(-1) s(-1)). The results indicate that this multifunctional drug delivery system has potential bioimaging tracking of chemotherapeutic agents ability in vitro and in vivo for cancer therapy.
Dual Enrollment for High School Students
Edwards, Linsey; Hughes, Katherine
2011-01-01
Dual enrollment programs allow high school students to enroll in college courses and potentially earn college credit. The term concurrent enrollment is sometimes used interchangeably with dual enrollment, and sometimes to refer to a particular model of dual enrollment. In some programs, students earn high school and college credit simultaneously;…
Dual models with SL(2, C) symmetry
Brink, L
1972-01-01
Making use of homogeneous space techniques, the authors construct a class of dual models, which is a generalization of the Virasoro- Shapiro type of model. The integrand in the integral representation for the N-point function depends not only on the modulus of the distances between two-dimensional Koba-Nielsen variables, but also on the corresponding phases. This is in fact the most general SL(2, C) invariant amplitude that can be constructed using complex integration variables. The extra phase factors in the integrand provide a possible means of avoiding tachyons both as external particles and as intermediate states in the amplitude. When factorized in a simple- minded fashion the intercepts are fixed to be integers. Although the external particles can be chosen not to be tachyons, such states appear as intermediate states. Within this factorization one can show that there are gauge conditions for the amplitude that can provide a ghostkilling mechanism. (19 refs).
Potretzke, Theodora A; Brace, Christopher L; Lubner, Meghan G; Sampson, Lisa A; Willey, Bridgett J; Lee, Fred T
2015-04-01
To compare dual-energy computed tomography (CT) with conventional CT for the detection of small-bowel ischemia in an experimental animal model. The study was approved by the animal care and use committee and was performed in accordance with the Guide for Care and Use of Laboratory Animals issued by the National Research Council. Ischemic bowel segments (n = 8) were created in swine (n = 4) by means of surgical occlusion of distal mesenteric arteries and veins. Contrast material-enhanced dual-energy CT and conventional single-energy CT (120 kVp) sequences were performed during the portal venous phase with a single-source fast-switching dual-energy CT scanner. Attenuation values and contrast-to-noise ratios of ischemic and perfused segments on iodine material-density, monospectral dual-energy CT (51 keV, 65 keV, and 70 keV), and conventional 120-kVp CT images were compared. Linear mixed-effects models were used for comparisons. The attenuation difference between ischemic and perfused segments was significantly greater on dual-energy 51-keV CT images than on conventional 120-kVp CT images (mean difference, 91.7 HU vs 47.6 HU; P conventional CT by increasing attenuation differences between ischemic and perfused segments on low-kiloelectron volt and iodine material density images. © RSNA, 2014.
Rural-urban migration: policy simulations in a dual economy model of Bangladesh.
Ahmed, S
1986-03-01
The process of rural-urban migration in Bangladesh is analyzed using a dual economy model. The focus is on the period 1976-1985. The main purpose of the paper is to examine alternative policies designed to reduce the level of such migration without adversely affecting the country's economy.
A one-dimensional model of resonances with a delta barrier and mass jump
International Nuclear Information System (INIS)
Alvarez, J.J.; Gadella, M.; Heras, F.J.H.; Nieto, L.M.
2009-01-01
In this Letter, we present a one-dimensional model that includes a hard core at the origin, a Dirac delta barrier at a point in the positive semiaxis and a mass jump at the same point. We study the effect of this mass jump in the behavior of the resonances of the model. We obtain an infinite number of resonances for this situation, showing that for the case of a mass jump the imaginary part of the resonance poles tend to a fixed value depending on the quotient of masses, and demonstrate that none of these resonances is degenerated.
An analytical model for cumulative infiltration into a dual-permeability media
Peyrard, Xavier; Lassabatere, Laurent; Angulo-Jaramillo, Rafael; Simunek, Jiri
2010-05-01
Modeling of water infiltration into the vadose zone is important for better understanding of movement of water-transported contaminants. There is a great need to take into account the soil heterogeneity and, in particular, the presence of macropores or cracks that could generate preferential flow. Several mathematical models have been proposed to describe unsaturated flow through heterogeneous soils. The dual-permeability model assumes that flow is governed by Richards equation in both porous regions (matrix and fractures). Water can be exchanged between the two regions following a first-order rate law. A previous study showed that the influence of the hydraulic conductivity of the matrix/macropore interface had a little influence on cumulative infiltration at the soil surface. As a result, one could consider the surface infiltration for a specific case of no water exchange between the fracture and matrix regions (a case of zero interfacial hydraulic conductivity). In such a case, water infiltration can be considered to be the sum of the cumulative infiltrations into the matrix and the fractures. On the basis of analytical models for each sub domain (matrix and fractures), an analytical model is proposed for the entire dual-porosity system. A sensitivity analysis is performed to characterize the influence of several factors, such as the saturated hydraulic conductivity ratio, the water pressure scale parameter ratio, and the saturated volumetric water content scale ratio, on the total cumulative infiltration. Such an analysis greatly helps in quantifying the impact of macroporosity and fractures on water infiltration, which can be of great interest for hydrological models.
Continuum Modeling of Inductor Hysteresis and Eddy Current Loss Effects in Resonant Circuits
Energy Technology Data Exchange (ETDEWEB)
Pries, Jason L. [ORNL; Tang, Lixin [ORNL; Burress, Timothy A. [ORNL
2017-10-01
This paper presents experimental validation of a high-fidelity toroid inductor modeling technique. The aim of this research is to accurately model the instantaneous magnetization state and core losses in ferromagnetic materials. Quasi–static hysteresis effects are captured using a Preisach model. Eddy currents are included by coupling the associated quasi-static Everett function to a simple finite element model representing the inductor cross sectional area. The modeling technique is validated against the nonlinear frequency response from two different series RLC resonant circuits using inductors made of electrical steel and soft ferrite. The method is shown to accurately model shifts in resonant frequency and quality factor. The technique also successfully predicts a discontinuity in the frequency response of the ferrite inductor resonant circuit.
Dual model for parton densities
International Nuclear Information System (INIS)
El Hassouni, A.; Napoly, O.
1981-01-01
We derive power-counting rules for quark densities near x=1 and x=0 from parton interpretations of one-particle inclusive dual amplitudes. Using these rules, we give explicit expressions for quark distributions (including charm) inside hadrons. We can then show the compatibility between fragmentation and recombination descriptions of low-p/sub perpendicular/ processes
Blöcher, Johanna; Kuraz, Michal
2017-04-01
In this contribution we propose implementations of the dual permeability model with different inter-domain exchange descriptions and metaheuristic optimization algorithms for parameter identification and mesh optimization. We compare variants of the coupling term with different numbers of parameters to test if a reduction of parameters is feasible. This can reduce parameter uncertainty in inverse modeling, but also allow for different conceptual models of the domain and matrix coupling. The different variants of the dual permeability model are implemented in the open-source objective library DRUtES written in FORTRAN 2003/2008 in 1D and 2D. For parameter identification we use adaptations of the particle swarm optimization (PSO) and Teaching-learning-based optimization (TLBO), which are population-based metaheuristics with different learning strategies. These are high-level stochastic-based search algorithms that don't require gradient information or a convex search space. Despite increasing computing power and parallel processing, an overly fine mesh is not feasible for parameter identification. This creates the need to find a mesh that optimizes both accuracy and simulation time. We use a bi-objective PSO algorithm to generate a Pareto front of optimal meshes to account for both objectives. The dual permeability model and the optimization algorithms were tested on virtual data and field TDR sensor readings. The TDR sensor readings showed a very steep increase during rapid rainfall events and a subsequent steep decrease. This was theorized to be an effect of artificial macroporous envelopes surrounding TDR sensors creating an anomalous region with distinct local soil hydraulic properties. One of our objectives is to test how well the dual permeability model can describe this infiltration behavior and what coupling term would be most suitable.
Vector and Axial-vector resonances in composite models of the Higgs boson
DEFF Research Database (Denmark)
Franzosi, Diogo Buarque; Cacciapaglia, Giacomo; Cai, Haiying
2016-01-01
We provide a non-linear realisation of composite Higgs models in the context of the SU(4)/Sp(4) symmetry breaking pattern, where the effective Lagrangian of the spin-0 and spin-1 resonances is constructed via the CCWZ prescription using the Hidden Symmetry formalism. We investigate the EWPT const...... as a template for the phenomenology of composite Higgs models at the LHC and at future 100 TeV colliders, as well as for other application. In this work, we focus on the formalism for spin-1 resonances and their bounds from di-lepton and di-boson searches at the LHC.......We provide a non-linear realisation of composite Higgs models in the context of the SU(4)/Sp(4) symmetry breaking pattern, where the effective Lagrangian of the spin-0 and spin-1 resonances is constructed via the CCWZ prescription using the Hidden Symmetry formalism. We investigate the EWPT...... constraints by accounting the effects from reduced Higgs couplings and integrating out heavy spin-1 resonances. This theory emerges from an underlying theory of gauge interactions with fermions, thus first principle lattice results predict the massive spectrum in composite Higgs models. This model can be used...
Resonances and fusion in heavy ion reactions: new models and developments
International Nuclear Information System (INIS)
Cindro, N.
1982-01-01
Several aspects of the problem of the resonant behaviour of heavy-ion induced reactions are discussed. First, the problem is set in its relation to fundamental nuclear physics and our understanding of nuclear structure. It is suggested that, if the resonant behaviour of heavy-ion reactions is indeed due to the presence of particular configurations in the composite systems, these configurations must have a very specific nature which prevents their mixing with the adjacent states or else other conditons (e.g. low level density) should be met. Further on, the problem of resonant behaviour observed in back-angle elastic scattering and in forward-angle reaction data is discussed. Collisions between heavy ions leading to the composite systems 36 Ar and 40 Ca are used to discuss the apparent lack of correlation between these two sets of data. A way to understand it, based on the fragmentation of broad resonances, is suggested. In the third part the relation between structure in the fusion cross section excitation functions and that in reaction channel cross sections is discussed. Finally, in the fourth part, the orbiting-cluster model of heavy-ion resonances is briefly described and its predictions discussed. Based on this model a list is given of colliding heavy-ion systems where resonances are expected. (author)
Personality and creativity : The dual pathway to creativity model and a research agenda
Baas, Matthijs; Roskes, Marieke; Sligte, Daniel; Nijstad, Bernard A.; De Dreu, Carsten K W
2013-01-01
To better understand the relation between personality traits and creativity, we invoke the Dual-Pathway to Creativity model (DPCM) that identifies two pathways to creative outcomes: (1) flexible processing of information (cognitive flexibility) and (2) persistent probing, and systematically and
Reliable Dual Tensor Model Estimation in Single and Crossing Fibers Based on Jeffreys Prior
Yang, Jianfei; Poot, Dirk H. J.; Caan, Matthan W. A.; Su, Tanja; Majoie, Charles B. L. M.; van Vliet, Lucas J.; Vos, Frans M.
2016-01-01
Purpose This paper presents and studies a framework for reliable modeling of diffusion MRI using a data-acquisition adaptive prior. Methods Automated relevance determination estimates the mean of the posterior distribution of a rank-2 dual tensor model exploiting Jeffreys prior (JARD). This data-acquisition prior is based on the Fisher information matrix and enables the assessment whether two tensors are mandatory to describe the data. The method is compared to Maximum Likelihood Estimation (MLE) of the dual tensor model and to FSL’s ball-and-stick approach. Results Monte Carlo experiments demonstrated that JARD’s volume fractions correlated well with the ground truth for single and crossing fiber configurations. In single fiber configurations JARD automatically reduced the volume fraction of one compartment to (almost) zero. The variance in fractional anisotropy (FA) of the main tensor component was thereby reduced compared to MLE. JARD and MLE gave a comparable outcome in data simulating crossing fibers. On brain data, JARD yielded a smaller spread in FA along the corpus callosum compared to MLE. Tract-based spatial statistics demonstrated a higher sensitivity in detecting age-related white matter atrophy using JARD compared to both MLE and the ball-and-stick approach. Conclusions The proposed framework offers accurate and precise estimation of diffusion properties in single and dual fiber regions. PMID:27760166
Song, Xinyue; Yue, Zihong; Zhang, Jiayu; Jiang, Yanxialei; Wang, Zonghua; Zhang, Shusheng
2018-04-25
Intracellular [Ca 2+ ] i and pH i have a close relationship, and their abnormal levels can result in cell dysfunction and accompanying diseases. Thus, simultaneous determination of [Ca 2+ ] i and pH i can more accurately investigate complex biological processes in an integrated platform. Herein, multicolor upconversion nanoparticles (UCNPs) were prepared with the advantages of no spectral overlapping, single NIR excitation wavelengths, and greater tissue penetration depth. The upconversion nanoprobes were easily prepared by the attachment of two fluorescent dyes, Fluo-4 and SNARF-4F. Based on the dual luminescence resonance energy transfer (LRET) process, the blue and green fluorescence of the UCNPs were specially quenched and selectively recovered after the detachment and/or absorbance change of the attached fluorescent dyes, enabling dual detection. Importantly, the developed nanoprobe could successfully be applied for the detection of [Ca 2+ ] i and pH i change in adenosine triphosphate (ATP) and ethylene glycol tetraacetic acid (EGTA) stimulation in living cells. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Toniolo, Giuliano R.; Fargnoli, H.G.; Brito, L.C.T. [Universidade Federal de Lavras, Departamento de Fisica, Caixa Postal 3037, Lavras, Minas Gerais (Brazil); Scarpelli, A.P.B. [Setor Tecnico-Cientifico, Departamento de Policia Federal, Sao Paulo (Brazil)
2017-02-15
S-matrix amplitudes for the electron-electron scattering are calculated in order to verify the physical equivalence between two Lorentz-breaking dual models. We begin with an extended Quantum Electrodynamics which incorporates CPT-even Lorentz-violating kinetic and mass terms. Then, in a process of gauge embedding, its gauge-invariant dual model is obtained. The physical equivalence of the two models is established at tree level in the electron-electron scattering and the unpolarized cross section is calculated up to second order in the Lorentz-violating parameter. (orig.)
International Nuclear Information System (INIS)
Toniolo, Giuliano R.; Fargnoli, H.G.; Brito, L.C.T.; Scarpelli, A.P.B.
2017-01-01
S-matrix amplitudes for the electron-electron scattering are calculated in order to verify the physical equivalence between two Lorentz-breaking dual models. We begin with an extended Quantum Electrodynamics which incorporates CPT-even Lorentz-violating kinetic and mass terms. Then, in a process of gauge embedding, its gauge-invariant dual model is obtained. The physical equivalence of the two models is established at tree level in the electron-electron scattering and the unpolarized cross section is calculated up to second order in the Lorentz-violating parameter. (orig.)
Mason, Tyler B; Lewis, Robin J
2015-08-01
The dual pathway model is a widely accepted model of binge eating that focuses on the role of sociocultural factors, negative affect, and dietary restraint. However, less is known about demographic (e.g., gender and ethnicity) differences in the model and the role of other variables in the model. To further our understanding of the dual pathway model of binge eating, the current study examined the role of demographics (i.e., gender, race, BMI, parental education and obesity), impulsivity, and food-related cognitions in the dual pathway model. A sample of college students completed a battery of measures. Multi-group structural equation modeling was used to evaluate the dual pathway model separately for men and women. Results supported the dual pathway model of binge eating among men and women, and also supported food-related cognitions as an important variable prior to binge eating. In other words, body shame was associated with more dietary restraint and negative affect, and in turn, dietary restraint and negative affect were associated with increased negative food-related cognitions. Then, food-related cognitions predicted binge eating. Additionally impulsivity was related to body shame, negative affect, and food-related cognitions, but was unrelated to binge eating after controlling for the other variables. Racial differences existed among women in BMI and body shame, but there were no racial differences among men. Our results suggest that the dual pathway model adequately explains binge eating among men and women, but that food-related cognitions may be an imporant anteceden to binge eating. Copyright © 2015 Elsevier Ltd. All rights reserved.
Dual Band Parasitic Element Patch Antenna for LTE/WLAN Applications
Directory of Open Access Journals (Sweden)
BAG Biplab
2017-05-01
Full Text Available In this paper, a single layer coaxial fed dual band slotted microstrip antenna is proposed. The proposed antenna consists of two direct couple parasitic elements and L-shape slots on the main resonating element. Two resonant modes are excited and it covers 4G LTE and WLAN middle band. The -10dB impedance bandwidth for resonant frequency of 2.35GHz and 5.28GHz are 140MHz (2.25-2.39GHz and 570MHz (5.18-5.75GHz, respectively. The measured VSWR at 2.35GHz is 1.27 and at 5.28GHz is 1.41. The proposed antenna is simple in design and compact in size. The simulated and measured results are in good agreement.
Energy Technology Data Exchange (ETDEWEB)
Mori, Hiroaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Cardiology, Kainan Hospital, Yatomi (Japan); Isobe, Satoshi, E-mail: sisobe@med.nagoya-u.ac.jp [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Sakai, Shinichi [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Yamada, Takashi [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Watanabe, Naoki; Miura, Manabu [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Uchida, Yasuhiro; Kanashiro, Masaaki; Ichimiya, Satoshi [Department of Cardiology, Yokkaichi Municipal Hospital, Yokkaichi (Japan); Okumura, Takahiro; Murohara, Toyoaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan)
2015-08-15
Highlights: • The percentage infarct size (%IS) was significantly greater in the microvascular obstruction (MO) group than in the non-MO group. • The percentage mismatch score (%MMS) on dual scintigraphy significantly correlated with the %IS and the percentage MO. • The %MMS was significantly greater in the non-MO group than in the MO group, and was an independent predictor for MO. - Abstract: Background: The hypo-enhanced regions within the hyper-enhanced infarct areas detected by cardiac magnetic resonance (CMR) imaging reflect microvascular obstruction (MO) after acute myocardial infarction (AMI). The combined myocardial thallium-201 ({sup 201}Tl)/iodine-123-15-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ({sup 123}I-BMIPP) dual single-photon emission computed tomography (SPECT) is a useful tool for detecting myocardial reversibility after AMI. We evaluated whether MO could be an early predictor of irreversible myocardial damage in comparison with {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings in AMI patients. Methods: Sixty-two patients with initial AMI who successfully underwent coronary revascularization were enrolled. MO was defined by CMR imaging. Patients were divided into 2 groups as follows: MO group (n = 32) and non-MO group (n = 30). Scintigraphic defect scores were calculated using a 17-segment model with a 5-point scoring system. The mismatch score (MMS) was calculated as follows: the total sum of (Σ) {sup 123}I-BMIPP defect score minus Σ{sup 201}Tl defect score. The percentage mismatch score (%MMS) was calculated as follows: MMS/(Σ{sup 123}I-BMIPP score) × 100 (%). Results: The percentage infarct size (%IS) was significantly greater in the MO group than in the non-MO group (32.2 ± 13.8% vs. 18.3 ± 12.1%, p < 0.001). The %MMS significantly correlated with the %IS and the percentage MO (r = −0.26, p = 0.03; r = −0.45, p < 0.001, respectively). The %MMS was significantly greater in the non-MO group than in the MO group (45.4
Dual-process models of health-related behaviour and cognition: a review of theory.
Houlihan, S
2018-03-01
The aim of this review was to synthesise a spectrum of theories incorporating dual-process models of health-related behaviour. Review of theory, adapted loosely from Cochrane-style systematic review methodology. Inclusion criteria were specified to identify all relevant dual-process models that explain decision-making in the context of decisions made about human health. Data analysis took the form of iterative template analysis (adapted from the conceptual synthesis framework used in other reviews of theory), and in this way theories were synthesised on the basis of shared theoretical constructs and causal pathways. Analysis and synthesis proceeded in turn, instead of moving uni-directionally from analysis of individual theories to synthesis of multiple theories. Namely, the reviewer considered and reconsidered individual theories and theoretical components in generating the narrative synthesis' main findings. Drawing on systematic review methodology, 11 electronic databases were searched for relevant dual-process theories. After de-duplication, 12,198 records remained. Screening of title and abstract led to the exclusion of 12,036 records, after which 162 full-text records were assessed. Of those, 21 records were included in the review. Moving back and forth between analysis of individual theories and the synthesis of theories grouped on the basis of theme or focus yielded additional insights into the orientation of a theory to an individual. Theories could be grouped in part on their treatment of an individual as an irrational actor, as social actor, as actor in a physical environment or as a self-regulated actor. Synthesising identified theories into a general dual-process model of health-related behaviour indicated that such behaviour is the result of both propositional and unconscious reasoning driven by an individual's response to internal cues (such as heuristics, attitude and affect), physical cues (social and physical environmental stimuli) as well as
International Nuclear Information System (INIS)
Wei, Zhongbao; Zhao, Jiyun; Ji, Dongxu; Tseng, King Jet
2017-01-01
Highlights: •SOC and capacity are dually estimated with online adapted battery model. •Model identification and state dual estimate are fully decoupled. •Multiple timescales are used to improve estimation accuracy and stability. •The proposed method is verified with lab-scale experiments. •The proposed method is applicable to different battery chemistries. -- Abstract: Reliable online estimation of state of charge (SOC) and capacity is critically important for the battery management system (BMS). This paper presents a multi-timescale method for dual estimation of SOC and capacity with an online identified battery model. The model parameter estimator and the dual estimator are fully decoupled and executed with different timescales to improve the model accuracy and stability. Specifically, the model parameters are online adapted with the vector-type recursive least squares (VRLS) to address the different variation rates of them. Based on the online adapted battery model, the Kalman filter (KF)-based SOC estimator and RLS-based capacity estimator are formulated and integrated in the form of dual estimation. Experimental results suggest that the proposed method estimates the model parameters, SOC, and capacity in real time with fast convergence and high accuracy. Experiments on both lithium-ion battery and vanadium redox flow battery (VRB) verify the generality of the proposed method on multiple battery chemistries. The proposed method is also compared with other existing methods on the computational cost to reveal its superiority for practical application.
Nonscaling parametrization of hadronic spectra and dual parton model
International Nuclear Information System (INIS)
Gaponenko, O.N.
2001-01-01
Using the popular Wdowczyk-Wolfendale parametrization (WW-parametrization) as an example one studies restrictions imposed by a dual parton model for different nonscaling parametrizations of the pulsed hadron spectra in soft hadron-hadron and hadron-nuclear interactions. One derived a new parametrization free from basic drawback of the WW-formulae. In the central range the determined parametrization show agreement with the Wdowczyk-Wolfendale formula, but in contrast to the last-named one it does not result in contradiction with the experiment due to fast reduction of inelastic factor reduction with energy increase [ru
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 10. What Can the Answer be? Reciprocal Basis and Dual Vectors. V Balakrishnan. Series Article Volume 1 Issue 10 October 1996 pp 6-13. Fulltext. Click here to view fulltext PDF. Permanent link:
Design, Fabrication, and Modeling of a Novel Dual-Axis Control Input PZT Gyroscope
Directory of Open Access Journals (Sweden)
Cheng-Yang Chang
2017-10-01
Full Text Available Conventional gyroscopes are equipped with a single-axis control input, limiting their performance. Although researchers have proposed control algorithms with dual-axis control inputs to improve gyroscope performance, most have verified the control algorithms through numerical simulations because they lacked practical devices with dual-axis control inputs. The aim of this study was to design a piezoelectric gyroscope equipped with a dual-axis control input so that researchers may experimentally verify those control algorithms in future. Designing a piezoelectric gyroscope with a dual-axis control input is more difficult than designing a conventional gyroscope because the control input must be effective over a broad frequency range to compensate for imperfections, and the multiple mode shapes in flexural deformations complicate the relation between flexural deformation and the proof mass position. This study solved these problems by using a lead zirconate titanate (PZT material, introducing additional electrodes for shielding, developing an optimal electrode pattern, and performing calibrations of undesired couplings. The results indicated that the fabricated device could be operated at 5.5±1 kHz to perform dual-axis actuations and position measurements. The calibration of the fabricated device was completed by system identifications of a new dynamic model including gyroscopic motions, electromechanical coupling, mechanical coupling, electrostatic coupling, and capacitive output impedance. Finally, without the assistance of control algorithms, the “open loop sensitivity” of the fabricated gyroscope was 1.82 μV/deg/s with a nonlinearity of 9.5% full-scale output. This sensitivity is comparable with those of other PZT gyroscopes with single-axis control inputs.
Design, Fabrication, and Modeling of a Novel Dual-Axis Control Input PZT Gyroscope.
Chang, Cheng-Yang; Chen, Tsung-Lin
2017-10-31
Conventional gyroscopes are equipped with a single-axis control input, limiting their performance. Although researchers have proposed control algorithms with dual-axis control inputs to improve gyroscope performance, most have verified the control algorithms through numerical simulations because they lacked practical devices with dual-axis control inputs. The aim of this study was to design a piezoelectric gyroscope equipped with a dual-axis control input so that researchers may experimentally verify those control algorithms in future. Designing a piezoelectric gyroscope with a dual-axis control input is more difficult than designing a conventional gyroscope because the control input must be effective over a broad frequency range to compensate for imperfections, and the multiple mode shapes in flexural deformations complicate the relation between flexural deformation and the proof mass position. This study solved these problems by using a lead zirconate titanate (PZT) material, introducing additional electrodes for shielding, developing an optimal electrode pattern, and performing calibrations of undesired couplings. The results indicated that the fabricated device could be operated at 5.5±1 kHz to perform dual-axis actuations and position measurements. The calibration of the fabricated device was completed by system identifications of a new dynamic model including gyroscopic motions, electromechanical coupling, mechanical coupling, electrostatic coupling, and capacitive output impedance. Finally, without the assistance of control algorithms, the "open loop sensitivity" of the fabricated gyroscope was 1.82 μV/deg/s with a nonlinearity of 9.5% full-scale output. This sensitivity is comparable with those of other PZT gyroscopes with single-axis control inputs.
Modelling of magneto-acoustic resonance in ferrite-piezoelectric bilayers
Energy Technology Data Exchange (ETDEWEB)
Bichurin, M I; Petrov, V M; Averkin, S V; Filippov, A V [Institute for Electronic Information Systems, Novgorod State University, Veliky Novgorod 173003 (Russian Federation); Liverts, E [Department of Physics, Ben-Gurion University of the Negev, Beersheva 84105 (Israel); Mandal, S; Srinivasan, G [Physics Department, Oakland University, Rochester, MI 48309 (United States)
2009-11-07
A model is discussed for magnetoelectric (ME) effects in a single-crystal ferrite-piezoelectric bilayer on a substrate. The specific focus is on coupling at magneto-acoustic resonance (MAR) at the coincidence of ferromagnetic resonance in the ferrite and thickness modes of the electromechanical resonance in the piezoelectric. The clamping effect of the substrate has been considered in determining the ME voltage coefficient and applied to a model system of a bilayer of lead zirconate titanate (PZT) and yttrium iron garnet (YIG) on a gadolinium gallium garnet substrate. The theory predicts a giant ME effect at MAR due to interaction and transfer of energy between elastic modes and the uniform precession spin-wave mode. It is shown that the ME coupling strength decreases with increasing substrate thickness. Estimates for YIG-PZT for nominal film parameters predict MAR at 5 GHz and ME coefficients on the order of 5-70 V cm{sup -1} Oe{sup -1}. The phenomenon is of importance for the realization of multifunctional ME sensors and transducers operating at microwave frequencies.
SMATASY. A Program for the model independent description of the Z resonance
International Nuclear Information System (INIS)
Kirsch, S.; Riemann, T.
1994-07-01
SMATASY is an interface for the ZF I T T ER package and may be used for the model independent description of the Z resonance at LEP 1 and SLC. It allows the determination of the Z mass and width and its resonance shape parameters r and j for cross-sections and their asymmetries. The r describes the peak height and j the interference of the Z resonance with photon exchange in each scattering channel and for σ T , σ FB , σ lr , σ pol etc. separately. Alternatively, the helicity amplitudes for a given scattering channel may be determined. We compare our formalism with other model independent approaches. The model independent treatment of QED corrections in SMATASY is applicable also far away from the Z peak. (orig.)
Shao, W.; Bogaard, T.A.; Su, Y.; Bakker, M.
2016-01-01
In this study, a 1D hydro-mechanical model was developed by coupling a dual-permeability model with an infinite slope stability approach to investigate the influence of preferential flow on pressure propagation and slope stability. The dual-permeability model used two modified Darcy-Richards
Dual-energy contrast-enhanced spectral mammography (CESM).
Daniaux, Martin; De Zordo, Tobias; Santner, Wolfram; Amort, Birgit; Koppelstätter, Florian; Jaschke, Werner; Dromain, Clarisse; Oberaigner, Willi; Hubalek, Michael; Marth, Christian
2015-10-01
Dual-energy contrast-enhanced mammography is one of the latest developments in breast care. Imaging with contrast agents in breast cancer was already known from previous magnetic resonance imaging and computed tomography studies. However, high costs, limited availability-or high radiation dose-led to the development of contrast-enhanced spectral mammography (CESM). We reviewed the current literature, present our experience, discuss the advantages and drawbacks of CESM and look at the future of this innovative technique.
A Continuous Dual-Process Model of Remember/Know Judgments
Wixted, John T.; Mickes, Laura
2010-01-01
The dual-process theory of recognition memory holds that recognition decisions can be based on recollection or familiarity, and the remember/know procedure is widely used to investigate those 2 processes. Dual-process theory in general and the remember/know procedure in particular have been challenged by an alternative strength-based…
The Dual-Factor Model of Mental Health: Further Study of the Determinants of Group Differences
Lyons, Michael D.; Huebner, E. Scott; Hills, Kimberly J.; Shinkareva, Svetlana V.
2012-01-01
Consistent with a positive psychology framework, this study examined the contributions of personality, environmental, and perceived social support variables in classifying adolescents using Greenspoon and Saklofske's Dual-Factor model of mental health. This model incorporates information about positive subjective well-being (SWB), along with…
Quark-parton model from dual topological unitarization
International Nuclear Information System (INIS)
Cohen-Tannoudji, G.; El Hassouni, A.; Kalinowski, J.; Peschanski, R.
1979-01-01
Topology, which occurs in the topological expansion of quantum chromodynamics (QCD) and in the dual topological unitarization (DTU) schemes, allows us to establish a quantitative correspondence between QCD and the dual S-matrix approaches. This topological correspondence, proposed by Veneziano and made more explicit in a recent paper for current-induced reactions, provides a clarifying and unifying quark-parton interpretation of soft inclusive processes. Precise predictions for inclusive cross sections in hadron-hadron collisions, structure functions of hadrons, and quark fragmentation functions including absolute normalizations are shown to agree with data. On a more theoretical ground the proposed scheme suggests a new approach to the confinement problem
Dual symmetry in gauge theories
International Nuclear Information System (INIS)
Koshkarov, A.L.
1997-01-01
Continuous dual symmetry in electrodynamics, Yang-Mills theory and gravitation is investigated. Dual invariant which leads to badly nonlinear motion equations is chosen as a Lagrangian of the pure classical dual nonlinear electrodynamics. In a natural manner some dual angle which is determined by the electromagnetic strengths at the point of the time-space appears in the model. Motion equations may well be interpreted as the equations of the standard Maxwell theory with source. Alternative interpretation is the quasi-Maxwell linear theory with magnetic charge. Analogous approach is possible in the Yang-Mills theory. In this case the dual-invariant non-Abelian theory motion equations possess the same instanton solutions as the conventional Yang-Mills equations have. An Abelian two-parameter dual group is found to exist in gravitation. Irreducible representations have been obtained: the curvature tensor was expanded into the sum of twice anti-self-dual and self-dual parts. Gravitational instantons are defined as (real )solutions to the usual duality equations. Central symmetry solutions to these equations are obtained. The twice anti-self-dual part of the curvature tensor may be used for introduction of new gravitational equations generalizing Einstein''s equations. However, the theory obtained reduces to the conformal-flat Nordstroem theory
International Nuclear Information System (INIS)
Wang Chi; Zhou Yu-Qiu; Shen Gao-Wei; Wu Wen-Wen; Ding Wei
2013-01-01
The method of numerical analysis is employed to study the resonance mechanism of the lumped parameter system model for acoustic mine detection. Based on the basic principle of the acoustic resonance technique for mine detection and the characteristics of low-frequency acoustics, the ''soil-mine'' system could be equivalent to a damping ''mass-spring'' resonance model with a lumped parameter analysis method. The dynamic simulation software, Adams, is adopted to analyze the lumped parameter system model numerically. The simulated resonance frequency and anti-resonance frequency are 151 Hz and 512 Hz respectively, basically in agreement with the published resonance frequency of 155 Hz and anti-resonance frequency of 513 Hz, which were measured in the experiment. Therefore, the technique of numerical simulation is validated to have the potential for analyzing the acoustic mine detection model quantitatively. The influences of the soil and mine parameters on the resonance characteristics of the soil—mine system could be investigated by changing the parameter setup in a flexible manner. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Topics in dual models and extended solutions
International Nuclear Information System (INIS)
Roth, R.S.
1977-01-01
Two main topics are explored. The first deals with the infinities arising from the one loop planar string diagram of the standard dual model. It is shown that for the number of dimensions d = 25 or 26, these infinities lead to a renormalization of the slope of the Regge trajectories, in addition to a renormalization of the coupling constant. The second topic deals with the propagator for a confined particle (monopole) in a field theory. When summed to all orders, this propagator is altogether free of singularities in the finite momentum plane, and an attempt is made to illustrate this. The Bethe-Salpeter equation is examined and it is shown that ladder diagrams are not sufficient to obtain this result. However, in a nonrelativistic approximation confinement is obtained and all poles disappear
Hu, M; Sheng, J; Kang, Z; Zou, L; Guo, J; Sun, P
2014-08-01
The aim of this study was to examine the relation between bone marrow adipose tissue (BMAT) and bone mineral density (BMD) of lumbar spine in male professional wrestlers and healthy untrained men. A total of 14 wrestlers (22.9±3.4 years) and 11 controls (24.4±1.6 years) were studied cross-sectionally. Body composition and BMD were measured by dual-energy X-ray absorptiometry. Magnetic resonance imaging of the lumbar spine was examined in a sagittal T1-weighted (T1-w) spin-echo (SE) sequence. The averaged bone marrow signal intensity (SI) of L2-L4 was related to the signal of an adjacent nondegenerative disk. Mean SI of T1-w SE in wrestlers was lower than controls (P=0.001), indicating L2-L4 BMAT in wrestlers was lower compared to controls. L2-L4 BMD in wrestlers was higher than controls (PBMAT and BMD was confirmed in this relatively small subject sample with narrow age range, which implies that exercise training is an important determinant of this association.
Mathematical Modeling of Dual Intake Transparent Transpired Solar Collector
Directory of Open Access Journals (Sweden)
Thomas Semenou
2015-01-01
Full Text Available Nowadays, in several types of commercial or institutional buildings, a significant rise of transpired solar collectors used to preheat the fresh air of the building can be observed. Nevertheless, when the air mass flow rate is low, the collector efficiency collapses and a large amount of energy remains unused. This paper presents a simple yet effective mathematical model of a transparent transpired solar collector (TTC with dual intake in order to remove stagnation problems in the plenum and ensure a better thermal efficiency and more heat recovery. A thermal model and a pressure loss model were developed. Then, the combined model was validated with experimental data from the Solar Rating and Certification Corporation (SRCC. The results show that the collector efficiency can be up to 70% and even 80% regardless of operating conditions. The temperature gain is able to reach 20°K when the solar irradiation is high.
Dual-anticipating, dual and dual-lag synchronization in modulated time-delayed systems
International Nuclear Information System (INIS)
Ghosh, Dibakar; Chowdhury, A. Roy
2010-01-01
In this Letter, dual synchronization in modulated time delay system using delay feedback controller is proposed. Based on Lyapunov stability theory, we suggest a general method to achieve the dual-anticipating, dual, dual-lag synchronization of time-delayed chaotic systems and we find both its existing and sufficient stability conditions. Numerically it is shown that the dual synchronization is also possible when driving system contain two completely different systems. Effect of parameter mismatch on dual synchronization is also discussed. As an example, numerical simulations for the Mackey-Glass and Ikeda systems are conducted, which is in good agreement with the theoretical analysis.
Motivation and justification: a dual-process model of culture in action.
Vaisey, Stephen
2009-05-01
This article presents a new model of culture in action. Although most sociologists who study culture emphasize its role in post hoc sense making, sociologists of religion and social psychologists tend to focus on the role beliefs play in motivation. The dual-process model integrates justificatory and motivational approaches by distinguishing between "discursive" and "practical" modes of culture and cognition. The author uses panel data from the National Study of Youth and Religion to illustrate the model's usefulness. Consistent with its predictions, he finds that though respondents cannot articulate clear principles of moral judgment, their choice from a list of moral-cultural scripts strongly predicts later behavior.
Dual Career Faculty Appointments: A Successful Model from ADVANCE-Nebraska
Holmes, M.; Advance-Nebraska Evaluation Team
2011-12-01
votes the candidate up or down. The third component provides a variety of faculty positions, including part-time tenure-track, post-doctoral, research professor, and professor of practice positions. Professors of practice are primarily teaching positions with three to five-year renewable contracts. The fourth component, funding, is aided by the NSF ADVANCE cooperative agreement providing one-fourth of the partner's salary for up to three years of the partner's appointment. This gives enough time for the administration to find permanent funding through faculty retirements, departures, or new funding streams. At UNL, department chairs have been exemplary in promoting the necessary cooperative spirit for the program to succeed. This model can be replicated at other institutions. Dual career couples are here to stay, and institutions that see them as great opportunities will win the lottery for the best talent available.
Dual education and industrial cooperation in electrical engineering
Váradiné Szarka, A.
2016-11-01
Dual education in higher education is a new system in Hungary introduced by Mercedes Benz with cooperation of Kecskemet College. In the new system companies support certain number of students and provide them strong practical education in their field. Students applying successfully for dual education study together with non-dual students at the university, so they go through the same university courses as their non-dual colleagues, but while non-dual students’ academic year includes 2×14 weeks active semester and 2×6 weeks exam session, all over 40 weeks, dual students have 48 working weeks including study at the university and practicing at the company. The main question of the success which one is the most effective model to be applied. This paper summarises 2 models of dual education with their advantages and disadvantages and also it presents practical realization at the University of Debrecen with special attention to measurement and instrumentation. Dual education in BSc level electrical engineering course cooperates with 6 multinational companies of the region in four specialization. Dual education also has great impact to the modernisation of engineering education. Detailed study of dual education in field of instrumentation and measurement is provided in the paper.
Neutron strength functions: the link between resolved resonances and the optical model
International Nuclear Information System (INIS)
Moldauer, P.A.
1980-01-01
Neutron strength functions and scattering radii are useful as energy and channel radius independent parameters that characterize neutron scattering resonances and provide a connection between R-matrix resonance analysis and the optical model. The choice of R-matrix channel radii is discussed, as are limitations on the accuracies of strength functions. New definitions of the p-wave strength function and scattering radius are proposed. For light nuclei, where strength functions display optical model energy variations over the resolved resonances, a doubly reduced partial neutron width is introduced for more meaningful statistical analyses of widths. The systematic behavior of strength functions and scattering radii is discussed
Vector and axial-vector resonances in composite models of the Higgs boson
Energy Technology Data Exchange (ETDEWEB)
Franzosi, Diogo Buarque [II. Physikalisches Institut, Universität Göttingen,Friedrich-Hund-Platz 1, 37077 Göttingen (Germany); Cacciapaglia, Giacomo; Cai, Haiying; Deandrea, Aldo [Univ Lyon, Université Lyon 1, CNRS/IN2P3, IPNL,F-69622, Villeurbanne (France); Frandsen, Mads [CP-Origins & Danish Institute for Advanced Study DIAS, University of Southern Denmark,Campusvej 55, DK-5230 Odense M (Denmark)
2016-11-11
We provide a non-linear realisation of composite Higgs models in the context of the SU(4)/Sp(4) symmetry breaking pattern, where the effective Lagrangian of the spin-0 and spin-1 resonances is constructed via the CCWZ prescription using the Hidden Symmetry formalism. We investigate the EWPT constraints by accounting the effects from reduced Higgs couplings and integrating out heavy spin-1 resonances. This theory emerges from an underlying theory of gauge interactions with fermions, thus first principle lattice results predict the massive spectrum in composite Higgs models. This model can be used as a template for the phenomenology of composite Higgs models at the LHC and at future 100 TeV colliders, as well as for other application. In this work, we focus on the formalism for spin-1 resonances and their bounds from di-lepton and di-boson searches at the LHC.
On a relation between massive Yang-Mills theories and dual string models
International Nuclear Information System (INIS)
Mickelsson, J.
1983-01-01
The relations between mass terms in Yang-Mills theories, projective representations of the group of gauge transformations, boundary conditions on vector potentials and Schwinger terms in local charge algebra commutation relations are discussed. The commutation relations (with Schwinger terms) are similar to the current algebra commutation relations of the SU(N) extended dual string model. (orig.)
Simulation and experimental validation of the dynamical model of a dual-rotor vibrotactor
Miklós, Á.; Szabó, Z.
2015-01-01
In this work, a novel design for small vibrotactors called the Dual Excenter is presented, which makes it possible to produce vibrations with independently adjustable frequency and amplitude. This feature has been realized using two coaxially aligned eccentric rotors, which are driven by DC motors independently. The prototype of the device has been built, where mechanical components are integrated on a frame with two optical sensors for the measurement of angular velocity and phase angle. The system is equipped with a digital controller. Simulations confirm the results of analytical investigations and they allow us to model the sampling method of the signals of the angular velocity and the phase angle between the rotors. Furthermore, we model the discrete behavior of the controller, which is a PI controller for the angular velocities and a PID controller for the phase angle. Finally, simulation results are compared to experimental ones, which show that the Dual Excenter concept is feasible.
Energy Technology Data Exchange (ETDEWEB)
Choi, Myungseok; Olshevskiy, Alexander; Kim, Chang-Wan [Konkuk University, Seoul (Korea, Republic of); Eom, Kilho [Sungkyunkwan University, Suwon (Korea, Republic of); Gwak, Kwanwoong [Sejong University, Seoul (Korea, Republic of); Dai, Mai Duc [Ho Chi Minh City University of Technology and Education, Ho Chi Minh (Viet Nam)
2017-05-15
Carbon nanotube (CNT) has recently received much attention due to its excellent electromechanical properties, indicating that CNT can be employed for development of Nanoelectromechanical system (NEMS) such as nanomechanical resonators. For effective design of CNT-based resonators, it is required to accurately predict the vibration behavior of CNT resonators as well as their frequency response to mass adsorption. In this work, we have studied the vibrational behavior of Multi-walled CNT (MWCNT) resonators by using a continuum mechanics modeling that was implemented in Finite element method (FEM). In particular, we consider a transversely isotropic hollow cylinder solid model with Finite element (FE) implementation for modeling the vibration behavior of Multi-walled CNT (MWCNT) resonators. It is shown that our continuum mechanics model provides the resonant frequencies of various MWCNTs being comparable to those obtained from experiments. Moreover, we have investigated the frequency response of MWCNT resonators to mass adsorption by using our continuum model with FE implementation. Our study sheds light on our continuum mechanics model that is useful in predicting not only the vibration behavior of MWCNT resonators but also their sensing performance for further effective design of MWCNT- based NEMS devices.
Femtosecond optical parametric oscillators toward real-time dual-comb spectroscopy
Jin, Yuwei; Cristescu, Simona M.; Harren, Frans J. M.; Mandon, Julien
2015-04-01
We demonstrate mid-infrared dual-comb spectroscopy with an optical parametric oscillator (OPO) toward real-time field measurement. A singly resonant OPO based on a MgO-doped periodically poled lithium niobate (PPLN) crystal is demonstrated. Chirped mirrors are used to compensate the dispersion caused by the optical cavity and the crystal. A low threshold of 17 mW has been achieved. The OPO source generates a tunable idler frequency comb between 2.7 and 4.7 μm. Dual-comb spectroscopy is achieved by coupling two identical Yb-fiber mode-locked lasers to this OPO with slightly different repetition frequencies. A measured absorption spectrum of methane is presented with a spectral bandwidth of , giving an instrumental resolution of . In addition, a second OPO containing two MgO-doped PPLN crystals in a singly resonant ring cavity is demonstrated. As such, this OPO generates two idler combs (average power up to 220 mW), covering a wavelength range between 2.7 and 4.2 μm, from which a mid-infrared dual-comb Fourier transform spectrometer is constructed. By detecting the heterodyned signal between the two idler combs, broadband spectra of molecular gases can be observed over a spectral bandwidth of more than . This special cavity design allows the spectral resolution to be improved to without locking the OPO cavity, indicating that this OPO represents an ideal high-power broadband mid-infrared source for real-time gas sensing.
Relativistic strings and dual models of strong interactions
International Nuclear Information System (INIS)
Marinov, M.S.
1977-01-01
The theory of strong interactions,based on the model depicting a hardon as a one-dimentional elastic relativistic system(''string'') is considered. The relationship between this model and the concepts of quarks and partons is discussed. Presented are the principal results relating to the Veneziano dual theory, which may be considered as the consequence of the string model, and to its modifications. The classical string theory is described in detail. Attention is focused on questions of importance to the construction of the quantum theory - the Hamilton mechanisms and conformal symmetry. Quantization is described, and it is shown that it is not contradictory only in the 26-dimentional space and with a special requirement imposed on the spectrum of states. The theory of a string with a distributed spin is considered. The spin is introduced with the aid of the Grassman algebra formalism. In this case quantization is possible only in the 10-dimentional space. The strings interact by their ruptures and gluings. A method for calculating the interaction amplitudes is indicated
Dual energy CT at the synchrotron: A piglet model for neurovascular research
International Nuclear Information System (INIS)
Schueltke, Elisabeth; Kelly, Michael E.; Nemoz, Christian; Fiedler, Stefan; Ogieglo, Lissa; Crawford, Paul; Paterson, Jessica; Beavis, Cole; Esteve, Francois; Brochard, Thierry; Renier, Michel; Requardt, Herwig; Dallery, Dominique; Le Duc, Geraldine; Meguro, Kotoo
2011-01-01
Background: Although the quality of imaging techniques available for neurovascular angiography in the hospital environment has significantly improved over the last decades, the equipment used for clinical work is not always suited for neurovascular research in animal models. We have previously investigated the suitability of synchrotron-based K-edge digital subtraction angiography (KEDSA) after intravenous injection of iodinated contrast agent for neurovascular angiography in radiography mode in both rabbit and pig models. We now have used the KEDSA technique for the acquisition of three-dimensional images and dual energy CT. Materials and methods: All experiments were conducted at the biomedical beamline ID 17 of the European Synchrotron Radiation Facility (ESRF). A solid state germanium (Ge) detector was used for the acquisition of image pairs at 33.0 and 33.3 keV. Three-dimensional images were reconstructed from an image series containing 60 single images taken throughout a full rotation of 360 o . CT images were reconstructed from two half-acquisitions with 720 projections each. Results: The small detector field of view was a limiting factor in our experiments. Nevertheless, we were able to show that dual energy CT using the KEDSA technique available at ID 17 is suitable for neurovascular research in animal models.
Dual energy CT at the synchrotron: a piglet model for neurovascular research.
Schültke, Elisabeth; Kelly, Michael E; Nemoz, Christian; Fiedler, Stefan; Ogieglo, Lissa; Crawford, Paul; Paterson, Jessica; Beavis, Cole; Esteve, Francois; Brochard, Thierry; Renier, Michel; Requardt, Herwig; Dallery, Dominique; Le Duc, Geraldine; Meguro, Kotoo
2011-08-01
Although the quality of imaging techniques available for neurovascular angiography in the hospital environment has significantly improved over the last decades, the equipment used for clinical work is not always suited for neurovascular research in animal models. We have previously investigated the suitability of synchrotron-based K-edge digital subtraction angiography (KEDSA) after intravenous injection of iodinated contrast agent for neurovascular angiography in radiography mode in both rabbit and pig models. We now have used the KEDSA technique for the acquisition of three-dimensional images and dual energy CT. All experiments were conducted at the biomedical beamline ID 17 of the European Synchrotron Radiation Facility (ESRF). A solid state germanium (Ge) detector was used for the acquisition of image pairs at 33.0 and 33.3 keV. Three-dimensional images were reconstructed from an image series containing 60 single images taken throughout a full rotation of 360°. CT images were reconstructed from two half-acquisitions with 720 projections each. The small detector field of view was a limiting factor in our experiments. Nevertheless, we were able to show that dual energy CT using the KEDSA technique available at ID 17 is suitable for neurovascular research in animal models. Copyright © 2010. Published by Elsevier Ireland Ltd.
Karimova, A. E.; Amanova, A. S.; Sadykova, A. M.; Kuzembaev, N. E.; Makisheva, A. T.; Kurmangazina, G. Zh.; Sakenov, Janat
2016-01-01
The article explores the significant problem of developing a theoretical model of professional competence development in dual-specialty students (on the example of the "History, Religious studies" specialty). In order to validate the specifics of the professional competence development in dual-specialty students (on the example of the…
DEFF Research Database (Denmark)
Sokoler, Leo Emil; Frison, Gianluca; Skajaa, Anders
2015-01-01
We develop an efficient homogeneous and self-dual interior-point method (IPM) for the linear programs arising in economic model predictive control of constrained linear systems with linear objective functions. The algorithm is based on a Riccati iteration procedure, which is adapted to the linear...... system of equations solved in homogeneous and self-dual IPMs. Fast convergence is further achieved using a warm-start strategy. We implement the algorithm in MATLAB and C. Its performance is tested using a conceptual power management case study. Closed loop simulations show that 1) the proposed algorithm...
Conical Refraction: new observations and a dual cone model.
Sokolovskii, G S; Carnegie, D J; Kalkandjiev, T K; Rafailov, E U
2013-05-06
We propose a paraxial dual-cone model of conical refraction involving the interference of two cones of light behind the exit face of the crystal. The supporting experiment is based on beam selecting elements breaking down the conically refracted beam into two separate hollow cones which are symmetrical with one another. The shape of these cones of light is a product of a 'competition' between the divergence caused by the conical refraction and the convergence due to the focusing by the lens. The developed mathematical description of the conical refraction demonstrates an excellent agreement with experiment.
International Nuclear Information System (INIS)
Kubaska, Samantha; Sahani, Dushyant V.; Saini, Sanjay; Hahn, Peter F.; Halpern, Elkan
2001-01-01
AIM: Iron oxide contrast agents are useful for lesion detection, and extracellular gadolinium chelates are advocated for lesion characterization. We undertook a study to determine if dual contrast enhanced liver imaging with sequential use of ferumoxides particles and gadolinium (Gd)-DTPA can be performed in the same imaging protocol. MATERIALS AND METHODS: Sixteen patients underwent dual contrast magnetic resonance imaging (MRI) of the liver for evaluation of known/suspected focal lesions which included, metastases (n = 5), hepatocellular carcinoma (HCC;n = 3), cholangiocharcinoma(n = 1) and focal nodular hyperplasia (FNH;n = 3). Pre- and post-iron oxide T1-weighted gradient recalled echo (GRE) and T2-weighted fast spin echo (FSE) sequences were obtained, followed by post-Gd-DTPA (0.1 mmol/kg) multi-phase dynamic T1-weighted out-of-phase GRE imaging. Images were analysed in a blinded fashion by three experts using a three-point scoring system for lesion conspicuity on pre- and post-iron oxide T1 images as well as for reader's confidence in characterizing liver lesions on post Gd-DTPA T1 images. RESULTS: No statistically significant difference in lesion conspicuity was observed on pre- and post-iron oxide T1-GRE images in this small study cohort. The presence of iron oxide did not appreciably diminish image quality of post-gadolinium sequences and did not prevent characterization of liver lesions. CONCLUSION: Our results suggest that characterization of focal liver lesion with Gd-enhanced liver MRI is still possible following iron oxide enhanced imaging. Kubaska, S. et al. (2001)
Hu, Hua; Vervaeke, Koen; Graham, Lyle J; Storm, Johan F
2009-11-18
Synaptic input to a neuron may undergo various filtering steps, both locally and during transmission to the soma. Using simultaneous whole-cell recordings from soma and apical dendrites from rat CA1 hippocampal pyramidal cells, and biophysically detailed modeling, we found two complementary resonance (bandpass) filters of subthreshold voltage signals. Both filters favor signals in the theta (3-12 Hz) frequency range, but have opposite location, direction, and voltage dependencies: (1) dendritic H-resonance, caused by h/HCN-channels, filters signals propagating from soma to dendrite when the membrane potential is close to rest; and (2) somatic M-resonance, caused by M/Kv7/KCNQ and persistent Na(+) (NaP) channels, filters signals propagating from dendrite to soma when the membrane potential approaches spike threshold. Hippocampal pyramidal cells participate in theta network oscillations during behavior, and we suggest that that these dual, polarized theta resonance mechanisms may convey voltage-dependent tuning of theta-mediated neural coding in the entorhinal/hippocampal system during locomotion, spatial navigation, memory, and sleep.
Non-monotonic resonance in a spatially forced Lengyel-Epstein model
Energy Technology Data Exchange (ETDEWEB)
Haim, Lev [Physics Department, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel); Department of Oncology, Soroka University Medical Center, Beer-Sheva 84101 (Israel); Hagberg, Aric [Center for Nonlinear Studies, Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Meron, Ehud [Physics Department, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel); Department of Solar Energy and Environmental Physics, BIDR, Ben-Gurion University of the Negev, Sede Boqer Campus, Midreshet Ben-Gurion 84990 (Israel)
2015-06-15
We study resonant spatially periodic solutions of the Lengyel-Epstein model modified to describe the chlorine dioxide-iodine-malonic acid reaction under spatially periodic illumination. Using multiple-scale analysis and numerical simulations, we obtain the stability ranges of 2:1 resonant solutions, i.e., solutions with wavenumbers that are exactly half of the forcing wavenumber. We show that the width of resonant wavenumber response is a non-monotonic function of the forcing strength, and diminishes to zero at sufficiently strong forcing. We further show that strong forcing may result in a π/2 phase shift of the resonant solutions, and argue that the nonequilibrium Ising-Bloch front bifurcation can be reversed. We attribute these behaviors to an inherent property of forcing by periodic illumination, namely, the increase of the mean spatial illumination as the forcing amplitude is increased.
Hewes, Dean E.
2009-01-01
The purpose of the author's contribution to this colloquy was to spark conversation on the theoretical nature of communication processes and the evidentiary requirements for testing their relationship to group outcomes. Co-discussants have raised important issues concerning the philosophical basis of the socioegocentric model (SM) and dual-level…
Raso , L.; Malaterre , P.O.; Bader , J.C.
2017-01-01
International audience; This article presents an innovative streamflow process model for use in reservoir operational rule design in stochastic dual dynamic programming (SDDP). Model features, which can be applied independently, are (1) a multiplicative process model for the forward phase and its linearized version for the backward phase; and (2) a nonuniform time-step length that is inversely proportional to seasonal variability. The advantages are (1) guaranteeing positive streamflow values...
Maraldo, Toni M; Zhou, Wanni; Dowling, Jessica; Vander Wal, Jillon S
2016-12-01
The dual pathway model, a theoretical model of eating disorder development, suggests that thin ideal internalization leads to body dissatisfaction which leads to disordered eating via the dual pathways of negative affect and dietary restraint. While the dual pathway model has been a valuable guide for eating disorder prevention, greater knowledge of characteristics that predict thin ideal internalization is needed. The present study replicated and extended the dual pathway model by considering the addition of fear of negative evaluation, suggestibility, rumination, and self-compassion in a sample of community women and female university students. Results showed that fear of negative evaluation and suggestibility predicted thin ideal internalization whereas rumination and self-compassion (inversely) predicted body dissatisfaction. Negative affect was predicted by fear of negative evaluation, rumination, and self-compassion (inversely). The extended model fit the data well in both samples. Analogue and longitudinal study of these constructs is warranted in future research. Copyright © 2016 Elsevier Ltd. All rights reserved.
THE REDUCTION OF VIBRATIONS IN A CAR – THE PRINCIPLE OF PNEUMATIC DUAL MASS FLYWHEEL
Directory of Open Access Journals (Sweden)
Robert GREGA
2014-09-01
Full Text Available The dual-mass flywheel replaces the classic flywheel in such way that it is divided into two masses (the primary mass and the secondary mass, which are jointed together by means of a flexible interconnection. This kind of the flywheel solution enables to change resonance areas of the engine with regard to the engine dynamic behaviour what leads to a reduction of vibrations consequently. However, there is also a disadvantage of the dualmass flywheels. The disadvantage is its short-time durability. There was projected a new type of the dual-mass flywheel in the framework of our workplace in order to eliminate disadvantages of the present dual-mass flywheels, i.e. we projected the pneumatic dual-mass flywheel, taking into consideration our experiences obtained during investigation of vibrations.
Bridge, Pascale; Pocock, Nicholas A; Nguyen, Tuan; Munns, Craig; Cowell, Christopher T; Thompson, Martin W
2009-09-01
Body composition studies in children have great potential to help understand the aetiology and evolution of acute and chronic. diseases. To validate appendicular lean soft tissue mass (LSTM) and fat mass (FM) measured using dual energy X-ray absorptiometry (DXA), with magnetic resonance imaging (MRI) as the reference standard, in healthy peri-pubertal adolescents. Peri-pubertal Caucasian children (n = 74) aged 11-14 years were evaluated. DXA LSTM and FM of the mid third femur were measured and skeletal muscle mass (SM) and FM of the same region were measured on the same day by MRI. There was a strong correlation between MRI SM and DXA LSTM (r2 = 0.98, index of concordance [C] = 0.91). DXA estimation of LSTM exceeded MRI SM by a mean of 189 g, from 6-371 g (p LSTM measurement in children, confirming its potential in clinical and research roles in paediatric diseases affecting and related to body composition.
Heffernan, Julieanne; Biedermann, Eric; Mayes, Alexander; Livings, Richard; Jauriqui, Leanne; Goodlet, Brent; Aldrin, John C.; Mazdiyasni, Siamack
2018-04-01
Process Compensated Resonant Testing (PCRT) is a full-body nondestructive testing (NDT) method that measures the resonance frequencies of a part and correlates them to the part's material and/or damage state. PCRT testing is used in the automotive, aerospace, and power generation industries via automated PASS/FAIL inspections to distinguish parts with nominal process variation from those with the defect(s) of interest. Traditional PCRT tests are created through the statistical analysis of populations of "good" and "bad" parts. However, gathering a statistically significant number of parts can be costly and time-consuming, and the availability of defective parts may be limited. This work uses virtual databases of good and bad parts to create two targeted PCRT inspections for single crystal (SX) nickel-based superalloy turbine blades. Using finite element (FE) models, populations were modeled to include variations in geometric dimensions, material properties, crystallographic orientation, and creep damage. Model results were verified by comparing the frequency variation in the modeled populations with the measured frequency variations of several physical blade populations. Additionally, creep modeling results were verified through the experimental evaluation of coupon geometries. A virtual database of resonance spectra was created from the model data. The virtual database was used to create PCRT inspections to detect crystallographic defects and creep strain. Quantification of creep strain values using the PCRT inspection results was also demonstrated.
Balanced sparse model for tight frames in compressed sensing magnetic resonance imaging.
Directory of Open Access Journals (Sweden)
Yunsong Liu
Full Text Available Compressed sensing has shown to be promising to accelerate magnetic resonance imaging. In this new technology, magnetic resonance images are usually reconstructed by enforcing its sparsity in sparse image reconstruction models, including both synthesis and analysis models. The synthesis model assumes that an image is a sparse combination of atom signals while the analysis model assumes that an image is sparse after the application of an analysis operator. Balanced model is a new sparse model that bridges analysis and synthesis models by introducing a penalty term on the distance of frame coefficients to the range of the analysis operator. In this paper, we study the performance of the balanced model in tight frame based compressed sensing magnetic resonance imaging and propose a new efficient numerical algorithm to solve the optimization problem. By tuning the balancing parameter, the new model achieves solutions of three models. It is found that the balanced model has a comparable performance with the analysis model. Besides, both of them achieve better results than the synthesis model no matter what value the balancing parameter is. Experiment shows that our proposed numerical algorithm constrained split augmented Lagrangian shrinkage algorithm for balanced model (C-SALSA-B converges faster than previously proposed algorithms accelerated proximal algorithm (APG and alternating directional method of multipliers for balanced model (ADMM-B.
Dual Entwining Structures and Dual Entwined Modules
Abuhlail, Jawad Y.
2003-01-01
In this note we introduce and investigate the concepts of dual entwining structures and dual entwined modules. This generalizes the concepts of dual Doi-Koppinen structures and dual Doi-Koppinen modules introduced (in the infinite case over rings) by the author is his dissertation.
Cross sections and multiparticle production at supercollider energies in the dual parton model
International Nuclear Information System (INIS)
Ranft, J.
1993-01-01
The dual parton model (DPM) describes soft and semihard multiparticle production and treats diffractive processes for the first time in a consistent way. The model is formulated in the form of a Monte-Carlo event generator, DTUJET for hadron-hadron collisions at collider energies. The uncertainties in the model predictions in the TeV energy range due to the unknown parton structure functions at x≤0.02 is explored. The behaviour of the model studied in the forward fragmentation region, which is especially relevant for the interaction of Cosmic Rays
Rapidly reconfigurable slow-light system based on off-resonant Raman absorption
International Nuclear Information System (INIS)
Vudyasetu, Praveen K.; Howell, John C.; Camacho, Ryan M.
2010-01-01
We present a slow-light system based on dual Raman absorption resonances in warm rubidium vapor. Each Raman absorption resonance is produced by a control beam in an off-resonant Λ system. This system combines all optical control of the Raman absorption and the low-dispersion broadening properties of the double Lorentzian absorption slow light. The bandwidth, group delay, and central frequency of the slow-light system can all be tuned dynamically by changing the properties of the control beam. We demonstrate multiple pulse delays with low distortion and show that such a system has fast switching dynamics and thus fast reconfiguration rates.
A dual-band reconfigurable Yagi-Uda antenna with diverse radiation patterns
Saurav, Kushmanda; Sarkar, Debdeep; Srivastava, Kumar Vaibhav
2017-07-01
In this paper, a dual-band pattern reconfigurable antenna is proposed. The antenna comprises of a dual-band complementary split ring resonators (CSRRs) loaded dipole as the driven element and two copper strips with varying lengths as parasitic segments on both sides of the driven dipole. PIN diodes are used with the parasitic elements to control their electrical length. The CSRRs loading provide a lower order mode in addition to the reference dipole mode, while the parasitic elements along with the PIN diodes are capable of switching the omni-directional radiation of the dual-band driven element to nine different configurations of radiation patterns which include bi-directional end-fire, broadside, and uni-directional end-fire in both the operating bands. A prototype of the designed antenna together with the PIN diodes and DC bias lines is fabricated to validate the concept of dual-band radiation pattern diversity. The simulation and measurement results are in good agreement. The proposed antenna can be used in wireless access points for PCS and WLAN applications.
Rapcsak, Steven Z.; Henry, Maya L.; Teague, Sommer L.; Carnahan, Susan D.; Beeson, Pélagie M.
2007-01-01
Coltheart and colleagues (Coltheart, Rastle, Perry, Langdon, & Ziegler, 2001; Castles, Bates, & Coltheart, 2006) have demonstrated that an equation derived from dual-route theory accurately predicts reading performance in young normal readers and in children with reading impairment due to developmental dyslexia or stroke. In this paper we present evidence that the dual-route equation and a related multiple regression model also accurately predict both reading and spelling performance in adult...
Nieuwland, Mante S.
2016-01-01
Abstract Cognitive and linguistic theories of counterfactual language comprehension assume that counterfactuals convey a dual meaning. Subjunctive‐counterfactual conditionals (e.g., ‘If Tom had studied hard, he would have passed the test’) express a supposition while implying the factual state of affairs (Tom has not studied hard and failed). The question of how counterfactual dual meaning plays out during language processing is currently gaining interest in psycholinguistics. Whereas numerous studies using offline measures of language processing consistently support counterfactual dual meaning, evidence coming from online studies is less conclusive. Here, we review the available studies that examine online counterfactual language comprehension through behavioural measurement (self‐paced reading times, eye‐tracking) and neuroimaging (electroencephalography, functional magnetic resonance imaging). While we argue that these studies do not offer direct evidence for the online computation of counterfactual dual meaning, they provide valuable information about the way counterfactual meaning unfolds in time and influences successive information processing. Further advances in research on counterfactual comprehension require more specific predictions about how counterfactual dual meaning impacts incremental sentence processing. PMID:27512408
Ghost free dual vector theories in 2+1 dimensions
International Nuclear Information System (INIS)
Dalmazi, Denis
2006-01-01
We explore here the issue of duality versus spectrum equivalence in dual theories generated through the master action approach. Specifically we examine a generalized self-dual (GSD) model where a Maxwell term is added to the self-dual model. A gauge embedding procedure applied to the GSD model leads to a Maxwell-Chern-Simons (MCS) theory with higher derivatives. We show here that the latter contains a ghost mode contrary to the original GSD model. By figuring out the origin of the ghost we are able to suggest a new master action which interpolates between the local GSD model and a nonlocal MCS model. Those models share the same spectrum and are ghost free. Furthermore, there is a dual map between both theories at classical level which survives quantum correlation functions up to contact terms. The remarks made here may be relevant for other applications of the master action approach
Photoproduction within the two-component Dual Parton Model: amplitudes and cross sections
International Nuclear Information System (INIS)
Engel, R.; Siegen Univ.
1995-01-01
In the framework of the Dual Parton Model an approximation scheme to describe high energy photoproduction processes is presented. Based on the distinction between direct, resolved soft, and resolved hard interaction processes we construct effective impact parameter amplitudes. In order to treat low mass diffraction within the eikonal formalism in a consistent way a phenomenological ansatz is proposed. The free parameters of the model are determined by fits to high energy hadro- and photoproduction cross sections. We calculate the partial photoproduction cross sections and discuss predictions of the model at HERA energies. Using hadro- and photoproduction data together, the uncertainties of the model predictions are strongly reduced. (orig.)
Three-Dimensional Electromagnetic Mixing Models for Dual-Phase Steel Microstructures
Directory of Open Access Journals (Sweden)
Weibin Zhou
2018-03-01
Full Text Available Linking the ferrite fraction in a dual-phase (DP steel microstructure and its electromagnetic properties is critical in the effort to develop on-line measurement techniques for phase transformation using electromagnetic (EM sensors. This paper developed a seamlessly integrated method for generating 3D microstructures and evaluating their equivalent permeability values. Both the generation of 3D microstructures and evaluation of equivalent permeability have been achieved through custom modelling packages developed by the authors. Voronoi modelling based on the random close packing of spheres (RCPS-VM was used to precisely control the ferrite fraction in DP steel microstructure, and an equivalent uniform field method for 3D finite element simulation was developed for efficient analysis.
Scholtz, Jan-Erik; Wichmann, Julian L; Bennett, Dennis W; Leithner, Doris; Bauer, Ralf W; Vogl, Thomas J; Bodelle, Boris
2017-05-01
The purpose of our study was to determine diagnostic accuracy, image quality, and radiation dose of low-dose single- and dual-energy unenhanced third-generation dual-source head CT for detection of intracranial hemorrhage (ICH). A total of 123 patients with suspected ICH were examined using a dual-source 192-MDCT scanner. Standard-dose 120-kVp single-energy CT (SECT; n = 36) and 80-kVp and 150-kVp dual-energy CT (DECT; n = 30) images were compared with low-dose SECT (n = 32) and DECT (n = 25) images obtained using automated tube current modulation (ATCM). Advanced modeled iterative reconstruction (ADMIRE) was used for all protocols. Detection of ICH was performed by three readers who were blinded to the image acquisition parameters of each image series. Image quality was assessed both quantitatively and qualitatively. Interobserver agreement was calculated using the Fleiss kappa. Radiation dose was measured as dose-length product (DLP). Detection of ICH was excellent (sensitivity, 94.9-100%; specificity, 94.7-100%) in all protocols (p = 1.00) with perfect interobserver agreement (0.83-0.96). Qualitative ratings showed significantly better ratings for both standard-dose protocols regarding gray matter-to-white matter contrast (p ≤ 0.014), whereas highest gray matter-to-white matter contrast-to-noise ratio was observed with low-dose DECT images (p ≥ 0.057). The lowest posterior fossa artifact index was measured for standard-dose DECT, which showed significantly lower values compared with low-dose protocols (p ≤ 0.034). Delineation of ventricular margins and sharpness of subarachnoidal spaces were rated excellent in all protocols (p ≥ 0.096). Low-dose techniques lowered radiation dose by 26% for SECT images (DLP, 575.0 ± 72.3 mGy · cm vs 771.5 ± 146.8 mGy · cm; p dual-source CT while allowing significant radiation dose reduction.
Description of inelastic nucleus-nucleus interactions at medium energy using dual parton model
International Nuclear Information System (INIS)
Polanski, A.; Shmakov, S.Yu.; Uzhinskij, V.V.
1989-01-01
It is shown that the dual parton model taking into account the processes of diffraction dissociation to the low mass states and finite energy corrections to the asymptotic Abramovski-Gribov-Kancheli cutting rules allows satisfactory description of existing experimental data on hadron-nucleus and nucleus-nucleus interactions at medium energy. (orig.)
Meso-Scale Modelling of Deformation, Damage and Failure in Dual Phase Steels
Sari Sarraf, Iman
Advanced high strength steels (AHSS), such as dual phase (DP) and transformation induced plasticity (TRIP) steels, offer high ductility, formability, and strength, as well as high strength-to-weight ratio and improved crash resistance. Dual phase steels belong to a family of high strength grades which consist of martensite, responsible for strengthening, distributed in a ductile ferrite matrix which accommodates the deformation throughout the forming process. It has been shown that the predominant damage mechanism and failure in DP steels depends on the ferrite and martensite grain sizes and their morphology, and can range from a mixture of brittle and ductile rupture to completely ductile rupture in a quasi-static uniaxial tension test. In this study, a hybrid finite element cellular automata model, initially proposed by Anton Shterenlikht (2003), was developed to evaluate the forming behaviour and predict the onset of instability and damage evolution in a dual phase steel. In this model, the finite element constitutive model is used to represent macro-level strain gradients and a damage variable, and two different cell arrays are designed to represent the ductile and brittle fracture modes in meso-scale. In the FE part of the model, a modified Rousselier ductile damage model is developed to account for nucleation, growth and coalescence of voids. Also, several rate-dependent hardening models were developed and evaluated to describe the work hardening flow curve of DP600. Based on statistical analysis and simulation results, a modified Johnson-Cook (JC) model and a multiplicative combination of the Voce-modified JC functions were found to be the most accurate hardening models. The developed models were then implemented in a user-defined material subroutine (VUMAT) for ABAQUS/Explicit finite element simulation software to simulate uniaxial tension tests at strain rates ranging from 0.001 1/s to 1000 1/s, Marciniak tests, and electrohydraulic free-forming (EHFF
Buss, Aaron T; Wifall, Tim; Hazeltine, Eliot; Spencer, John P
2014-02-01
People are typically slower when executing two tasks than when only performing a single task. These dual-task costs are initially robust but are reduced with practice. Dux et al. (2009) explored the neural basis of dual-task costs and learning using fMRI. Inferior frontal junction (IFJ) showed a larger hemodynamic response on dual-task trials compared with single-task trial early in learning. As dual-task costs were eliminated, dual-task hemodynamics in IFJ reduced to single-task levels. Dux and colleagues concluded that the reduction of dual-task costs is accomplished through increased efficiency of information processing in IFJ. We present a dynamic field theory of response selection that addresses two questions regarding these results. First, what mechanism leads to the reduction of dual-task costs and associated changes in hemodynamics? We show that a simple Hebbian learning mechanism is able to capture the quantitative details of learning at both the behavioral and neural levels. Second, is efficiency isolated to cognitive control areas such as IFJ, or is it also evident in sensory motor areas? To investigate this, we restrict Hebbian learning to different parts of the neural model. None of the restricted learning models showed the same reductions in dual-task costs as the unrestricted learning model, suggesting that efficiency is distributed across cognitive control and sensory motor processing systems.
A non-static model for the Roper resonances
International Nuclear Information System (INIS)
Guichon, P.A.M.
1985-07-01
We solve the M.I.T. bag equations for Fermions in the limit of small fluctuations and quantize the solution. We get a non static bag model which provides a satisfactory interpretation of the Roper resonances if the time averaged radius of the cavitity is about 1 fm
Mkhitaryan, V. V.; Danilović, D.; Hippola, C.; Raikh, M. E.; Shinar, J.
2018-01-01
We present a comparative theoretical study of magnetic resonance within the polaron pair recombination (PPR) and the triplet exciton-polaron quenching (TPQ) models. Both models have been invoked to interpret the photoluminescence detected magnetic resonance (PLDMR) results in π -conjugated materials and devices. We show that resonance line shapes calculated within the two models differ dramatically in several regards. First, in the PPR model, the line shape exhibits unusual behavior upon increasing the microwave power: it evolves from fully positive at weak power to fully negative at strong power. In contrast, in the TPQ model, the PLDMR is completely positive, showing a monotonic saturation. Second, the two models predict different dependencies of the resonance signal on the photoexcitation power, PL. At low PL, the resonance amplitude Δ I /I is ∝PL within the PPR model, while it is ∝PL2 crossing over to PL3 within the TPQ model. On the physical level, the differences stem from different underlying spin dynamics. Most prominently, a negative resonance within the PPR model has its origin in the microwave-induced spin-Dicke effect, leading to the resonant quenching of photoluminescence. The spin-Dicke effect results from the spin-selective recombination, leading to a highly correlated precession of the on-resonance pair partners under the strong microwave power. This effect is not relevant for TPQ mechanism, where the strong zero-field splitting renders the majority of triplets off resonance. On the technical level, the analytical evaluation of the line shapes for the two models is enabled by the fact that these shapes can be expressed via the eigenvalues of a complex Hamiltonian. This bypasses the necessity of solving the much larger complex linear system of the stochastic Liouville equations. Our findings pave the way towards a reliable discrimination between the two mechanisms via cw PLDMR.
A Dual Hesitant Fuzzy Multigranulation Rough Set over Two-Universe Model for Medical Diagnoses
Zhang, Chao; Li, Deyu; Yan, Yan
2015-01-01
In medical science, disease diagnosis is one of the difficult tasks for medical experts who are confronted with challenges in dealing with a lot of uncertain medical information. And different medical experts might express their own thought about the medical knowledge base which slightly differs from other medical experts. Thus, to solve the problems of uncertain data analysis and group decision making in disease diagnoses, we propose a new rough set model called dual hesitant fuzzy multigranulation rough set over two universes by combining the dual hesitant fuzzy set and multigranulation rough set theories. In the framework of our study, both the definition and some basic properties of the proposed model are presented. Finally, we give a general approach which is applied to a decision making problem in disease diagnoses, and the effectiveness of the approach is demonstrated by a numerical example. PMID:26858772
International Nuclear Information System (INIS)
Malik, R. P.; Srinivas, N.; Bhanja, T.
2016-01-01
We exploit the key concepts of the augmented version of superfield approach to Becchi-Rouet-Stora-Tyutin (BRST) formalism to derive the superspace (SUSP) dual unitary operator and its Hermitian conjugate and demonstrate their utility in the derivation of the nilpotent and absolutely anticommuting (anti-)dual-BRST symmetry transformations for a set of interesting models of the Abelian 1-form gauge theories. These models are the one (0+1)-dimensional (1D) rigid rotor and modified versions of the two (1+1)-dimensional (2D) Proca as well as anomalous gauge theories and 2D model of a self-dual bosonic field theory. We show the universality of the SUSP dual unitary operator and its Hermitian conjugate in the cases of all the Abelian models under consideration. These SUSP dual unitary operators, besides maintaining the explicit group structure, provide the alternatives to the dual horizontality condition (DHC) and dual gauge invariant restrictions (DGIRs) of the superfield formalism. The derivations of the dual unitary operators and corresponding (anti-)dual-BRST symmetries are completely novel results in our present investigation.
Farokhi, Hamed; Païdoussis, Michael P.; Misra, Arun K.
2018-04-01
The present study examines the nonlinear behaviour of a cantilevered carbon nanotube (CNT) resonator and its mass detection sensitivity, employing a new nonlinear electrostatic load model. More specifically, a 3D finite element model is developed in order to obtain the electrostatic load distribution on cantilevered CNT resonators. A new nonlinear electrostatic load model is then proposed accounting for the end effects due to finite length. Additionally, a new nonlinear size-dependent continuum model is developed for the cantilevered CNT resonator, employing the modified couple stress theory (to account for size-effects) together with the Kelvin-Voigt model (to account for nonlinear damping); the size-dependent model takes into account all sources of nonlinearity, i.e. geometrical and inertial nonlinearities as well as nonlinearities associated with damping, small-scale, and electrostatic load. The nonlinear equation of motion of the cantilevered CNT resonator is obtained based on the new models developed for the CNT resonator and the electrostatic load. The Galerkin method is then applied to the nonlinear equation of motion, resulting in a set of nonlinear ordinary differential equations, consisting of geometrical, inertial, electrical, damping, and size-dependent nonlinear terms. This high-dimensional nonlinear discretized model is solved numerically utilizing the pseudo-arclength continuation technique. The nonlinear static and dynamic responses of the system are examined for various cases, investigating the effect of DC and AC voltages, length-scale parameter, nonlinear damping, and electrostatic load. Moreover, the mass detection sensitivity of the system is examined for possible application of the CNT resonator as a nanosensor.
Modeling and understanding of effects of randomness in arrays of resonant meta-atoms
DEFF Research Database (Denmark)
Tretyakov, Sergei A.; Albooyeh, Mohammad; Alitalo, Pekka
2013-01-01
In this review presentation we will discuss approaches to modeling and understanding electromagnetic properties of 2D and 3D lattices of small resonant particles (meta-atoms) in transition from regular (periodic) to random (amorphous) states. Nanostructured metasurfaces (2D) and metamaterials (3D......) are arrangements of optically small but resonant particles (meta-atoms). We will present our results on analytical modeling of metasurfaces with periodical and random arrangements of electrically and magnetically resonant meta-atoms with identical or random sizes, both for the normal and oblique-angle excitations....... We show how the electromagnetic response of metasurfaces is related to the statistical parameters of the structure. Furthermore, we will discuss the phenomenon of anti-resonance in extracted effective parameters of metamaterials and clarify its relation to the periodicity (or amorphous nature...
Optimum filter selection for Dual Energy X-ray Applications through Analytical Modeling
International Nuclear Information System (INIS)
Koukou, V; Martini, N; Sotiropoulou, P; Nikiforidis, G; Michail, C; Kalyvas, N; Kandarakis, I; Fountos, G
2015-01-01
In this simulation study, an analytical model was used in order to determine the optimal acquisition parameters for a dual energy breast imaging system. The modeled detector system, consisted of a 33.91mg/cm 2 Gd 2 O 2 S:Tb scintillator screen, placed in direct contact with a high resolution CMOS sensor. Tungsten anode X-ray spectra, filtered with various filter materials and filter thicknesses were examined for both the low- and high-energy beams, resulting in 3375 combinations. The selection of these filters was based on their K absorption edge (K-edge filtering). The calcification signal-to-noise ratio (SNR tc ) and the mean glandular dose (MGD) were calculated. The total mean glandular dose was constrained to be within acceptable levels. Optimization was based on the maximization of the SNR tc /MGD ratio. The results showed that the optimum spectral combination was 40kVp with added beam filtration of 100 μm Ag and 70kVp Cu filtered spectrum of 1000 μm for the low- and high-energy, respectively. The minimum detectable calcification size was 150 μm. Simulations demonstrate that this dual energy X-ray technique could enhance breast calcification detection. (paper)
Uncertainty in dual permeability model parameters for structured soils
Arora, B.; Mohanty, B. P.; McGuire, J. T.
2012-01-01
Successful application of dual permeability models (DPM) to predict contaminant transport is contingent upon measured or inversely estimated soil hydraulic and solute transport parameters. The difficulty in unique identification of parameters for the additional macropore- and matrix-macropore interface regions, and knowledge about requisite experimental data for DPM has not been resolved to date. Therefore, this study quantifies uncertainty in dual permeability model parameters of experimental soil columns with different macropore distributions (single macropore, and low- and high-density multiple macropores). Uncertainty evaluation is conducted using adaptive Markov chain Monte Carlo (AMCMC) and conventional Metropolis-Hastings (MH) algorithms while assuming 10 out of 17 parameters to be uncertain or random. Results indicate that AMCMC resolves parameter correlations and exhibits fast convergence for all DPM parameters while MH displays large posterior correlations for various parameters. This study demonstrates that the choice of parameter sampling algorithms is paramount in obtaining unique DPM parameters when information on covariance structure is lacking, or else additional information on parameter correlations must be supplied to resolve the problem of equifinality of DPM parameters. This study also highlights the placement and significance of matrix-macropore interface in flow experiments of soil columns with different macropore densities. Histograms for certain soil hydraulic parameters display tri-modal characteristics implying that macropores are drained first followed by the interface region and then by pores of the matrix domain in drainage experiments. Results indicate that hydraulic properties and behavior of the matrix-macropore interface is not only a function of saturated hydraulic conductivity of the macroporematrix interface (Ksa) and macropore tortuosity (lf) but also of other parameters of the matrix and macropore domains.
A numerical study on dual-phase-lag model of bio-heat transfer during hyperthermia treatment.
Kumar, P; Kumar, Dinesh; Rai, K N
2015-01-01
The success of hyperthermia in the treatment of cancer depends on the precise prediction and control of temperature. It was absolutely a necessity for hyperthermia treatment planning to understand the temperature distribution within living biological tissues. In this paper, dual-phase-lag model of bio-heat transfer has been studied using Gaussian distribution source term under most generalized boundary condition during hyperthermia treatment. An approximate analytical solution of the present problem has been done by Finite element wavelet Galerkin method which uses Legendre wavelet as a basis function. Multi-resolution analysis of Legendre wavelet in the present case localizes small scale variations of solution and fast switching of functional bases. The whole analysis is presented in dimensionless form. The dual-phase-lag model of bio-heat transfer has compared with Pennes and Thermal wave model of bio-heat transfer and it has been found that large differences in the temperature at the hyperthermia position and time to achieve the hyperthermia temperature exist, when we increase the value of τT. Particular cases when surface subjected to boundary condition of 1st, 2nd and 3rd kind are discussed in detail. The use of dual-phase-lag model of bio-heat transfer and finite element wavelet Galerkin method as a solution method helps in precise prediction of temperature. Gaussian distribution source term helps in control of temperature during hyperthermia treatment. So, it makes this study more useful for clinical applications. Copyright © 2015 Elsevier Ltd. All rights reserved.
Modeling of Perpendicularly Driven Dual-Frequency Capacitively Coupled Plasma
International Nuclear Information System (INIS)
Wang Hongyu; Sun Peng; Zhao Shuangyun; Li Yang; Jiang Wei
2016-01-01
We analyzed perpendicularly configured dual-frequency (DF) capacitively coupled plasmas (CCP). In this configuration, two pairs of electrodes are arranged oppositely, and the discharging is perpendicularly driven by two radio frequency (RF) sources. Particle-in-cell/Monte Carlo (PIC/MC) simulation showed that the configuration had some advantages as this configuration eliminated some dual frequency coupling effects. Some variation and potential application of the discharging configuration is discussed briefly. (paper)
Dual-Tasking Alleviated Sleep Deprivation Disruption in Visuomotor Tracking: An fMRI Study
Gazes, Yunglin; Rakitin, Brian C.; Steffener, Jason; Habeck, Christian; Butterfield, Brady; Basner, Robert C.; Ghez, Claude; Stern, Yaakov
2012-01-01
Effects of dual-responding on tracking performance after 49-h of sleep deprivation (SD) were evaluated behaviorally and with functional magnetic resonance imaging (fMRI). Continuous visuomotor tracking was performed simultaneously with an intermittent color-matching visual detection task in which a pair of color-matched stimuli constituted a…
DEFF Research Database (Denmark)
Sokoler, Leo Emil; Frison, Gianluca; Edlund, Kristian
2013-01-01
In this paper, we develop an efficient interior-point method (IPM) for the linear programs arising in economic model predictive control of linear systems. The novelty of our algorithm is that it combines a homogeneous and self-dual model, and a specialized Riccati iteration procedure. We test...
New normative standards of conditional reasoning and the dual-source model.
Singmann, Henrik; Klauer, Karl Christoph; Over, David
2014-01-01
There has been a major shift in research on human reasoning toward Bayesian and probabilistic approaches, which has been called a new paradigm. The new paradigm sees most everyday and scientific reasoning as taking place in a context of uncertainty, and inference is from uncertain beliefs and not from arbitrary assumptions. In this manuscript we present an empirical test of normative standards in the new paradigm using a novel probabilized conditional reasoning task. Our results indicated that for everyday conditional with at least a weak causal connection between antecedent and consequent only the conditional probability of the consequent given antecedent contributes unique variance to predicting the probability of conditional, but not the probability of the conjunction, nor the probability of the material conditional. Regarding normative accounts of reasoning, we found significant evidence that participants' responses were confidence preserving (i.e., p-valid in the sense of Adams, 1998) for MP inferences, but not for MT inferences. Additionally, only for MP inferences and to a lesser degree for DA inferences did the rate of responses inside the coherence intervals defined by mental probability logic (Pfeifer and Kleiter, 2005, 2010) exceed chance levels. In contrast to the normative accounts, the dual-source model (Klauer et al., 2010) is a descriptive model. It posits that participants integrate their background knowledge (i.e., the type of information primary to the normative approaches) and their subjective probability that a conclusion is seen as warranted based on its logical form. Model fits showed that the dual-source model, which employed participants' responses to a deductive task with abstract contents to estimate the form-based component, provided as good an account of the data as a model that solely used data from the probabilized conditional reasoning task.
New Normative Standards of Conditional Reasoning and the Dual-Source Model
Directory of Open Access Journals (Sweden)
Henrik eSingmann
2014-04-01
Full Text Available There has been a major shift in research on human reasoning towards Bayesian and probabilistic approaches, which has been called a new paradigm. The new paradigm sees most everyday and scientific reasoning as taking place in a context of uncertainty, and inference is from uncertain beliefs and not from arbitrary assumptions. In this manuscript we present an empirical test of normative standards in the new paradigm using a novel probabilized conditional reasoning task. Our results indicated that for everyday conditional with at least a weak causal connection between antecedent and consequent only the conditional probability of the consequent given antecedent contributes unique variance to predicting the probability of conditional, but not the probability of the conjunction, nor the probability of the material conditional. Regarding normative accounts of reasoning, we found significant evidence that participants' responses were confidence preserving (i.e., p-valid in the sense of Adams, 1998 for MP inferences, but not for MT inferences. Additionally, only for MP inferences and to a lesser degree for DA inferences did the rate of responses inside the coherence intervals defined by mental probability logic (Pfeifer & Kleiter, 2005, 2010 exceed chance levels. In contrast to the normative accounts, the dual-source model (Klauer, Beller, & Hütter, 2010 is a descriptive model. It posits that participants integrate their background knowledge (i.e., the type of information primary to the normative approaches and their subjective probability that a conclusion is seen as warranted based on its logical form. Model fits showed that the dual-source model, which employed participants' responses to a deductive task with abstract contents to estimate the form-based component, provided as good an account of the data as a model that solely used data from the probabilized conditional reasoning task.
Conserved number fluctuations in a hadron resonance gas model
International Nuclear Information System (INIS)
Garg, P.; Mishra, D.K.; Netrakanti, P.K.; Mohanty, B.; Mohanty, A.K.; Singh, B.K.; Xu, N.
2013-01-01
Net-baryon, net-charge and net-strangeness number fluctuations in high energy heavy-ion collisions are discussed within the framework of a hadron resonance gas (HRG) model. Ratios of the conserved number susceptibilities calculated in HRG are being compared to the corresponding experimental measurements to extract information about the freeze-out condition and the phase structure of systems with strong interactions. We emphasize the importance of considering the actual experimental acceptances in terms of kinematics (pseudorapidity (η) and transverse momentum (p T )), the detected charge state, effect of collective motion of particles in the system and the resonance decay contributions before comparisons are made to the theoretical calculations. In this work, based on HRG model, we report that the net-baryon number fluctuations are least affected by experimental acceptances compared to the net-charge and net-strangeness number fluctuations
Burger, Liesl; Forbes, Andrew
2007-09-01
A simple model of a Porro prism laser resonator has been found to correctly predict the formation of the "petal" mode patterns typical of these resonators. A geometrical analysis of the petals suggests that these petals are the lowest-order modes of this type of resonator. Further use of the model reveals the formation of more complex beam patterns, and the nature of these patterns is investigated. Also, the output of stable and unstable resonator modes is presented.
International Nuclear Information System (INIS)
Izumi, Kiwamu; Sigg, Daniel
2017-01-01
Length sensing and control is vital for Advanced LIGO and its goal of performing astrophysical searches. The current kilometer scale gravitational wave antennae are dual recycled Michelson interferometers enhanced with Fabry–Perot resonators in the arms. Observation requires the lengths of all optical cavities to be precisely servoed in the vicinity of a resonance using feedback controls. Simultaneously achieving robustness and low-noise is challenging due to cross-couplings between the multiple coupled optical resonators. We analytically derive the Advanced LIGO sensing and control scheme, calculate the effects of radiation pressure forces and review the current strategies of minimizing the coupling of noise into the gravitational wave readout. (paper)
Nonlinear Dynamics of a Helicopter Model in Ground Resonance
Tang, D. M.; Dowell, E. H.
1985-01-01
An approximate theoretical method is presented which determined the limit cycle behavior of a helicopter model which has one or two nonlinear dampers. The relationship during unstable ground resonance oscillations between lagging motion of the blades and fuselage motion is discussed. An experiment was carried out on using a helicopter scale model. The experimental results agree with those of the theoretical analysis.
Stabilization of self-mode-locked quantum dash lasers by symmetric dual-loop optical feedback
Asghar, Haroon; Wei, Wei; Kumar, Pramod; Sooudi, Ehsan; McInerney, John. G.
2018-02-01
We report experimental studies of the influence of symmetric dual-loop optical feedback on the RF linewidth and timing jitter of self-mode-locked two-section quantum dash lasers emitting at 1550 nm. Various feedback schemes were investigated and optimum levels determined for narrowest RF linewidth and low timing jitter, for single-loop and symmetric dual-loop feedback. Two symmetric dual-loop configurations, with balanced and unbalanced feedback ratios, were studied. We demonstrate that unbalanced symmetric dual loop feedback, with the inner cavity resonant and fine delay tuning of the outer loop, gives narrowest RF linewidth and reduced timing jitter over a wide range of delay, unlike single and balanced symmetric dual-loop configurations. This configuration with feedback lengths 80 and 140 m narrows the RF linewidth by 4-67x and 10-100x, respectively, across the widest delay range, compared to free-running. For symmetric dual-loop feedback, the influence of different power split ratios through the feedback loops was determined. Our results show that symmetric dual-loop feedback is markedly more effective than single-loop feedback in reducing RF linewidth and timing jitter, and is much less sensitive to delay phase, making this technique ideal for applications where robustness and alignment tolerance are essential.
Tanabe, Koji; Nishikawa, Keiichi; Sano, Tsukasa; Sakai, Osamu; Jara, Hernán
2010-05-01
To test a newly developed fat suppression magnetic resonance imaging (MRI) prepulse that synergistically uses the principles of fat suppression via inversion recovery (STIR) and spectral fat saturation (CHESS), relative to pure CHESS and STIR. This new technique is termed dual fat suppression (Dual-FS). To determine if Dual-FS could be chemically specific for fat, the phantom consisted of the fat-mimicking NiCl(2) aqueous solution, porcine fat, porcine muscle, and water was imaged with the three fat-suppression techniques. For Dual-FS and STIR, several inversion times were used. Signal intensities of each image obtained with each technique were compared. To determine if Dual-FS could be robust to magnetic field inhomogeneities, the phantom consisting of different NiCl(2) aqueous solutions, porcine fat, porcine muscle, and water was imaged with Dual-FS and CHESS at the several off-resonance frequencies. To compare fat suppression efficiency in vivo, 10 volunteer subjects were also imaged with the three fat-suppression techniques. Dual-FS could suppress fat sufficiently within the inversion time of 110-140 msec, thus enabling differentiation between fat and fat-mimicking aqueous structures. Dual-FS was as robust to magnetic field inhomogeneities as STIR and less vulnerable than CHESS. The same results for fat suppression were obtained in volunteers. The Dual-FS-STIR-CHESS is an alternative and promising fat suppression technique for turbo spin echo MRI. Copyright 2010 Wiley-Liss, Inc.
de Vries, Enno T.; Raoof, Amir; van Genuchten, Martinus Th.
2017-07-01
Many environmental and agricultural applications involve the transport of water and dissolved constituents through aggregated soil profiles, or porous media that are structured, fractured or macroporous in other ways. During the past several decades, various process-based macroscopic models have been used to simulate contaminant transport in such media. Many of these models consider advective-dispersive transport through relatively large inter-aggregate pore domains, while exchange with the smaller intra-aggregate pores is assumed to be controlled by diffusion. Exchange of solute between the two domains is often represented using a first-order mass transfer coefficient, which is commonly obtained by fitting to observed data. This study aims to understand and quantify the solute exchange term by applying a dual-porosity pore-scale network model to relatively large domains, and analysing the pore-scale results in terms of the classical dual-porosity (mobile-immobile) transport formulation. We examined the effects of key parameters (notably aggregate porosity and aggregate permeability) on the main dual-porosity model parameters, i.e., the mobile water fraction (ϕm) and the mass transfer coefficient (α). Results were obtained for a wide range of aggregate porosities (between 0.082 and 0.700). The effect of aggregate permeability was explored by varying pore throat sizes within the aggregates. Solute breakthrough curves (BTCs) obtained with the pore-scale network model at several locations along the domain were analysed using analytical solutions of the dual-porosity model to obtain estimates of ϕm and α. An increase in aggregate porosity was found to decrease ϕm and increase α, leading to considerable tailing in the BTCs. Changes in the aggregate pore throat size affected the relative flow velocity between the intra- and inter-aggregate domains. Higher flow velocities within the aggregates caused a change in the transport regime from diffusion dominated to more
Modelling of the dual frequency capacitive sheath in the intermediate pressure range
International Nuclear Information System (INIS)
Boyle, P C; Robiche, J; Turner, M M
2004-01-01
The nonlinearity of the plasma sheath in dual frequency capacitively coupled reactors is investigated for frequencies well above the ion plasma frequency. This work focuses on the behaviour of the voltage and the sheath width with respect to the driving current source and the collisionality regime. For typical plasma processing applications, the gas pressure ranges from a few milliTorrs to hundreds of milliTorrs, and the ion dynamics span different collisional regimes. To describe these different ion dynamics, we have used a collisionless model and a variable mobility model. The sheath widths and the voltages obtained from these two models have then been compared
Krupka, Jerzy; Aleshkevych, Pavlo; Salski, Bartlomiej; Kopyt, Pawel
2018-02-01
The mode of uniform precession, or Kittel mode, in a magnetized ferromagnetic sphere, has recently been proven to be the magnetic plasmon resonance. In this paper we show how to apply the electrodynamic model of the magnetic plasmon resonance for accurate measurements of the ferromagnetic resonance linewidth ΔH. Two measurement methods are presented. The first one employs Q-factor measurements of the magnetic plasmon resonance coupled to the resonance of an empty metallic cavity. Such coupled modes are known as magnon-polariton modes, i.e. hybridized modes between the collective spin excitation and the cavity excitation. The second one employs direct Q-factor measurements of the magnetic plasmon resonance in a filter setup with two orthogonal semi-loops used for coupling. Q-factor measurements are performed employing a vector network analyser. The methods presented in this paper allow one to extend the measurement range of the ferromagnetic resonance linewidth ΔH well beyond the limits of the commonly used measurement standards in terms of the size of the samples and the lowest measurable linewidths. Samples that can be measured with the newly proposed methods may have larger size as compared to the size of samples that were used in the standard methods restricted by the limits of perturbation theory.
Wang, Zhongxian; Liu, Yiping; Wei, Yonggeng; Song, Yilin
2018-01-01
The resonant coil design is taken as the core technology in the magnetic coupling resonant wireless power transmission system, which achieves energy transmission by the coupling of the resonant coil. This paper studies the effect of the resonant coil on energy transmission and the efficiency of the system. Combining a two-coil with a three-coil system, the optimum design method for the resonant coil is given to propose a novel coil structure. First, the co-simulation methods of Pspice and Maxwell are used. When the coupling coefficient of the resonant coil is different, the relationship between system transmission efficiency, output power, and frequency is analyzed. When the self-inductance of the resonant coil is different, the relationship between the performance and frequency of the system transmission is analyzed. Then, two-coil and three-coil structure models are built, and the parameters of the magnetic field of the coils are calculated and analyzed using the finite element method. In the end, a dual E-type simulation circuit model is used to optimize the design of the novel resonance coil. The co-simulation results show that the coupling coefficients of the two-coil, three-coil, and novel coil systems are 0.017, 0.17 and 0.0126, respectively. The power loss of the novel coil is 16.4 mW. There is an obvious improvement in the three-coil system, which shows that the magnetic leakage of the field and the energy coupling are relatively small. The new structure coil has better performance, and the load loss is lower; it can improve the system output power and transmission efficiency.
Dual degree partnership in nursing: an innovative undergraduate educational model.
Bastable, Susan B; Markowitz, Marianne
2012-10-01
We report the success of a unique articulation Dual Degree Partnership in Nursing (DDPN) model. The process used to establish and implement this approach is described. Unlike typical 2+2 agreements between associate degree (AD) and bachelor degree (BS) nursing education programs, the DDPN is designed with a 1+2+1 sequence. Intended to attract high school students, this model provides the opportunity to earn two degrees (AD and BS) while experiencing a 4-year campus living and learning environment. This configuration was accomplished without compromising the integrity of either of the established programs. After collecting data over the past 6 years, this model demonstrates popularity with the traditional-aged student, as well as success from an academic perspective. Statistics on retention, graduation, and NCLEX® pass rates indicate the feasibility and success of the model. Based on the findings, the potential for replication is promising for other colleges interested in a similar collaboration. Copyright 2012, SLACK Incorporated.
The Linked Dual Representation model of vocal perception and production
Directory of Open Access Journals (Sweden)
Sean eHutchins
2013-11-01
Full Text Available The voice is one of the most important media for communication, yet there is a wide range of abilities in both the perception and production of the voice. In this article, we review this range of abilities, focusing on pitch accuracy as a particularly informative case, and look at the factors underlying these abilities. Several classes of models have been posited describing the relationship between vocal perception and production, and we review the evidence for and against each class of model. We look at how the voice is different from other musical instruments and review evidence about both the association and the dissociation between vocal perception and production abilities. Finally, we introduce the Linked Dual Representation model, a new approach which can account for the broad patterns in prior findings, including trends in the data which might seem to be countervailing. We discuss how this model interacts with higher-order cognition and examine its predictions about several aspects of vocal perception and production.
New Fukui, dual and hyper-dual kernels as bond reactivity descriptors.
Franco-Pérez, Marco; Polanco-Ramírez, Carlos-A; Ayers, Paul W; Gázquez, José L; Vela, Alberto
2017-06-21
We define three new linear response indices with promising applications for bond reactivity using the mathematical framework of τ-CRT (finite temperature chemical reactivity theory). The τ-Fukui kernel is defined as the ratio between the fluctuations of the average electron density at two different points in the space and the fluctuations in the average electron number and is designed to integrate to the finite-temperature definition of the electronic Fukui function. When this kernel is condensed, it can be interpreted as a site-reactivity descriptor of the boundary region between two atoms. The τ-dual kernel corresponds to the first order response of the Fukui kernel and is designed to integrate to the finite temperature definition of the dual descriptor; it indicates the ambiphilic reactivity of a specific bond and enriches the traditional dual descriptor by allowing one to distinguish between the electron-accepting and electron-donating processes. Finally, the τ-hyper dual kernel is defined as the second-order derivative of the Fukui kernel and is proposed as a measure of the strength of ambiphilic bonding interactions. Although these quantities have never been proposed, our results for the τ-Fukui kernel and for τ-dual kernel can be derived in zero-temperature formulation of the chemical reactivity theory with, among other things, the widely-used parabolic interpolation model.
Dual-energy CT can detect malignant lymph nodes in rectal cancer.
Al-Najami, I; Lahaye, M J; Beets-Tan, R G H; Baatrup, G
2017-05-01
There is a need for an accurate and operator independent method to assess the lymph node status to provide the most optimal personalized treatment for rectal cancer patients. This study evaluates whether Dual Energy Computed Tomography (DECT) could contribute to the preoperative lymph node assessment, and compared it to Magnetic Resonance Imaging (MRI). The objective of this prospective observational feasibility study was to determine the clinical value of the DECT for the detection of metastases in the pelvic lymph nodes of rectal cancer patients and compare the findings to MRI and histopathology. The patients were referred to total mesorectal excision (TME) without any neoadjuvant oncological treatment. After surgery the rectum specimen was scanned, and lymph nodes were matched to the pathology report. Fifty-four histology proven rectal cancer patients received a pelvic DECT scan and a standard MRI. The Dual Energy CT quantitative parameters were analyzed: Water and Iodine concentration, Dual-Energy Ratio, Dual Energy Index, and Effective Z value, for the benign and malignant lymph node differentiation. DECT scanning showed statistical difference between malignant and benign lymph nodes in the measurements of iodine concentration, Dual-Energy Ratio, Dual Energy Index, and Effective Z value. Dual energy CT classified 42% of the cases correctly according to N-stage compared to 40% for MRI. This study showed statistical difference in several quantitative parameters between benign and malignant lymph nodes. There were no difference in the accuracy of lymph node staging between DECT and MRI. Copyright © 2017 Elsevier B.V. All rights reserved.
Roes, M.G.L.; Duarte, J.L.; Hendrix, M.A.M.
2011-01-01
Feedback sensor isolation is often an expensive necessity in power converters, for reasons of safety and electromagnetic compatibility. A disturbance observer-based control strategy for a dual-output resonant converter is proposed to overcome this problem. Current control of two LED loads is
Roes, M.G.L.; Duarte, J.L.; Hendrix, M.A.M.
2010-01-01
Feedback sensor isolation is often an expensive necessity in power converters, for reasons of safety and electromagnetic compatibility. A disturbance observer-based control strategy for a dual-output resonant converter is proposed to overcome this problem. Current control of two LED loads is
Estimation of free-hydrocarbon recovery from dual-pump systems
International Nuclear Information System (INIS)
Charbeneau, R.J.
1995-01-01
Free-product hydrocarbon which floats on the water table may be recovered using single-pump and dual-pump systems. The factors that affect the long-term free-product recovery using dual-pump systems include the free-product thickness as measured in monitoring wells, the ground-water pumping rate, hydrocarbon density and viscosity, and the soil permeability. This paper presents a simple model for prediction of free-product recovery using dual-pump systems. The model predicts the long-term rather than short-term recovery rates, and lends itself to spreadsheet calculations on microcomputers. A particularly simple form arises for cases where the drawdown is small. An application for estimating recovery from a dual-pump system is presented, and limitations of the model are summarized
Ma, Caijuan; Sun, Zijun; Liu, Guihua; Su, Zhengquan; Bai, Yan
2018-02-01
The method was presented for the sensitive and selective determination of chitosan (CTS) in health products with Brilliant Blue (BB) as a probe, based on dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS). In weakly acidic buffer solution, the binding of CTS and BB could result in the RRS intensities getting enhanced significantly at RRS peaks of 344 nm and 452 nm, and the scattering intensities of the two peaks were proportional to the concentration of CTS within a certain range. When the RRS intensities of the two wavelengths were superposed, the results showed higher sensitivity. Under the optimum experimental conditions, the total of the two increased RRS intensities was linear to the CTS concentration in the range of 0.02-1.80 μg/mL and the limit of detection (LOD) was 7.45 ng/mL. In this work, the optimum conditions and the effects of some foreign substances were studied. Accordingly, the new method based on DWO-RRS for the determination of CTS was developed. In addition, the effect of the molecular weight and the deacetylation degree between different chitosan molecules was discussed. Finally, this assay was applied to determine the concentration of CTS in health products with satisfactory results.
Zhu, Jinghui; Qin, Mingyou; Liu, Shaopu; Liu, Zhongfang; Yang, Jidong; Hu, Xiaoli
2014-09-15
A flow injection analysis (FIA) system combined with dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) has been established and validated for rapid determination of malachite green (MG) and its metabolite in fish samples. Under experimental condition, MG would react with Erythrosin (Ery) to form ion-association complexes, resulting in the occurrence of two RRS peaks and a dramatic enhancement of RRS intensity. The maximum RRS peaks were located at 286 nm and 337 nm. It is noted that the increments of both of these two peaks were proportional to the concentration of MG. The detection limit of DWO-RRS was 1.5 ng/mL, which was comparable to several reported methods. Moreover, the results of real sample analysis exhibited an acceptable recovery between 97.5% and 103.6%, indicating that the method had good reproducibility. Copyright © 2014 Elsevier B.V. All rights reserved.
Dynamic dual-tracer PET reconstruction.
Gao, Fei; Liu, Huafeng; Jian, Yiqiang; Shi, Pengcheng
2009-01-01
Although of important medical implications, simultaneous dual-tracer positron emission tomography reconstruction remains a challenging problem, primarily because the photon measurements from dual tracers are overlapped. In this paper, we propose a simultaneous dynamic dual-tracer reconstruction of tissue activity maps based on guidance from tracer kinetics. The dual-tracer reconstruction problem is formulated in a state-space representation, where parallel compartment models serve as continuous-time system equation describing the tracer kinetic processes of dual tracers, and the imaging data is expressed as discrete sampling of the system states in measurement equation. The image reconstruction problem has therefore become a state estimation problem in a continuous-discrete hybrid paradigm, and H infinity filtering is adopted as the estimation strategy. As H infinity filtering makes no assumptions on the system and measurement statistics, robust reconstruction results can be obtained for the dual-tracer PET imaging system where the statistical properties of measurement data and system uncertainty are not available a priori, even when there are disturbances in the kinetic parameters. Experimental results on digital phantoms, Monte Carlo simulations and physical phantoms have demonstrated the superior performance.
Dual Resonant Frequencies Effects on an Induction-Based Oil Palm Fruit Sensor
Directory of Open Access Journals (Sweden)
Noor Hasmiza Harun
2014-11-01
Full Text Available As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB. Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB. A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA. To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.
Dual resonant frequencies effects on an induction-based oil palm fruit sensor.
Harun, Noor Hasmiza; Misron, Norhisam; Mohd Sidek, Roslina; Aris, Ishak; Wakiwaka, Hiroyuki; Tashiro, Kunihisa
2014-11-19
As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB). Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB). A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA). To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.
van Zomeren, Martijn; Leach, Colin Wayne; Spears, Russell
To explain the psychology behind individuals' motivation to participate in collective action against collective disadvantage (e.g., protest marches), the authors introduce a dynamic dual pathway model of approach coping that integrates many common explanations of collective action (i.e., group
The dual pathway to creativity model: creative ideation as a function of flexibility and persistence
Nijstad, B.A.; de Dreu, C.K.W.; Rietzschel, E.F.; Baas, M.
2010-01-01
The dual pathway to creativity model argues that creativity—the generation of original and appropriate ideas—is a function of cognitive flexibility and cognitive persistence, and that dispositional or situational variables may influence creativity either through their effects on flexibility, on
Nijstad, B.A.; De Dreu, C.K.W.; Rietzschel, E.F.; Baas, M.
2010-01-01
The dual pathway to creativity model argues that creativity-the generation of original and appropriate ideas-is a function of cognitive flexibility and cognitive persistence, and that dispositional or situational variables may influence creativity either through their effects on flexibility, on
Wu, Di; Li, Peng; Chen, Juhong
2018-01-01
In recent years, the Internet technology has been deeply influencing recycling industry to make it more intelligent and interconnected. However, most existing papers on “Internet Recycling” neglected the problem of pricing strategy under online and offline channels for different levels of recyclers. Moreover, the effect of regional differences has been emphasized a lot in dual-channel forward supply chain, but recycling field has seldom been concerned about it. In this paper, a recycling system consisting of one recycling center and several third-party recyclers (TPR) was investigated based on traditional mode and dual-channel mode. The dual-channel reverse supply chain model is transformed from traditional mode by the introduction of online channel. It involves two recycling modes, as recycling centre for online recovery and “Recycling center+TPR” for offline recovery. By establishing pricing strategies based on Stackelberg game model, the impacts of regional differences were analysed. Finally, numerical analysis was given to illustrate the effectiveness of the pricing mechanisms and strategies.
Oberauer, Klauss; Lange, Elke B.
2009-01-01
The article presents a mathematical model of short-term recognition based on dual-process models and the three-component theory of working memory [Oberauer, K. (2002). Access to information in working memory: Exploring the focus of attention. "Journal of Experimental Psychology: Learning, Memory, and Cognition, 28", 411-421]. Familiarity arises…
The Fermi-Pasta-Ulam Model Periodic Solutions
Arioli, G; Terracini, S
2003-01-01
We introduce two novel methods for studying periodic solutions of the FPU beta-model, both numerically and rigorously. One is a variational approach, based on the dual formulation of the problem, and the other involves computer-assisted proofs. These methods are used e.g. to construct a new type of solutions, whose energy is spread among several modes, associated with closely spaced resonances.
Modeling the full-bridge series-resonant power converter
King, R. J.; Stuart, T. A.
1982-01-01
A steady state model is derived for the full-bridge series-resonant power converter. Normalized parametric curves for various currents and voltages are then plotted versus the triggering angle of the switching devices. The calculations are compared with experimental measurements made on a 50 kHz converter and a discussion of certain operating problems is presented.
New results in the Dual Parton Model
International Nuclear Information System (INIS)
Van, J.T.T.; Capella, A.
1984-01-01
In this paper, the similarity between the x distribution for particle production and the fragmentation functions are observed in e+e- collisions and in deep inelastic scattering are presented. Based on the observation, the authors develop a complete approach to multiparticle production which incorporates the most important features and concepts learned about high energy collisions. 1. Topological expansion : the dominant diagram at high energy corresponds to the simplest topology. 2. Unitarity : diagrams of various topology contribute to the cross sections in a way that unitary is preserved. 3. Regge behaviour and Duality. 4. Partonic structure of hadrons. These general theoretical ideas, result from many joint experimental and theoretical efforts on the study of soft hadron physics. The dual parton model is able to explain all the experimental features from FNAL to SPS collider energies. It has all the properties of an S-matrix theory and provides a unified description of hadron-hadron, hadron-nucleus and nucleus-nucleus collisions
Note on Nahm's partition function of the dual spectrum II
Minimi, M
1977-01-01
For pt.I see CERN publication TH2240. In part I, in considering the Nahm dual resonance mass spectra theory, it was noticed that there is another modular form; a generating function that transforms automorphically under T:w to -1/w and would realize the Veneziano dualism. The group structure associated with this form is studied since it appears, to the authors, to be more natural than Nahm's original. (6 refs).
Inverse modeling of multicomponent reactive transport through single and dual porosity media
Samper, Javier; Zheng, Liange; Fernández, Ana María; Montenegro, Luis
2008-06-01
Compacted bentonite is foreseen as buffer material for high-level radioactive waste in deep geological repositories because it provides hydraulic isolation, chemical stability, and radionuclide sorption. A wide range of laboratory tests were performed within the framework of FEBEX ( Full-scale Engineered Barrier EXperiment) project to characterize buffer properties and develop numerical models for FEBEX bentonite. Here we present inverse single and dual-continuum multicomponent reactive transport models of a long-term permeation test performed on a 2.5 cm long sample of FEBEX bentonite. Initial saline bentonite porewater was flushed with 5.5 pore volumes of fresh granitic water. Water flux and chemical composition of effluent waters were monitored during almost 4 years. The model accounts for solute advection and diffusion and geochemical reactions such as aqueous complexation, acid-base, cation exchange, protonation/deprotonation by surface complexation and dissolution/precipitation of calcite, chalcedony and gypsum. All of these processes are assumed at local equilibrium. Similar to previous studies of bentonite porewater chemistry on batch systems which attest the relevance of protonation/deprotonation on buffering pH, our results confirm that protonation/deprotonation is a key process in maintaining a stable pH under dynamic transport conditions. Breakthrough curves of reactive species are more sensitive to initial porewater concentration than to effective diffusion coefficient. Optimum estimates of initial porewater chemistry of saturated compacted FEBEX bentonite are obtained by solving the inverse problem of multicomponent reactive transport. While the single-continuum model reproduces the trends of measured data for most chemical species, it fails to match properly the long tails of most breakthrough curves. Such limitation is overcome by resorting to a dual-continuum reactive transport model.
Dual-use tools and systematics-aware analysis workflows in the ATLAS Run-II analysis model
FARRELL, Steven; The ATLAS collaboration
2015-01-01
The ATLAS analysis model has been overhauled for the upcoming run of data collection in 2015 at 13 TeV. One key component of this upgrade was the Event Data Model (EDM), which now allows for greater flexibility in the choice of analysis software framework and provides powerful new features that can be exploited by analysis software tools. A second key component of the upgrade is the introduction of a dual-use tool technology, which provides abstract interfaces for analysis software tools to run in either the Athena framework or a ROOT-based framework. The tool interfaces, including a new interface for handling systematic uncertainties, have been standardized for the development of improved analysis workflows and consolidation of high-level analysis tools. This presentation will cover the details of the dual-use tool functionality, the systematics interface, and how these features fit into a centrally supported analysis environment.
Dual-use tools and systematics-aware analysis workflows in the ATLAS Run-2 analysis model
FARRELL, Steven; The ATLAS collaboration; Calafiura, Paolo; Delsart, Pierre-Antoine; Elsing, Markus; Koeneke, Karsten; Krasznahorkay, Attila; Krumnack, Nils; Lancon, Eric; Lavrijsen, Wim; Laycock, Paul; Lei, Xiaowen; Strandberg, Sara Kristina; Verkerke, Wouter; Vivarelli, Iacopo; Woudstra, Martin
2015-01-01
The ATLAS analysis model has been overhauled for the upcoming run of data collection in 2015 at 13 TeV. One key component of this upgrade was the Event Data Model (EDM), which now allows for greater flexibility in the choice of analysis software framework and provides powerful new features that can be exploited by analysis software tools. A second key component of the upgrade is the introduction of a dual-use tool technology, which provides abstract interfaces for analysis software tools to run in either the Athena framework or a ROOT-based framework. The tool interfaces, including a new interface for handling systematic uncertainties, have been standardized for the development of improved analysis workflows and consolidation of high-level analysis tools. This paper will cover the details of the dual-use tool functionality, the systematics interface, and how these features fit into a centrally supported analysis environment.
A Dual Processing Approach to Stereotype Change.
Johnston, Lucy; Coolen, Petra
1995-01-01
Considered stereotype change within a framework of dual process models. Using three experiments, manipulated task involvement, source credibility, and message quality. Findings proved dual process as appropriate when considering the processing of stereotype-disconfirming information and processing's impact on existing stereotypes. Different…
International Nuclear Information System (INIS)
Donescu, O.S.; Battie, M.C.; Videman, T.
2007-01-01
Purpose: To examine degenerative features based on magnetic resonance imaging (MRI) measurements at the lumbar spine in relation to dual-energy X-ray absorptiometry (DXA), and to investigate whether bone mineral density (BMD) is reflected in the substitution of bone trabecular structure by fat at the vertebral body level indicated by MRI T1 relaxation time, endplate concavity, and hypertrophic (osteophytes and endplate sclerosis) MRI findings. Material and Methods: The sample for this cross-sectional study was composed of 102 subjects, 35-70 years old, from a population-based cohort. Data collection included DXA in the anterior-posterior projection at the L1-L4 vertebrae and right femoral neck, and MRI of the lumbar spine in the midsagittal plane. Results: Age, vertebral signal intensity, osteophytes, and endplate concavity collectively explained 20% of the variance in spine BMD. Conclusion: The study findings suggest that degenerative findings based on MRI measurements at the lumbar spine have an influence on bone assessment using DXA. Therefore, an overall bone assessment such as DXA might not offer an accurate measure of BMD
Parameter Identification for Nonlinear Circuit Models of Power BAW Resonator
Directory of Open Access Journals (Sweden)
CONSTANTINESCU, F.
2011-02-01
Full Text Available The large signal operation of the bulk acoustic wave (BAW resonators is characterized by the amplitude-frequency effect and the intermodulation effect. The measurement of these effects, together with that of the small signal frequency characteristic, are used in this paper for the parameter identification of the nonlinear circuit models developed previously by authors. As the resonator has been connected to the measurement bench by wire bonding, the parasitic elements of this connection have been taken into account, being estimated solving some electrical and magnetic field problems.
Some properties of dual and approximate dual of fusion frames
Arefijamaal, Ali Akbar; Neyshaburi, Fahimeh Arabyani
2016-01-01
In this paper we extend the notion of approximate dual to fusion frames and present some approaches to obtain dual and approximate alternate dual fusion frames. Also, we study the stability of dual and approximate alternate dual fusion frames.
Directory of Open Access Journals (Sweden)
S.N.M.P. Simamora
2014-10-01
Full Text Available Efficiency condition occurs when the value of the used outputs compared to the resource total that has been used almost close to the value 1 (absolute environment. An instrument to achieve efficiency if the power output level has decreased significantly in the life of the instrument used, if it compared to the previous condition, when the instrument is not equipped with additional systems (or proposed model improvement. Even more effective if the inputs model that are used in unison to achieve a homogeneous output. On this research has been designed and implemented the automatic control system for models of single input-dual-output, wherein the sampling instruments used are lamp and fan. Source voltage used is AC (alternate-current and tested using quantitative research methods and instrumentation (with measuring instruments are observed. The results obtained demonstrate the efficiency of the instrument experienced a significant current model of single-input-dual-output applied separately instrument trials such as lamp and fan when it compared to the condition or state before. And the result show that the design has been built, can also run well.
Temporal lobe epilepsy: analysis of patients with dual pathology.
Salanova, V; Markand, O; Worth, R
2004-02-01
To determine the frequency and types of dual pathology in patients with temporal lobe epilepsy (TLE) and to analyze the clinical manifestations and surgical outcome. A total of 240 patients with TLE underwent temporal resections following a comprehensive pre-surgical evaluation. Thirty-seven (15.4%) of these had hippocampal sclerosis (HS) or temporal lobe gliosis in association with another lesion (dual pathology). Eighteen of 37 patients with dual pathology had heterotopia of the temporal lobe, nine had cortical dysplasia, four had cavernous angiomas or arteriovenous malformations, one had a dysembryoplastic neuroepithelial tumor, one had a contusion and four patients had cerebral infarctions in childhood. 68.5% had abnormal head magnetic resonance imagings, 91.3% had abnormal positron emission tomography scans, and 96% had abnormal ictal SPECT. The intracarotid amobarbital procedure (IAP) showed impaired memory of the epileptogenic side in 72% of the patients. Twenty patients had left and 17 had right-sided en bloc temporal resections, including the lesion and mesial temporal structures. Twenty-six (70.2%) became seizure-free, eight (21.6%) had rare seizures, two (5.4%) had worthwhile seizure reduction and one (2.7%) had no improvement (range of follow-up 1-16 years, mean = 7.4 years). 15.4% had dual pathology. The dual pathology was almost exclusively seen in patients whose lesions were congenital, or occurred early in life, suggesting that the hippocampus is more vulnerable and more readily develops HS in early childhood. Resections, including the lateral and mesial temporal structures led to a favorable outcome with no mortality and little morbidity.
RECONSTRUCTION OF A HUMAN LUNG MORPHOLOGY MODEL FROM MAGNETIC RESONANCE IMAGES
RATIONALE A description of lung morphological structure is necessary for modeling the deposition and fate of inhaled therapeutic aerosols. A morphological model of the lung boundary was generated from magnetic resonance (MR) images with the goal of creating a framework for anato...
Swanson, Ryan D; Binley, Andrew; Keating, Kristina; France, Samantha; Osterman, Gordon; Day-Lewis, Frederick D.; Singha, Kamini
2015-01-01
The advection-dispersion equation (ADE) fails to describe commonly observed non-Fickian solute transport in saturated porous media, necessitating the use of other models such as the dual-domain mass-transfer (DDMT) model. DDMT model parameters are commonly calibrated via curve fitting, providing little insight into the relation between effective parameters and physical properties of the medium. There is a clear need for material characterization techniques that can provide insight into the geometry and connectedness of pore spaces related to transport model parameters. Here, we consider proton nuclear magnetic resonance (NMR), direct-current (DC) resistivity, and complex conductivity (CC) measurements for this purpose, and assess these methods using glass beads as a control and two different samples of the zeolite clinoptilolite, a material that demonstrates non-Fickian transport due to intragranular porosity. We estimate DDMT parameters via calibration of a transport model to column-scale solute tracer tests, and compare NMR, DC resistivity, CC results, which reveal that grain size alone does not control transport properties and measured geophysical parameters; rather, volume and arrangement of the pore space play important roles. NMR cannot provide estimates of more-mobile and less-mobile pore volumes in the absence of tracer tests because these estimates depend critically on the selection of a material-dependent and flow-dependent cutoff time. Increased electrical connectedness from DC resistivity measurements are associated with greater mobile pore space determined from transport model calibration. CC was hypothesized to be related to length scales of mass transfer, but the CC response is unrelated to DDMT.
International Nuclear Information System (INIS)
Hu Yong; Li Jing-Chao; Shen Ming-Wu; Shi Xiang-Yang
2014-01-01
Recent advances with iron oxide/gold (Fe 3 O 4 /Au) composite nanoparticles (CNPs) in dual-modality magnetic resonance (MR) and computed tomography (CT) imaging applications are reviewed. The synthesis and assembly of “dumbbelllike” and “core/shell” Fe 3 O 4 /Au CNPs is introduced. Potential applications of some developed Fe 3 O 4 /Au CNPs as contrast agents for dual-mode MR/CT imaging applications are described in detail. (topical review - magnetism, magnetic materials, and interdisciplinary research)
Physical optics modeling of modal patterns in a crossed porro prism resonator
CSIR Research Space (South Africa)
Litvin, IA
2006-07-01
Full Text Available A physical optics model is proposed to describe the transverse modal patterns in crossed Porro prism resonators. The model departs from earlier attempts in that the prisms are modeled as non-classical rotating elements with amplitude and phase...
Wang, Guobao; Corwin, Michael T; Olson, Kristin A; Badawi, Ramsey D; Sarkar, Souvik
2018-05-30
The hallmark of nonalcoholic steatohepatitis is hepatocellular inflammation and injury in the setting of hepatic steatosis. Recent work has indicated that dynamic 18F-FDG PET with kinetic modeling has the potential to assess hepatic inflammation noninvasively, while static FDG-PET did not show a promise. Because the liver has dual blood supplies, kinetic modeling of dynamic liver PET data is challenging in human studies. The objective of this study is to evaluate and identify a dual-input kinetic modeling approach for dynamic FDG-PET of human liver inflammation. Fourteen human patients with nonalcoholic fatty liver disease were included in the study. Each patient underwent one-hour dynamic FDG-PET/CT scan and had liver biopsy within six weeks. Three models were tested for kinetic analysis: traditional two-tissue compartmental model with an image-derived single-blood input function (SBIF), model with population-based dual-blood input function (DBIF), and modified model with optimization-derived DBIF through a joint estimation framework. The three models were compared using Akaike information criterion (AIC), F test and histopathologic inflammation reference. The results showed that the optimization-derived DBIF model improved the fitting of liver time activity curves and achieved lower AIC values and higher F values than the SBIF and population-based DBIF models in all patients. The optimization-derived model significantly increased FDG K1 estimates by 101% and 27% as compared with traditional SBIF and population-based DBIF. K1 by the optimization-derived model was significantly associated with histopathologic grades of liver inflammation while the other two models did not provide a statistical significance. In conclusion, modeling of DBIF is critical for kinetic analysis of dynamic liver FDG-PET data in human studies. The optimization-derived DBIF model is more appropriate than SBIF and population-based DBIF for dynamic FDG-PET of liver inflammation. © 2018
Aerial Triangulation Close-range Images with Dual Quaternion
Directory of Open Access Journals (Sweden)
SHENG Qinghong
2015-05-01
Full Text Available A new method for the aerial triangulation of close-range images based on dual quaternion is presented. Using dual quaternion to represent the spiral screw motion of the beam in the space, the real part of dual quaternion represents the angular elements of all the beams in the close-range area networks, the real part and the dual part of dual quaternion represents the line elements corporately. Finally, an aerial triangulation adjustment model based on dual quaternion is established, and the elements of interior orientation and exterior orientation and the object coordinates of the ground points are calculated. Real images and large attitude angle simulated images are selected to run the experiments of aerial triangulation. The experimental results show that the new method for the aerial triangulation of close-range images based on dual quaternion can obtain higher accuracy.
DEFF Research Database (Denmark)
Andersen, Steffen; Harrison, Glenn W.; Lau, Morten Igel
2014-01-01
The most popular models of decision making use a single criterion to evaluate projects or lotteries. However, decision makers may actually consider multiple criteria when evaluating projects. We consider a dual criteria model from psychology. This model integrates the familiar tradeoffs between...... to the clear role that income thresholds play in such decision making, but does not rule out a role for tradeoffs between risk and utility or probability weighting....
International Nuclear Information System (INIS)
Hara, F.; Seto, K.
1987-01-01
The design value of damping for nuclear piping systems is a vital parameter in ensuring safety in nuclear plants during large earthquakes. Many experiments and on-site tests have been undertaken in nuclear-industry developed countries to determine rational design values. However damping value in nuclear piping systems is so strongly influenced by many piping parameters that it shows a tremendous dispersion in its experimental values. A new trend has recently appeared in designing nuclear pipings, where they attempt to use a device to absorb vibration energy induced by seismic excitation. A typical device is an energy absorbing device, made of a special material having a high capacity of plasticity, which is installed between the piping and the support. This paper deals with the basic study of application of dual vibration absorbers to nuclear piping systems to accomplish high damping value and reduce consequently seismic response at resonance frequencies of a piping system, showing their effectiveness from not only numerical calculation but also experimental evaluation of the vibration responses in a 3D model piping system equipped with dual two vibration absorbers
Assessment of myocardial perfusion with MRI using a modified dual bolus method
International Nuclear Information System (INIS)
Husso, M; Sipola, P; Manninen, H; Vainio, P; Kuittinen, T; Hartikainen, J; Saarakkala, S; Töyräs, J; Kuikka, J
2014-01-01
Quantification of regional myocardial blood flow (rMBF) with first-pass magnetic resonance imaging (FP-MRI) requires two contrast agent injections (dual bolus technique), inducing error in the determined rMBF if the injections differ. We hypothesize that using input and residue curves of the same injection would be more reliable. We aim to introduce and evaluate a novel method to correct the high concentration arterial input function (AIF) for determination of rMBF. Sixteen patients with non-Hodgkin's lymphoma were examined before and after chemotherapy. The input function was solved by correcting initial high concentration AIF using the ratio of low and high contrast AIF areas, normalized by corresponding heart rates (modified dual bolus method). For comparison, the scaled low contrast AIF was used as an input function (dual bolus method). Unidirectional transfer coefficient K trans was calculated using both methods. K trans -values determined with the dual bolus (0.81 ± 0.32 ml g −1 min −1 ) and modified dual bolus (0.77 ± 0.42 ml g −1 min −1 ) methods were in agreement (p = 0.21). Mean K trans -values increased from 0.76 ± 0.43 to 0.89 ± 0.55 ml g −1 min −1 after chemotherapy (p = 0.17). The modified dual bolus technique agrees with the dual bolus technique (R2 = 0.899) when the low and high contrast injections are similar. However, when this is not the case, the modified dual bolus technique may be more reliable. (paper)
The Neurocognitive Basis for Impaired Dual-Task Performance in Senior Fallers.
Nagamatsu, Lindsay S; Hsu, C Liang; Voss, Michelle W; Chan, Alison; Bolandzadeh, Niousha; Handy, Todd C; Graf, Peter; Beattie, B Lynn; Liu-Ambrose, Teresa
2016-01-01
Falls are a major health-care concern, and while dual-task performance is widely recognized as being impaired in those at-risk for falls, the underlying neurocognitive mechanisms remain unknown. A better understanding of the underlying mechanisms could lead to the refinement and development of behavioral, cognitive, or neuropharmacological interventions for falls prevention. Therefore, we conducted a cross-sectional study with community-dwelling older adults aged 70-80 years with a history of falls (i.e., two or more falls in the past 12 months) or no history of falls (i.e., zero falls in the past 12 months); n = 28 per group. We compared functional activation during cognitive-based dual-task performance between fallers and non-fallers using functional magnetic resonance imaging (fMRI). Executive cognitive functioning was assessed via Stroop, Trail Making, and Digit Span. Mobility was assessed via the Timed Up and Go test (TUG). We found that non-fallers exhibited significantly greater functional activation compared with fallers during dual-task performance in key regions responsible for resolving dual-task interference, including precentral, postcentral, and lingual gyri. Further, we report slower reaction times during dual-task performance in fallers and significant correlations between level of functional activation and independent measures of executive cognitive functioning and mobility. Our study is the first neuroimaging study to examine dual-task performance in fallers, and supports the notion that fallers have reduced functional brain activation compared with non-fallers. Given that dual-task performance-and the underlying neural concomitants-appears to be malleable with relevant training, our study serves as a launching point for promising strategies to reduce falls in the future.
Roper resonances and generator coordinate method in the chiral-soliton model
International Nuclear Information System (INIS)
Meissner, T.; Gruemmer, F.; Goeke, K.; Harvey, M.
1989-01-01
The nucleon and Δ Roper resonances are described by means of the generator coordinate method in the framework of the nontopological chiral-soliton model. Solitons with various sizes are constructed with a constrained variational technique. The masses of all known Roper resonances come out to within 150 MeV of their experimental values. A nucleon compression modulus of about 4 GeV is extracted. The limits of the approach due to the polarization of the Dirac vacuum are displayed
Model of charge-state distributions for electron cyclotron resonance ion source plasmas
Directory of Open Access Journals (Sweden)
D. H. Edgell
1999-12-01
Full Text Available A computer model for the ion charge-state distribution (CSD in an electron cyclotron resonance ion source (ECRIS plasma is presented that incorporates non-Maxwellian distribution functions, multiple atomic species, and ion confinement due to the ambipolar potential well that arises from confinement of the electron cyclotron resonance (ECR heated electrons. Atomic processes incorporated into the model include multiple ionization and multiple charge exchange with rate coefficients calculated for non-Maxwellian electron distributions. The electron distribution function is calculated using a Fokker-Planck code with an ECR heating term. This eliminates the electron temperature as an arbitrary user input. The model produces results that are a good match to CSD data from the ANL-ECRII ECRIS. Extending the model to 1D axial will also allow the model to determine the plasma and electrostatic potential profiles, further eliminating arbitrary user input to the model.
Xu, Xiaolun; Li, Yongqian; Wang, Binbin; Zhou, Zili
2015-10-01
The resonance characteristics of plasmonic metamaterials absorbers (PMAs) are strongly dependent on geometric parameters. A resistor-inductor-capacitor (RLC) circuit model has been extended to predict the resonance wavelengths and the bandwidths of multiple magnetic polaritons modes in PMAs. For a typical metallic-dielectric-metallic structure absorber working in the infrared region, the developed model describes the correlation between the resonance characteristics and the dimensional sizes. In particular, the RLC model is suitable for not only the fundamental resonance mode, but also for the second- and third-order resonance modes. The prediction of the resonance characteristics agrees fairly well with those calculated by the finite-difference time-domain simulation and the experimental results. The developed RLC model enables the facilitation of designing multi-band PMAs for infrared radiation detectors and thermal emitters.
A model for precalculus students to determine the resonance frequency of a trumpet mouthpiece
Chapman, Robert C.
2004-05-01
The trumpet mouthpiece as a Helmholtz resonator is used to show precalculus students a mathematical model for determining the approximate resonance frequency of the mouthpiece. The mathematics is limited to algebra and trigonometry. Using a system of mouthpieces that have interchangeable cups and backbores, students are introduced to the acoustics of this resonator. By gathering data on 51 different configurations of mouthpieces, the author modifies the existing Helmholtz resonator equation to account for both cup volumes and backbore configurations. Students then use this model for frequency predictions. Included are how to measure the different physical attributes of a trumpet mouthpiece at minimal cost. This includes methods for measuring cup volume, backbore volume, backbore length, throat area, etc. A portion of this phase is de-signed for students to become acquainted with some of the vocabulary of acoustics and the physics of sound.
The Dual Rounding Model: Forging Therapeutic Alliances in Oncology and Palliative Care.
Baxley, Carey E
2016-04-01
Inpatients with solid tumors at Duke University Hospital in Durham, NC, are cared for in a dynamic integrated care model that incorporates medical oncology and palliative care. This has profound implications for patients, their loved ones, medical and surgical staff, and oncology nurses. As a nurse with less than three years of experience, my participation in a setting that uses the Dual Rounding Model has accelerated my professional and personal development. During a typical shift, I am an oncology nurse, a palliative care nurse, and a hospice nurse. .
Modeling laser brightness from cross Porro prism resonators
Forbes, Andrew; Burger, Liesl; Litvin, Igor Anatolievich
2006-08-01
Laser brightness is a parameter often used to compare high power laser beam delivery from various sources, and incorporates both the power contained in the particular mode, as well as the propagation of that mode through the beam quality factor, M2. In this study a cross Porro prism resonator is considered; crossed Porro prism resonators have been known for some time, but until recently have not been modeled as a complete physical optics system that allows the modal output to be determined as a function of the rotation angle of the prisms. In this paper we consider the diffraction losses as a function of the prism rotation angle relative to one another, and combine this with the propagation of the specific modes to determine the laser output brightness as a function of the prism orientation.
Biess, J. J.; Inouye, L. Y.; Shank, J. H.
1974-01-01
A high-voltage, high-power LC series resonant inverter using SCRs has been developed for an Ion Engine Power Processor. The inverter operates within 200-400Vdc with a maximum output power of 2.5kW. The inverter control logic, the screen supply electrical and mechanical characteristics, the efficiency and losses in power components, regulation on the dual feedback principle, the SCR waveforms and the component weight are analyzed. Efficiency of 90.5% and weight density of 4.1kg/kW are obtained.
Dual parton model and the process π + n → pω
International Nuclear Information System (INIS)
Bandyopad, P.
1975-01-01
The differential cross section for the process π + n→pω has been determined on the basis of the dynamical dual model of hadrons. It is shown that the theoretical prediction is in excellent agreement with the experimental results. Also, it can nicely explain the fact that there is no dip in the differential cross section. Moreover, it is shown that the large value of the density matrix element σsub(oo) in the Gottfried-Jackson frame, as observed in experiments, can be interpreted in a nice way. (author)
A Squeeze-film Damping Model for the Circular Torsion Micro-resonators
Yang, Fan; Li, Pu
2017-07-01
In recent years, MEMS devices are widely used in many industries. The prediction of squeeze-film damping is very important for the research of high quality factor resonators. In the past, there have been many analytical models predicting the squeeze-film damping of the torsion micro-resonators. However, for the circular torsion micro-plate, the works over it is very rare. The only model presented by Xia et al[7] using the method of eigenfunction expansions. In this paper, The Bessel series solution is used to solve the Reynolds equation under the assumption of the incompressible gas of the gap, the pressure distribution of the gas between two micro-plates is obtained. Then the analytical expression for the damping constant of the device is derived. The result of the present model matches very well with the finite element method (FEM) solutions and the result of Xia’s model, so the present models’ accuracy is able to be validated.
International Nuclear Information System (INIS)
Sourrouille, Lucas; Casana, Rodolfo
2016-01-01
We have studied the existence of self-dual solitonic solutions in a generalization of the Abelian Chern-Simons-Higgs model. Such a generalization introduces two different nonnegative functions, ω_1(|ϕ|) and ω(|ϕ|), which split the kinetic term of the Higgs field, |D_μϕ|"2→ω_1(|ϕ|)|D_0ϕ|"2-ω(|ϕ|)|D_kϕ|"2, breaking explicitly the Lorentz covariance. We have shown that a clean implementation of the Bogomolnyi procedure only can be implemented whether ω(|ϕ|)∝β|ϕ|"2"β"-"2 with β≥1. The self-dual or Bogomolnyi equations produce an infinity number of soliton solutions by choosing conveniently the generalizing function ω_1(|ϕ|) which must be able to provide a finite magnetic field. Also, we have shown that by properly choosing the generalizing functions it is possible to reproduce the Bogomolnyi equations of the Abelian Maxwell-Higgs and Chern-Simons-Higgs models. Finally, some new self-dual |ϕ|"6-vortex solutions have been analyzed from both theoretical and numerical point of view.
International Nuclear Information System (INIS)
Dunne, Lawrence J; Axelsson, Anna-Karin; Alford, Neil McN; Valant, Matjaz; Manos, George
2011-01-01
Despite considerable effort, the microscopic origin of the electrocaloric (EC) effect in ferroelectric relaxors is still intensely discussed. Ferroelectric relaxors typically display a dual-peak EC effect, whose origin is uncertain. Here we present an exact statistical mechanical matrix treatment of a lattice model of polar nanoregions forming in a neutral background and use this approach to study the characteristics of the EC effect in ferroelectric relaxors under varying electric field and pressure. The dual peaks seen in the EC properties of ferroelectric relaxors are due to the formation and ordering of polar nanoregions. The model predicts significant enhancement of the EC temperature rise with pressure which may have some contribution to the giant EC effect.
Dual-probe spectroscopic fingerprints of defects in graphene
DEFF Research Database (Denmark)
Settnes, Mikkel; Power, Stephen; Petersen, Dirch Hjorth
2014-01-01
(e.g., an extended graphene sheet). Applying this method, we study the transport anisotropies in pristine graphene sheets, and analyze the spectroscopic fingerprints arising from quantum interference around single-site defects, such as vacancies and adatoms. Furthermore, we demonstrate that the dual......-probe setup is a useful tool for characterizing the electronic transport properties of extended defects or designed nanostructures. In particular, we show that nanoscale perforations, or antidots, in a graphene sheet display Fano-type resonances with a strong dependence on the edge geometry of the perforation....
Dual Dynamic Programming - DDP
International Nuclear Information System (INIS)
Velasquez Bermudez, Jesus M
1998-01-01
Objections are presented to the mathematical formulation of the denominated Dual Dynamic programming-PDD that is the theoretical base of several computational model available for the optimal formulation of interconnected hydrothermal systems
PZT crack detection in suspension-based dual stage actuator [for HDDs
Yung Ping Yeh; Ku, C
2000-01-01
An impedance method is proposed to detect cracks of PZT bars in suspension based dual stage-actuators. The frequency response amplitude of impedance at the resonance of 1.95 MHz, the PZT bar width extension mode, was very sensitive to the cracks in PZT material. As cracks in the PZT bars propagated from invisible micro cracks to visible macro cracks, the impedance gain at 1.95 MHz dropped suddenly. (3 refs).
Magnetic resonance imaging of local soft tissue inflammation using gadolinium-DTPA
International Nuclear Information System (INIS)
Paajanen, H.; Brasch, R.C.; Schmiedl, U.; Ogan, M.
1987-01-01
Chemical inflammation was induced subcutaneously in 10 rats using carrageenan mucopolysaccharide. Dual spin echo (SE) imaging of inflammatory loci was performed employing a 0.35 tesla resistive magnet. In addition, gadolinium-DTPA was administrated intravenously into 5 rats to evaluate the potential benefits of paramagnetic contrast medium for the detection and characterization of inflammatory loci. T2 weighted SE images demonstrated the edematous lesions as zones of high intensity. This was attributed to the increased relaxation times of lesions when compared to the adjacent soft tissue. The inflammation was also delineated on T1 weighted SE images, but only after injection of paramagnetic Gd-DTPA. Carrageenan mucopolysaccharide-induced lesions provide a useful experimental model for in viva evaluation of soft tissue inflammation using magnetic resonance imaging. No special benefit of paramagnetic contrast enhancement was demonstrated in this model of local edema. (orig.)
Directory of Open Access Journals (Sweden)
Bart W. Hoogenboom
2012-05-01
Full Text Available Micromechanic resonators provide a small-volume and potentially high-throughput method to determine rheological properties of fluids. Here we explore the accuracy in measuring mass density and viscosity of ethanol-water and glycerol-water model solutions, using a simple and easily implemented model to deduce the hydrodynamic effects on resonating cantilevers of various length-to-width aspect ratios. We next show that these measurements can be extended to determine the alcohol percentage of both model solutions and commercial beverages such as beer, wine and liquor. This demonstrates how micromechanical resonators can be used for quality control of every-day drinks.
Multi-Criteria Decision-Making Model for the Material Flow of Resonant Wood Production
Directory of Open Access Journals (Sweden)
Patrik Aláč
2017-03-01
Full Text Available This paper proposes a multi-criteria decision-making model, for the selection and evaluation of the most valuable wooden input—resonant wood. Application of a given model can improve the process of input valuation as well as impact and improve particular economic indicators for the resonant wood manufacturer. We have tried to describe and evaluate the supply chain of resonant wood manufacturing and production of musical instruments. Particular value-added and non-value-added activities have been chosen according to the logical sequence of technology. Then, concrete criteria were specified and their significance weightings. Another important part of our paper is the description of resonant wood, specifications, and demands on log and wood species. There are some important physical and mechanical properties which should be taken into account and evaluated during the production of musical instruments. By the application of this model, a particular enterprise can reach an enhanced tool for the continuous evaluation of the product flowing through the supply chain. Visibility of particular operations and their logical sequence, presented by Petri nets, can lead to easier detection of possible defects in these operations and their origin. So, the main purpose of the paper lies in the suggestion of an objective and quantified managerial tool for the decision making.
Dual Credit/Dual Enrollment and Data Driven Policy Implementation
Lichtenberger, Eric; Witt, M. Allison; Blankenberger, Bob; Franklin, Doug
2014-01-01
The use of dual credit has been expanding rapidly. Dual credit is a college course taken by a high school student for which both college and high school credit is given. Previous studies provided limited quantitative evidence that dual credit/dual enrollment is directly connected to positive student outcomes. In this study, predictive statistics…
Kang, Bo-Kyeong; Yu, Eun Sil; Lee, Seung Soo; Lee, Youngjoo; Kim, Namkug; Sirlin, Claude B; Cho, Eun Yoon; Yeom, Suk Keu; Byun, Jae Ho; Park, Seong Ho; Lee, Moon-Gyu
2012-06-01
The aims of this study were to assess the confounding effects of hepatic iron deposition, inflammation, and fibrosis on hepatic steatosis (HS) evaluation by magnetic resonance imaging (MRI) and magnetic resonance spectroscopy (MRS) and to assess the accuracies of MRI and MRS for HS evaluation, using histology as the reference standard. In this institutional review board-approved prospective study, 56 patients gave informed consents and underwent chemical-shift MRI and MRS of the liver on a 1.5-T magnetic resonance scanner. To estimate MRI fat fraction (FF), 4 analysis methods were used (dual-echo, triple-echo, multiecho, and multi-interference), and MRS FF was calculated with T2 correction. Degrees of HS, iron deposition, inflammation, and fibrosis were analyzed in liver resection (n = 37) and biopsy (n = 19) specimens. The confounding effects of histology on fat quantification were assessed by multiple linear regression analysis. Using the histologic degree of HS as the reference standard, the accuracies of each method in estimating HS and diagnosing an HS of 5% or greater were determined by linear regression and receiver operating characteristic analyses. Iron deposition significantly confounded estimations of FF by the dual-echo (P hepatic fat, with coexisting histologic abnormalities having no confounding effects.
RECONSTRUCTION OF HUMAN LUNG MORPHOLOGY MODELS FROM MAGNETIC RESONANCE IMAGES
Reconstruction of Human Lung Morphology Models from Magnetic Resonance ImagesT. B. Martonen (Experimental Toxicology Division, U.S. EPA, Research Triangle Park, NC 27709) and K. K. Isaacs (School of Public Health, University of North Carolina, Chapel Hill, NC 27514)
Quantum damped oscillator I: Dissipation and resonances
International Nuclear Information System (INIS)
Chruscinski, Dariusz; Jurkowski, Jacek
2006-01-01
Quantization of a damped harmonic oscillator leads to so called Bateman's dual system. The corresponding Bateman's Hamiltonian, being a self-adjoint operator, displays the discrete family of complex eigenvalues. We show that they correspond to the poles of energy eigenvectors and the corresponding resolvent operator when continued to the complex energy plane. Therefore, the corresponding generalized eigenvectors may be interpreted as resonant states which are responsible for the irreversible quantum dynamics of a damped harmonic oscillator
Dual diathesis-stressor model of emotional and linguistic contributions to developmental stuttering.
Walden, Tedra A; Frankel, Carl B; Buhr, Anthony P; Johnson, Kia N; Conture, Edward G; Karrass, Jan M
2012-05-01
This study assessed emotional and speech-language contributions to childhood stuttering. A dual diathesis-stressor framework guided this study, in which both linguistic requirements and skills, and emotion and its regulation, are hypothesized to contribute to stuttering. The language diathesis consists of expressive and receptive language skills. The emotion diathesis consists of proclivities to emotional reactivity and regulation of emotion, and the emotion stressor consists of experimentally manipulated emotional inductions prior to narrative speaking tasks. Preschool-age children who do and do not stutter were exposed to three emotion-producing overheard conversations-neutral, positive, and angry. Emotion and emotion-regulatory behaviors were coded while participants listened to each conversation and while telling a story after each overheard conversation. Instances of stuttering during each story were counted. Although there was no main effect of conversation type, results indicated that stuttering in preschool-age children is influenced by emotion and language diatheses, as well as coping strategies and situational emotional stressors. Findings support the dual diathesis-stressor model of stuttering.
Saab, Rim; Tausch, Nicole; Spears, Russell; Cheung, Wing-Yee
We examined predictors of collective action among bystander group members in solidarity with a disadvantaged group by extending the dual pathway model of collective action, which proposes one efficacy-based and one emotion-based path to collective action (Van Zomeren, Spears, Fischer, & Leach,
Electromagnetic energy harvesting from a dual-mass pendulum oscillator
Wang, Hongyan; Tang, Jiong
2016-04-01
This paper presents the analysis of a type of vibration energy harvester composed of an electromagnetic pendulum oscillator combined to an elastic main structure. In this study, the elastic main structure connected to the base is considered as a single degree-of-freedom (DOF) spring-mass-damper subsystem. The electromagnetic pendulum oscillator is considered as a dual-mass two-frequency subsystem, which is composed of a hollow bar with a tip winded coil and a magnetic mass with a spring located in the hollow bar. As the pendulum swings, the magnetic mass can move along the axial direction of the bar. Thus, the relative motion between the magnet and the coil induces a wire current. A mathematical model of the coupled system is established. The system dynamics a 1:2:1 internal resonance. Parametric analysis is carried out to demonstrate the effect of the excitation acceleration, excitation frequency, load resistance, and frequency tuning parameters on system performance.
Terahertz-wave differential detection based on simultaneous dual-wavelength up-conversion
Directory of Open Access Journals (Sweden)
Yuma Takida
2017-03-01
Full Text Available We report a terahertz (THz-wave differential detection based on simultaneous dual-wavelength up-conversion in a nonlinear optical MgO:LiNbO3 crystal with optical and electronic THz-wave sources. The broadband parametric gain and noncollinear phase-matching of MgO:LiNbO3 provide efficient conversion from superposed THz waves to spatially distributed near-infrared (NIR beams to function as a dispersive THz-wave spectrometer without any additional dispersive element. We show that the μW-level THz waves from two independent sources, a 0.78-THz injection-seeded THz-wave parametric generator (is-TPG and a 1.14-THz resonant tunneling diode (RTD, are simultaneously up-converted to two NIR waves and then detected with two NIR photodetectors. By applying a balanced detection scheme to this dual-frequency detection, we demonstrate THz-wave differential imaging of maltose and polyethylene pellets in the transmission geometry. This dual-wavelength detection is applicable to more than three frequencies and broadband THz-wave radiation for real-time THz-wave spectroscopic detection and imaging.
Modelling out-of-plane and in-plane resonant modes of microplates in liquid media
International Nuclear Information System (INIS)
Ruiz-Díez, V; Hernando-García, J; Manzaneque, T; Sánchez-Rojas, J L; Kucera, M; Schmid, U
2015-01-01
In this article, the quality factor and the resonant frequency of different vibrating modes of microplates immersed in liquid are simulated by means of a finite element method (FEM) and compared with experimental data. For the in-plane modes, we studied the first extensional mode of mid-point supported microplates, which may be efficiently actuated by a thin piezoelectric film on top of the structure. A comparison of different approaches to account for the viscous loading in computationally efficient 2D finite element models is presented. As an alternative to the harmonic response, a novel multitone excitation in the fluid–structure interaction model allows for the calculation of the frequency response of the structure. For the out-of-plane modes, different modes were simulated and compared to analytical models to validate our approach. Our 2D FEM model yields more accurate estimations of the experimental resonance frequency and quality factors than the available analytical models. With the help of these tools, the applicability of the micro-resonators as viscosity and density sensors is discussed. (paper)
On the algebraic structure of self-dual gauge fields and sigma models
International Nuclear Information System (INIS)
Bais, F.A.; Sasaki, R.
1983-01-01
An extensive and detailed analysis of self-dual gauge fields, in particular with axial symmetry, is presented, culminating in a purely algebraic procedure to generate solutions. The method which is particularly suited for the construction of multimonopole solutions for a theory with arbitrary G, is also applicable to a wide class of non-linear sigma models. The relevant symmetries as well as the associated linear problems which underly the exact solubility of the problem, are constructed and discussed in detail. (orig.)
Hu, Weiming; Tian, Guodong; Kang, Yongxin; Yuan, Chunfeng; Maybank, Stephen
2017-09-25
In this paper, a new nonparametric Bayesian model called the dual sticky hierarchical Dirichlet process hidden Markov model (HDP-HMM) is proposed for mining activities from a collection of time series data such as trajectories. All the time series data are clustered. Each cluster of time series data, corresponding to a motion pattern, is modeled by an HMM. Our model postulates a set of HMMs that share a common set of states (topics in an analogy with topic models for document processing), but have unique transition distributions. For the application to motion trajectory modeling, topics correspond to motion activities. The learnt topics are clustered into atomic activities which are assigned predicates. We propose a Bayesian inference method to decompose a given trajectory into a sequence of atomic activities. On combining the learnt sources and sinks, semantic motion regions, and the learnt sequence of atomic activities, the action represented by the trajectory can be described in natural language in as automatic a way as possible. The effectiveness of our dual sticky HDP-HMM is validated on several trajectory datasets. The effectiveness of the natural language descriptions for motions is demonstrated on the vehicle trajectories extracted from a traffic scene.
Transmission line model for coupled rectangular double split‐ring resonators
DEFF Research Database (Denmark)
Yan, Lei; Tang, Meng; Krozer, Viktor
2011-01-01
In this work, a model based on a coupled transmission line formulation is developed for microstrip rectangular double split‐ring resonators (DSRRs). This model allows using the physical dimensions of the DSRRs as an input avoiding commonly used extraction of equivalent parameters. The model inclu...... simulations of the DSRR structures. © 2011 Wiley Periodicals, Inc. Microwave Opt Technol Lett 53:1311–1315, 2011; View this article online at wileyonlinelibrary.com. DOI 10.1002/mop.25988...
Directory of Open Access Journals (Sweden)
Leon T.B. Jackson
2013-09-01
Full Text Available Orientation: The study addresses the question of how employees of the South African Police Service (SAPS cope with intercultural relations in an increasingly diverse organisation. Research purpose: A dual-process model of diversity outcomes was tested in which a distinction is made between a positive (work-related stream that links positive diversity conditions through active coping to work outcomes and a relatively independent health related stream of negative antecedents, mediating passive coping skills and ill-health related outcomes. Motivation for the study: To test the viability of a dual-process model to understand diversity outcomes in the workplace. Research design, approach and methods: A convenience sample (n= 158 was recruited from members of the SAPS in Gauteng, using a cross-sectional design. Instruments used in previous acculturation research were adapted to measure contextual factors, coping and diversity outcomes. Main findings: A very good fit for the proposed hypothetical model was found. Approach coping partially mediated the relationship between positive acculturation conditions and the subjective experience of work success whereas avoidance coping fully mediated the relationship between discrimination, and ill-health symptoms are related to ill-health symptoms. Practical/managerial implications: Mainstream-facilitating conditions and discrimination influence individual coping styles, which in turn impact on ill-health and the subjective experience of work success. In addition, ill-health also impacts negatively on work-success experiences amongst the sampled SAPS members. It would thus make sense for the SAPS to sanction discrimination. Contribution/value added: A variation of the mediated dual-process model for diversity (Jackson & Van de Vijver, in press, using coping strategies as mediators was supported. The model adds new insights in diversity in organisations.
Asymptotically exact solution of the multi-channel resonant-level model
International Nuclear Information System (INIS)
Zhang Guangming; Su Zhaobin; Yu Lu.
1994-01-01
An asymptotically exact partition function of the multi-channel resonant-level model is obtained through Tomonaga-Luttinger bosonization. A Fermi-liquid vs. non-Fermi-liquid transition, resulting from a competition between the Kondo and X-ray edge physics, is elucidated explicitly via the renormalization group theory. In the strong-coupling limit, the model is renormalized to the Toulouse limit. (author). 20 refs, 1 fig
Dual-joint modeling for estimation of total knee replacement contact forces during locomotion.
Hast, Michael W; Piazza, Stephen J
2013-02-01
Model-based estimation of in vivo contact forces arising between components of a total knee replacement is challenging because such forces depend upon accurate modeling of muscles, tendons, ligaments, contact, and multibody dynamics. Here we describe an approach to solving this problem with results that are tested by comparison to knee loads measured in vivo for a single subject and made available through the Grand Challenge Competition to Predict in vivo Tibiofemoral Loads. The approach makes use of a "dual-joint" paradigm in which the knee joint is alternately represented by (1) a ball-joint knee for inverse dynamic computation of required muscle controls and (2) a 12 degree-of-freedom (DOF) knee with elastic foundation contact at the tibiofemoral and patellofemoral articulations for forward dynamic integration. Measured external forces and kinematics were applied as a feedback controller and static optimization attempted to track measured knee flexion angles and electromyographic (EMG) activity. The resulting simulations showed excellent tracking of knee flexion (average RMS error of 2.53 deg) and EMG (muscle activations within ±10% envelopes of normalized measured EMG signals). Simulated tibiofemoral contact forces agreed qualitatively with measured contact forces, but their RMS errors were approximately 25% of the peak measured values. These results demonstrate the potential of a dual-joint modeling approach to predict joint contact forces from kinesiological data measured in the motion laboratory. It is anticipated that errors in the estimation of contact force will be reduced as more accurate subject-specific models of muscles and other soft tissues are developed.
An analytical model for the determination of resonance frequencies of perforated beams
International Nuclear Information System (INIS)
Luschi, Luca; Pieri, Francesco
2014-01-01
In this paper, we develop closed expressions for the equivalent bending and shear stiffness of beams with regular square perforations, and apply them to the problem of determining the resonance frequencies of slender, regularly perforated clamped–clamped beams, which are of interest in the development of MEMS resonant devices. We prove that, depending on the perforation size, the Euler–Bernoulli equation or the more complex shear equation needs to be used to obtain accurate values for these frequencies. Extensive finite element method simulations are used to validate the proposed model over the full practical range of possible hole sizes. An experimental verification of the model is also presented. (paper)
Partial widths of boson resonances in the quark-gluon model of strong interactions
International Nuclear Information System (INIS)
Kaidalov, A.B.; Volkovitsky, P.E.
1981-01-01
The quark-gluon model of strong interactions based on the topological expansion and the string model ib used for the calculation of the partial widths of boson resonances in the channels with two pseudoscalar mesons. The partial widths of mesons with arbitrary spins lying on the vector and tensor Regge trajectories are expressed in terms of the only rho-meson width. The violation of SU(3) symmetry increases with the growth of the spin of the resonance. The theoretical predictions are in a good agreement with experimental data [ru
Charge distributions and correlations in fragmentation models for soft hadron collisions
International Nuclear Information System (INIS)
Wolf, E.A. de
1984-01-01
Data on charge distributions and charge correlations in pp and meson-proton interactions at PS and SPS energies are successfully compared with the Lund fragmentation model for low-psub(T) hadron collisions. It is argued that local conservation of quantum numbers and resonance production, as implemented in fragmentation models, are sufficient ingredients to explain most of the available experimental results at these energies. No necessity is found for dual-sheet contributions considered in DTU-based parton models. (orig.)
Directory of Open Access Journals (Sweden)
Daolun Li
2015-01-01
Full Text Available A mathematical dual porosity and dual permeability numerical model based on perpendicular bisection (PEBI grid is developed to describe gas flow behaviors in shale-gas reservoirs by incorporating slippage corrected permeability and adsorbed gas effect. Parametric studies are conducted for a horizontal well with multiple infinite conductivity hydraulic fractures in shale-gas reservoir to investigate effect of matrix-wellbore flow, natural fracture porosity, and matrix porosity. We find that the ratio of fracture permeability to matrix permeability approximately decides the bottom hole pressure (BHP error caused by omitting the flow between matrix and wellbore and that the effect of matrix porosity on BHP is related to adsorption gas content. When adsorbed gas accounts for large proportion of the total gas storage in shale formation, matrix porosity only has a very small effect on BHP. Otherwise, it has obvious influence. This paper can help us understand the complex pressure transient response due to existence of the adsorbed gas and help petroleum engineers to interpret the field data better.
Modelling the dynamic mechanisms associated with the principal resonance of the seated human body.
Matsumoto, Y; Griffin, M J
2001-01-01
Simple mathematical models have been developed to obtain insights into resonance phenomena observed at about 5 Hz in the dynamic responses of the seated human body exposed to vertical whole-body vibration. Alternative lumped parameter models with a few degrees-of-freedom have been investigated. Rotational degrees-of-freedom, with eccentricity of the centre of gravity of the mass elements, represented responses in the fore-and-aft and pitch axes caused by vertical vibration. The causes of body resonance are not fully understood, but this information is required to develop cause-effect relationships between vibration exposures and effects on human health, comfort and performance.Method. The inertial and geometric parameters for models were based on published anatomical data. Other mechanical parameters were determined by comparing model responses to experimental data. Two models, with four and five degrees-of-freedom, gave more reasonable representations than other models. Mechanical parameters obtained with median and individual experimental data were consistent for vertical degrees-of-freedom but varied for rotational degrees-of-freedom. The resonance of the apparent mass at about 5 Hz may be attributed to a vibration mode consisting of vertical motion of the pelvis and legs and a pitch motion of the pelvis, both of which cause vertical motion of the upper-body above the pelvis, a bending motion of the spine, and vertical motion of the viscera. The mathematical models developed in this study may assist understanding of the dynamic mechanisms responsible for resonances in the seated human body. The information is required to represent mechanical responses of the body and assist the development of models for specific effects of vibration.
Förner, K.; Polifke, W.
2017-10-01
The nonlinear acoustic behavior of Helmholtz resonators is characterized by a data-based reduced-order model, which is obtained by a combination of high-resolution CFD simulation and system identification. It is shown that even in the nonlinear regime, a linear model is capable of describing the reflection behavior at a particular amplitude with quantitative accuracy. This observation motivates to choose a local-linear model structure for this study, which consists of a network of parallel linear submodels. A so-called fuzzy-neuron layer distributes the input signal over the linear submodels, depending on the root mean square of the particle velocity at the resonator surface. The resulting model structure is referred to as an local-linear neuro-fuzzy network. System identification techniques are used to estimate the free parameters of this model from training data. The training data are generated by CFD simulations of the resonator, with persistent acoustic excitation over a wide range of frequencies and sound pressure levels. The estimated nonlinear, reduced-order models show good agreement with CFD and experimental data over a wide range of amplitudes for several test cases.
Model-based crosstalk compensation for simultaneous 99mTc/123I dual-isotope brain SPECT imaging.
Du, Yong; Tsui, Benjamin M W; Frey, Eric C
2007-09-01
In this work, we developed a model-based method to estimate and compensate for the crosstalk contamination in simultaneous 123I and 99mTc dual isotope brain single photo emission computed tomography imaging. The model-based crosstalk compensation (MBCC) includes detailed modeling of photon interactions inside both the object and the detector system. In the method, scatter in the object is modeled using the effective source scatter estimation technique, including contributions from all the photon emissions. The effects of the collimator-detector response, including the penetration and scatter components due to high-energy 123I photons, are modeled using precalculated tables of Monte Carlo simulated point-source response functions obtained from sources in air at various distances from the face of the collimator. The model-based crosstalk estimation method was combined with iterative reconstruction based compensation to reduce contamination due to crosstalk. The MBCC method was evaluated using Monte Carlo simulated and physical phantom experimentally acquired simultaneous dual-isotope data. Results showed that, for both experimental and simulation studies, the model-based method provided crosstalk estimates that were in good agreement with the true crosstalk. Compensation using MBCC improved image contrast and removed the artifacts for both Monte Carlo simulated and experimentally acquired data. The results were in good agreement with images acquired without any crosstalk contamination.
Model-based crosstalk compensation for simultaneous Tc99m∕I123 dual-isotope brain SPECT imaging.
Du, Yong; Tsui, Benjamin M W; Frey, Eric C
2007-09-01
In this work, we developed a model-based method to estimate and compensate for the crosstalk contamination in simultaneous I123 and Tc99m dual isotope brain single photo emission computed tomography imaging. The model-based crosstalk compensation (MBCC) includes detailed modeling of photon interactions inside both the object and the detector system. In the method, scatter in the object is modeled using the effective source scatter estimation technique, including contributions from all the photon emissions. The effects of the collimator-detector response, including the penetration and scatter components due to high-energy I123 photons, are modeled using pre-calculated tables of Monte Carlo simulated point-source response functions obtained from sources in air at various distances from the face of the collimator. The model-based crosstalk estimation method was combined with iterative reconstruction based compensation to reduce contamination due to crosstalk. The MBCC method was evaluated using Monte Carlo simulated and physical phantom experimentally acquired simultaneous dual-isotope data. Results showed that, for both experimental and simulation studies, the model-based method provided crosstalk estimates that were in good agreement with the true crosstalk. Compensation using MBCC improved image contrast and removed the artifacts for both Monte Carlo simulated and experimentally acquired data. The results were in good agreement with images acquired without any crosstalk contamination. © 2007 American Association of Physicists in Medicine.
M. Oudkerk (Matthijs); C.G. Torres; B. Song; M. Konig; J. Grimm; J. Fernandez-Cuadrado; B. op de Beeck; M. Marquardt; P. van Dijk (Pieter); J.C. de Groot (Jan Cees)
2002-01-01
textabstractPURPOSE: To evaluate whether mangafodipir trisodium (Mn-DPDP)-enhanced magnetic resonance (MR) imaging surpasses dual-phase spiral computed tomography (CT) in differentiating focal liver lesions. MATERIALS AND METHODS: One hundred forty-five patients who had or were
Testing the dual-route model of perceived gaze direction: Linear combination of eye and head cues.
Otsuka, Yumiko; Mareschal, Isabelle; Clifford, Colin W G
2016-06-01
We have recently proposed a dual-route model of the effect of head orientation on perceived gaze direction (Otsuka, Mareschal, Calder, & Clifford, 2014; Otsuka, Mareschal, & Clifford, 2015), which computes perceived gaze direction as a linear combination of eye orientation and head orientation. By parametrically manipulating eye orientation and head orientation, we tested the adequacy of a linear model to account for the effect of horizontal head orientation on perceived direction of gaze. Here, participants adjusted an on-screen pointer toward the perceived gaze direction in two image conditions: Normal condition and Wollaston condition. Images in the Normal condition included a change in the visible part of the eye along with the change in head orientation, while images in the Wollaston condition were manipulated to have identical eye regions across head orientations. Multiple regression analysis with explanatory variables of eye orientation and head orientation revealed that linear models account for most of the variance both in the Normal condition and in the Wollaston condition. Further, we found no evidence that the model with a nonlinear term explains significantly more variance. Thus, the current study supports the dual-route model that computes the perceived gaze direction as a linear combination of eye orientation and head orientation.
Dual-band and high-efficiency polarization converter based on metasurfaces at microwave frequencies
Liu, Yajun; Xia, Song; Shi, Hongyu; Zhang, Anxue; Xu, Zhuo
2016-06-01
We present a dual-band and high-efficiency polarization converter in microwave regime. The proposed converter can convert a linearly polarized wave to its cross-polarized wave for two distinct bands: Ku (11.5-20.0 GHz) and Ka (28.8-34.0 GHz). It can also convert the linearly polarized wave to a circularly polarized wave at four other frequencies. The experimental results are in good agreement with simulation results for both frequency bands. The polarization conversion ratio is above 0.94 for the Ku-band and 0.90 for the Ka-band. Furthermore, the converter can achieve dual-band and high-efficiency polarization conversion over angles of incidence up to 45°. The converter is also polarization-selective in that only the x- and y-polarized waves can be converted. The physical mechanism of the dual-band polarization conversion effect is interpreted via decomposed electric field components that couple with different plasmon resonance modes of the structure.
Mathematical Model of Thyristor Inverter Including a Series-parallel Resonant Circuit
Miroslaw Luft; Elzbieta Szychta
2008-01-01
The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with theaid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.
Optical model calculation for the unresolved/resolved resonance region of Fe-56
Energy Technology Data Exchange (ETDEWEB)
Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Froehner, F.H.
1997-03-01
We have studied optical model fits to total neutron cross sections of structural materials using the accurate data base for {sup 56}Fe existing in the resolved and unresolved resonance region. Averages over resolved resonances were calculated with Lorentzian weighting in Reich-Moore (reduced R matrix) approximation. Starting from the best available optical potentials we found that adjustment of the real and imaginary well depths does not work satisfactorily with the conventional weak linear energy dependence of the well depths. If, however, the linear dependences are modified towards low energies, the average total cross sections can be fitted quite well, from the resolved resonance region up to 20 MeV and higher. (author)
Simultaneous multislice magnetic resonance fingerprinting with low-rank and subspace modeling.
Bo Zhao; Bilgic, Berkin; Adalsteinsson, Elfar; Griswold, Mark A; Wald, Lawrence L; Setsompop, Kawin
2017-07-01
Magnetic resonance fingerprinting (MRF) is a new quantitative imaging paradigm that enables simultaneous acquisition of multiple magnetic resonance tissue parameters (e.g., T 1 , T 2 , and spin density). Recently, MRF has been integrated with simultaneous multislice (SMS) acquisitions to enable volumetric imaging with faster scan time. In this paper, we present a new image reconstruction method based on low-rank and subspace modeling for improved SMS-MRF. Here the low-rank model exploits strong spatiotemporal correlation among contrast-weighted images, while the subspace model captures the temporal evolution of magnetization dynamics. With the proposed model, the image reconstruction problem is formulated as a convex optimization problem, for which we develop an algorithm based on variable splitting and the alternating direction method of multipliers. The performance of the proposed method has been evaluated by numerical experiments, and the results demonstrate that the proposed method leads to improved accuracy over the conventional approach. Practically, the proposed method has a potential to allow for a 3× speedup with minimal reconstruction error, resulting in less than 5 sec imaging time per slice.
Simultaneous live cell imaging using dual FRET sensors with a single excitation light.
Directory of Open Access Journals (Sweden)
Yusuke Niino
Full Text Available Fluorescence resonance energy transfer (FRET between fluorescent proteins is a powerful tool for visualization of signal transduction in living cells, and recently, some strategies for imaging of dual FRET pairs in a single cell have been reported. However, these necessitate alteration of excitation light between two different wavelengths to avoid the spectral overlap, resulting in sequential detection with a lag time. Thus, to follow fast signal dynamics or signal changes in highly motile cells, a single-excitation dual-FRET method should be required. Here we reported this by using four-color imaging with a single excitation light and subsequent linear unmixing to distinguish fluorescent proteins. We constructed new FRET sensors with Sapphire/RFP to combine with CFP/YFP, and accomplished simultaneous imaging of cAMP and cGMP in single cells. We confirmed that signal amplitude of our dual FRET measurement is comparable to of conventional single FRET measurement. Finally, we demonstrated to monitor both intracellular Ca(2+ and cAMP in highly motile cardiac myocytes. To cancel out artifacts caused by the movement of the cell, this method expands the applicability of the combined use of dual FRET sensors for cell samples with high motility.
Directory of Open Access Journals (Sweden)
Irena Cosic
2016-06-01
Full Text Available The meaning and influence of light to biomolecular interactions, and consequently to health, has been analyzed using the Resonant Recognition Model (RRM. The RRM proposes that biological processes/interactions are based on electromagnetic resonances between interacting biomolecules at specific electromagnetic frequencies within the infra-red, visible and ultra-violet frequency ranges, where each interaction can be identified by the certain frequency critical for resonant activation of specific biological activities of proteins and DNA. We found that: (1 the various biological interactions could be grouped according to their resonant frequency into super families of these functions, enabling simpler analyses of these interactions and consequently analyses of influence of electromagnetic frequencies to health; (2 the RRM spectrum of all analyzed biological functions/interactions is the same as the spectrum of the sun light on the Earth, which is in accordance with fact that life is sustained by the sun light; (3 the water is transparent to RRM frequencies, enabling proteins and DNA to interact without loss of energy; (4 the spectrum of some artificial sources of light, as opposed to the sun light, do not cover the whole RRM spectrum, causing concerns for disturbance to some biological functions and consequently we speculate that it can influence health.
Protein structure analysis using the resonant recognition model and wavelet transforms
International Nuclear Information System (INIS)
Fang, Q.; Cosic, I.
1998-01-01
An approach based on the resonant recognition model and the discrete wavelet transform is introduced here for characterising proteins' biological function. The protein sequence is converted into a numerical series by assigning the electron-ion interaction potential to each amino acid from N-terminal to C-terminal. A set of peaks is found after performing a wavelet transform onto a numerical series representing a group of homologous proteins. These peaks are related to protein structural and functional properties and named characteristic vector of that protein group. Further more, the amino acids contributing mostly to a protein's biological functions, the so-called 'hot spots' amino acids, are predicted by the continuous wavelet transform. It is found that the hot spots are clustered around the protein's cleft structure. The wavelets approach provides a novel methods for amino acid sequence analysis as well as an expansion for the newly established macromolecular interaction model: the resonant recognition model. Copyright (1998) Australasian Physical and Engineering Sciences in Medicine
Dynamical chiral-symmetry breaking in dual QCD
International Nuclear Information System (INIS)
Krein, G.; Williams, A.G.
1991-01-01
We have extended recent studies by Baker, Ball, and Zachariasen (BBZ) of dynamical chiral-symmetry breaking in dual QCD. Specifically, we have taken dual QCD to specify the nonperturbative infrared nature of the quark-quark interaction and then we have smoothly connected onto this the known leading-log perturbative QCD interaction in the ultraviolet region. In addition, we have solved for a momentum-dependent self-energy and have used the complete lowest-order dual QCD quark-quark interaction. We calculate the quark condensate left-angle bar qq right-angle and the pion decay constant f π within this model. We find that the dual QCD parameters needed to give acceptable results are reasonably consistent with those extracted from independent physical considerations by BBZ
Truncated Dual-Cap Nucleation Site Development
Matson, Douglas M.; Sander, Paul J.
2012-01-01
During heterogeneous nucleation within a metastable mushy-zone, several geometries for nucleation site development must be considered. Traditional spherical dual cap and crevice models are compared to a truncated dual cap to determine the activation energy and critical cluster growth kinetics in ternary Fe-Cr-Ni steel alloys. Results of activation energy results indicate that nucleation is more probable at grain boundaries within the solid than at the solid-liquid interface.
DEFF Research Database (Denmark)
Abadal, G.; Davis, Zachary James; Helbo, Bjarne
2001-01-01
A simple linear electromechanical model for an electrostatically driven resonating cantilever is derived. The model has been developed in order to determine dynamic quantities such as the capacitive current flowing through the cantilever-driver system at the resonance frequency, and it allows us ...
Three-stage steady-state model for biomass gasification in a dual circulating fluidized-bed
International Nuclear Information System (INIS)
Nguyen, Thanh D.B.; Ngo, Son Ich; Lim, Young-Il; Lee, Jeong Woo; Lee, Uen-Do; Song, Byung-Ho
2012-01-01
Highlights: ► Steam gasification of woodchips is examined in dual circulating fluidized-bed (DFB). ► We develop a three-stage model (TSM) for process performance evaluation. ► Effect of gasification temperature and steam to fuel ratio is investigated. ► Several effective operating conditions are found by parametric study. - Abstract: A three-stage steady state model (TSM) was developed for biomass steam gasification in a dual circulating fluidized-bed (DFB) to calculate the composition of producer gas, carbon conversion, heat recovery, cost efficiency, and heat demand needed for the endothermic gasification reactions. The model was divided into three stages including biomass pyrolysis, char–gas reactions, and gas–phase reaction. At each stage, an empirical equation was estimated from experimental data. It was assumed that both unconverted char and additional fuel were completely combusted at 950 °C in the combustor (riser) and the heat required for gasification reactions was provided by the bed material (silica sand). The model was validated with experimental data taken from the literature. The parametric study of the gasification temperature (T) and the steam to fuel ratio (γ) was then carried out to evaluate performance criteria of a 1.8 MW DFB gasifier using woodchips as a feedstock for the electric power generation. Effective operating conditions of the DFB gasifier were proposed by means of the contour of the solid circulation ratio, the heat recovery, the additional fuel ratio and the cost efficiency with respect to T and γ.
Mathematical model of thyristor inverter including a series-parallel resonant circuit
Luft, M.; Szychta, E.
2008-01-01
The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with the aid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.
Polymer dual ring resonators for label-free optical biosensing using microfluidics.
Salleh, Muhammad H M; Glidle, Andrew; Sorel, Marc; Reboud, Julien; Cooper, Jonathan M
2013-04-18
We demonstrate a polymer resonator microfluidic biosensor that overcomes the complex manufacturing procedures required to fabricate traditional devices. In this new format, we show that a gapless light coupling photonic configuration, fabricated in SU8 polymer, can achieve high sensitivity, label-free chemical sensing in solution and high sensitivity biological sensing, at visible wavelengths.
Lucey, Siobhan M; Santini, Ario; Roebuck, Elizabeth M
2015-03-01
There is a lack of data on polymerization of resin-based materials (RBMs) used in paediatric dentistry, using dual-peak light-emitting diode (LED) light-curing units (LCUs). To evaluate the degree of conversion (DC) of RBMs cured with dual-peak or single-peak LED LCUs. Samples of Vit-l-escence (Ultradent) and Herculite XRV Ultra (Kerr) and fissure sealants Delton Clear and Delton Opaque (Dentsply) were prepared (n = 3 per group) and cured with either one of two dual-peak LCUs (bluephase(®) G2; Ivoclar Vivadent or Valo; Ultradent) or a single-peak (bluephase(®) ; Ivoclar Vivadent). High-performance liquid chromatography and nuclear magnetic resonance spectroscopy were used to confirm the presence or absence of initiators other than camphorquinone. The DC was determined using micro-Raman spectroscopy. Data were analysed using general linear model anova; α = 0.05. With Herculite XRV Ultra, the single-peak LCU gave higher DC values than either of the two dual-peak LCUs (P < 0.05). Both fissure sealants showed higher DC compared with the two RBMs (P < 0.05); the DC at the bottom of the clear sealant was greater than the opaque sealant, (P < 0.05). 2,4,6-trimethylbenzoyldiphenylphosphine oxide (Lucirin(®) TPO) was found only in Vit-l-escence. Dual-peak LED LCUs may not be best suited for curing non-Lucirin(®) TPO-containing materials. A clear sealant showed a better cure throughout the material and may be more appropriate than opaque versions in deep fissures. © 2014 BSPD, IAPD and John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Informational model verification of ZVS Buck quasi-resonant DC-DC converter
Vakovsky, Dimiter; Hinov, Nikolay
2016-12-01
The aim of the paper is to create a polymorphic informational model of a ZVS Buck quasi-resonant DC-DC converter for the modeling purposes of the object. For the creation of the model is applied flexible open standards for setting, storing, publishing and exchange of data in distributed information environment. The created model is useful for creation of many and different by type variants with different configuration of the composing elements and different inner model of the examined object.
International Nuclear Information System (INIS)
Altın, İsmail; Bilgin, Atilla
2015-01-01
This study builds on a previous parametric investigation using a thermodynamic-based quasi-dimensional (QD) cycle simulation of a spark-ignition (SI) engine with dual-spark plugs. The previous work examined the effects of plug-number and location on some performance parameters considering an engine with a simple cylindrical disc-shaped combustion chamber. In order to provide QD thermodynamic models applicable to complex combustion chamber geometries, a novel approach is considered here: flame-maps, which utilizes a computer aided design (CAD) software (SolidWorks). Flame maps are produced by the CAD software, which comprise all the possible flame radiuses with an increment of one-mm between them, according to the spark plug positions, spark timing, and piston position near the top dead center. The data are tabulated and stored as matrices. Then, these tabulated data are adapted to the previously reported cycle simulation. After testing for simple disc-shaped chamber geometries, the simulation is applied to a real production automobile (Honda-Fit) engine to perform the parametric study. - Highlights: • QD model was applied in dual plug engine with complex realistic combustion chamber. • This method successfully modeled the combustion in the dual-plug Honda-Fit engine. • The same combustion chamber is tested for various spark plug(s) locations. • The centrally located single spark-plug results in the fastest combustion
Pricing Model for Dual Sales Channel with Promotion Effect Consideration
Chuiri Zhou
2016-01-01
We focus on the pricing strategy of a dual sales channel member when his/her online retailer faces an upcoming overloaded express delivery service due to the sales peak of online shopping, especially referring to the occurring affairs in China. We characterize the pricing problem of the dual selling channel system as a two-period game. When the price discount is only provided by the online seller, we find that the prices of the traditional channel and the online channel in the two periods are...
Do basal Ganglia amplify willed action by stochastic resonance? A model.
Directory of Open Access Journals (Sweden)
V Srinivasa Chakravarthy
Full Text Available Basal ganglia are usually attributed a role in facilitating willed action, which is found to be impaired in Parkinson's disease, a pathology of basal ganglia. We hypothesize that basal ganglia possess the machinery to amplify will signals, presumably weak, by stochastic resonance. Recently we proposed a computational model of Parkinsonian reaching, in which the contributions from basal ganglia aid the motor cortex in learning to reach. The model was cast in reinforcement learning framework. We now show that the above basal ganglia computational model has all the ingredients of stochastic resonance process. In the proposed computational model, we consider the problem of moving an arm from a rest position to a target position: the two positions correspond to two extrema of the value function. A single kick (a half-wave of sinusoid, of sufficiently low amplitude given to the system in resting position, succeeds in taking the system to the target position, with high probability, only at a critical noise level. But for suboptimal noise levels, the model arm's movements resemble Parkinsonian movement symptoms like akinetic rigidity (low noise and dyskinesias (high noise.
Dual Processing Model for Medical Decision-Making: An Extension to Diagnostic Testing.
Tsalatsanis, Athanasios; Hozo, Iztok; Kumar, Ambuj; Djulbegovic, Benjamin
2015-01-01
Dual Processing Theories (DPT) assume that human cognition is governed by two distinct types of processes typically referred to as type 1 (intuitive) and type 2 (deliberative). Based on DPT we have derived a Dual Processing Model (DPM) to describe and explain therapeutic medical decision-making. The DPM model indicates that doctors decide to treat when treatment benefits outweigh its harms, which occurs when the probability of the disease is greater than the so called "threshold probability" at which treatment benefits are equal to treatment harms. Here we extend our work to include a wider class of decision problems that involve diagnostic testing. We illustrate applicability of the proposed model in a typical clinical scenario considering the management of a patient with prostate cancer. To that end, we calculate and compare two types of decision-thresholds: one that adheres to expected utility theory (EUT) and the second according to DPM. Our results showed that the decisions to administer a diagnostic test could be better explained using the DPM threshold. This is because such decisions depend on objective evidence of test/treatment benefits and harms as well as type 1 cognition of benefits and harms, which are not considered under EUT. Given that type 1 processes are unique to each decision-maker, this means that the DPM threshold will vary among different individuals. We also showed that when type 1 processes exclusively dominate decisions, ordering a diagnostic test does not affect a decision; the decision is based on the assessment of benefits and harms of treatment. These findings could explain variations in the treatment and diagnostic patterns documented in today's clinical practice.
Dual Processing Model for Medical Decision-Making: An Extension to Diagnostic Testing.
Directory of Open Access Journals (Sweden)
Athanasios Tsalatsanis
Full Text Available Dual Processing Theories (DPT assume that human cognition is governed by two distinct types of processes typically referred to as type 1 (intuitive and type 2 (deliberative. Based on DPT we have derived a Dual Processing Model (DPM to describe and explain therapeutic medical decision-making. The DPM model indicates that doctors decide to treat when treatment benefits outweigh its harms, which occurs when the probability of the disease is greater than the so called "threshold probability" at which treatment benefits are equal to treatment harms. Here we extend our work to include a wider class of decision problems that involve diagnostic testing. We illustrate applicability of the proposed model in a typical clinical scenario considering the management of a patient with prostate cancer. To that end, we calculate and compare two types of decision-thresholds: one that adheres to expected utility theory (EUT and the second according to DPM. Our results showed that the decisions to administer a diagnostic test could be better explained using the DPM threshold. This is because such decisions depend on objective evidence of test/treatment benefits and harms as well as type 1 cognition of benefits and harms, which are not considered under EUT. Given that type 1 processes are unique to each decision-maker, this means that the DPM threshold will vary among different individuals. We also showed that when type 1 processes exclusively dominate decisions, ordering a diagnostic test does not affect a decision; the decision is based on the assessment of benefits and harms of treatment. These findings could explain variations in the treatment and diagnostic patterns documented in today's clinical practice.
CSIR Research Space (South Africa)
Burger, L
2007-01-01
Full Text Available of this type of resonator. Further use of the model reveals the formation of more complex beam patterns, and the nature of these patterns is investigated. Also, the output of stable and unstable resonator modes is presented....
Determination of freeze-out conditions from fluctuations in the Hadron Resonance Gas model
International Nuclear Information System (INIS)
Alba, P; Alberico, W; Sarti, V Mantovani; Ratti, C; Bellwied, R; Bluhm, M; Nahrgang, M
2015-01-01
Fluctuations of conserved charges measured in Heavy-Ion Collisions (HICs) received increasing attention in recent years, because they are good candidates to explore the phase diagram of QCD matter. During the last year, net-electric charge and net-proton moments of multiplicities measured at RHIC have been published by the STAR collaboration, for a range of collision energies which spans a region of the phase diagram at finite chemical potential. Here we present a new freeze-out curve obtained using the Hadron Resonance Gas (HRG) model approach to fit these experimental data. The HRG model is modified in order to have a realistic description of the HICs: kinematic cuts, resonance feed-down and resonance regeneration are taken into account. Our result is in agreement with preliminary studies by the ALICE collaboration, and is supported by a recent lattice analysis of the same quantities. (paper)
Resonance phenomena in a time-dependent, three-dimensional model of an idealized eddy
Rypina, I. I.; Pratt, L. J.; Wang, P.; Äe; -zgökmen, T. M.; Mezic, I.
2015-08-01
We analyze the geometry of Lagrangian motion and material barriers in a time-dependent, three-dimensional, Ekman-driven, rotating cylinder flow, which serves as an idealization for an isolated oceanic eddy and other overturning cells with cylindrical geometry in the ocean and atmosphere. The flow is forced at the top through an oscillating upper lid, and the response depends on the frequency and amplitude of lid oscillations. In particular, the Lagrangian geometry changes near the resonant tori of the unforced flow, whose frequencies are rationally related to the forcing frequencies. Multi-scale analytical expansions are used to simplify the flow in the vicinity of resonant trajectories and to investigate the resonant flow geometries. The resonance condition and scaling can be motivated by simple physical argument. The theoretically predicted flow geometries near resonant trajectories have then been confirmed through numerical simulations in a phenomenological model and in a full solution of the Navier-Stokes equations.
Dual AAV Vectors for Stargardt Disease.
Trapani, Ivana
2018-01-01
Stargardt disease (STGD1), due to mutations in the large ABCA4 gene, is the most common inherited macular degeneration in humans. Attempts at developing gene therapy approaches for treatment of STGD1 are currently ongoing. Among all the vectors available for gene therapy of inherited retinal diseases, those based on adeno-associated viruses (AAV) are the most promising given the efficacy shown in various animal models and their excellent safety profile in humans, as confirmed in many ongoing clinical trials. However, one of the main obstacles for the use of AAV is their limited effective packaging capacity of about 5 kb. Taking advantage of the AAV genome's ability to concatemerize , others and we have recently developed dual AAV vectors to overcome this limit. We tested dual AAV vectors for ABCA4 delivery, and found that they transduce efficiently both mouse and pig photoreceptors , and rescue the Abca4-/- mouse retinal phenotype, indicating their potential for gene therapy of STGD1. This chapter details how we designed dual AAV vectors for the delivery of the ABCA4 gene and describes the techniques that can be explored to evaluate dual AAV transduction efficiency in vitro and in the retina, and their efficacy in the mouse model of STGD1.
Development of an ESR/MR dual-imaging system as a tool to detect bioradicals
International Nuclear Information System (INIS)
Fujii, Hirotada; Aoki, Masaaki; Haishi, Tomoyuki; Itoh, Kouichi; Sakata, Motomichi
2006-01-01
A system combining electron spin resonance imaging (ESRI) with another imaging modality capable of enabling visualization of the distribution of bioradicals on an anatomical map of the specimens would be a superior biomedical imaging system. We describe the development of an electron spin resonance ESR/MR dual-imaging system with one permanent magnet and the biomedical applications of this system. The magnetic circuit developed for the ESR/MR dual-imaging system consisted of the permanent magnet made of Fe-Nd-B, pole pieces, and poke. The permanent magnet was installed on the MR side only, and the ESR side was made of pole pieces only. The magnetic field was adjusted to 0.5T at MR and to 0.042T at ESR. The overall dimensions of the magnet developed for the ESR/MR imaging system were 460 (W) x 440 (D) x 460 (H) mm, and it weighed 220 kg. The distance of each center for the magnet for ESR and MR imaging could be set as close as 200 mm. The entire ESR/MR imaging system can be installed in a common laboratory without magnetic shielding. MR images of plants (myoga) and small animals (mice and rats) were successfully acquired with or without ESR operation. ESR spectra of nitroxyl spin probes were also measured, even with MRI operation. ESR signals of triarylmethyl derivatives with narrow line-width (0.026 mT) were observed in living mice while MRI was operating. The ESR/MR imaging dual functions work properly with no electric or magnetic interference. The ESR/MR dual images demonstrate that this system enables visualization of the distribution of bioradicals on the anatomical map of the object. (author)
Sibley, Chris G.; Overall, Nickola C.
2011-01-01
We tested a dual process motivational model of ambivalent sexism and gender differences in intimate partner preferences. Meta-analysis of 32 samples (16 with men, 16 with women; N = 5,459) indicated that Benevolent Sexism (BS) in women was associated with greater preferences for high-resource partners (r = 0.24), whereas Hostile Sexism (HS) in men…
Dual RBFNNs-Based Model-Free Adaptive Control With Aspen HYSYS Simulation.
Zhu, Yuanming; Hou, Zhongsheng; Qian, Feng; Du, Wenli
2017-03-01
In this brief, we propose a new data-driven model-free adaptive control (MFAC) method with dual radial basis function neural networks (RBFNNs) for a class of discrete-time nonlinear systems. The main novelty lies in that it provides a systematic design method for controller structure by the direct usage of I/O data, rather than using the first-principle model or offline identified plant model. The controller structure is determined by equivalent-dynamic-linearization representation of the ideal nonlinear controller, and the controller parameters are tuned by the pseudogradient information extracted from the I/O data of the plant, which can deal with the unknown nonlinear system. The stability of the closed-loop control system and the stability of the training process for RBFNNs are guaranteed by rigorous theoretical analysis. Meanwhile, the effectiveness and the applicability of the proposed method are further demonstrated by the numerical example and Aspen HYSYS simulation of distillation column in crude styrene produce process.
Mathematical Model of Thyristor Inverter Including a Series-parallel Resonant Circuit
Directory of Open Access Journals (Sweden)
Miroslaw Luft
2008-01-01
Full Text Available The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with theaid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.
Edmunds, Charlotte E. R.; Milton, Fraser; Wills, Andy J.
2018-01-01
Behavioral evidence for the COVIS dual-process model of category learning has been widely reported in over a hundred publications (Ashby & Valentin, 2016). It is generally accepted that the validity of such evidence depends on the accurate identification of individual participants' categorization strategies, a task that usually falls to…
In-fiber torsion sensor based on dual polarized Mach-Zehnder interference.
Chen, Lei; Zhang, Wei-Gang; Wang, Li; Zhang, Hao; Sieg, Jonathan; Zhou, Quan; Zhang, Li-Yu; Wang, Biao; Yan, Tie-Yi
2014-12-29
This paper presents a novel optical fiber torsion sensor based on dual polarized Mach-Zehnder interference (DPMZI). Unlike the conventional fiber sensor, the proposed sensor is composed of a sensor part and a demodulator. The demodulator is made by a bared single mode fiber (SMF) loop, and the sensor part is a segment of a coated SMF placed before the loop. A mathematical model is proposed based on DPMZI mechanism and from the model when the sensor part is twisted, the E-field rotational angle will bring a quasi-linear impact on the resonance dip wavelength in their matched detecting range. A proof-of-concept experiment was performed to verify the theoretical prediction. From the experimental data, a sensitivity of -0.3703, -1.00962, and -0.59881 nm•m/rad is achieved with the determining range of 12.0936, 7.6959, and 10.4444 rad/m respectively. The sensor which is composed only of the SMF has the advantages of low insertion loss (~-2dB), healthy structure, low manufacture cost, and easy assembly and application.
Goel, Ekta; Kumar, Sanjay; Singh, Balraj; Singh, Kunal; Jit, Satyabrata
2017-06-01
The subthreshold performance of graded-channel dual-material double-gate (GCDMDG) MOSFETs is examined through two-dimensional (2D) analytical modeling of subthreshold-current (SC) and subthreshold-swing (SS). The potential function obtained by using the parabolic approach to solve the 2D Poisson's equation, has been used to formulate SC and SS characteristics of the device. The variations of SS against different device parameters have been obtained with the help of effective conduction path parameter. The SC and SS characteristics of the GCDMDG MOS transistor have been compared with those of the dual-material double-gate (DMDG) and simple graded-channel double-gate (GCDG) MOS structures to show its better subthreshold characteristics over the latter two devices. The results of the developed model are well-agreed with the commercially available SILVACO ATLAS™ simulator data.
Dual chiral density wave in quark matter
International Nuclear Information System (INIS)
Tatsumi, Toshitaka
2002-01-01
We prove that quark matter is unstable for forming a dual chiral density wave above a critical density, within the Nambu-Jona-Lasinio model. Presence of a dual chiral density wave leads to a uniform ferromagnetism in quark matter. A similarity with the spin density wave theory in electron gas and the pion condensation theory is also pointed out. (author)
Directory of Open Access Journals (Sweden)
Sidan Tian
2016-06-01
Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA
Antaramian, Susan P; Scott Huebner, E; Hills, Kimberly J; Valois, Robert F
2010-10-01
Traditional mental health models focus on psychological problems and distress; accordingly, health is viewed as the absence of illness or disability. In contrast, a dual-factor model of mental health incorporates both indicators of positive subjective well-being (SWB) and measures of psychopathological symptoms to comprehensively determine an individual's psychological adjustment. This study used such a dual-factor model to measure the mental health status of young adolescents. A total of 764 middle school students were classified into one of four distinct groups based on having high or low psychopathology and high or low SWB. Furthermore, group differences in student engagement, academic achievement, and environmental support for learning were investigated. Results demonstrated the existence of a traditionally neglected group of adolescents (low SWB and low psychopathology) who are nonetheless at risk for academic and behavior problems in school and who performed no better than the most troubled group of adolescents. Overall, both the presence of positive well-being and the absence of symptoms were necessary for ensuring the most advantageous school performance. These results highlight the importance of incorporating positive indicators of well-being along with traditional negative factors in more fully understanding relationships between individuals' mental health and educational outcomes. © 2010 American Orthopsychiatric Association.
Lin, Zhuchong; Liu, Kun; Zhang, Li; Zeng, Delin
2016-09-01
Maglev dual-stage inertially stabilization (MDIS) system is a newly proposed system which combines a conventional two-axis gimbal assembly and a 5-DOF (degree of freedom) magnetic bearing with vernier tilting capacity to perform dual-stage stabilization for the LOS of the suspended optical instrument. Compared with traditional dual-stage system, maglev dual-stage system exhibits different characteristics due to the negative position stiffness of the magnetic forces, which introduces additional coupling in the dual stage control system. In this paper, the coupling effect on the system performance is addressed based on frequency-domain analysis, including disturbance rejection, fine stage saturation and coarse stage structural resonance suppression. The difference between various control strategies is also discussed, including pile-up(PU), stabilize-follow (SF) and stabilize-compensate (SC). A number of principles for the design of a maglev dual stage system are proposed. A general process is also suggested, which leads to a cost-effective design striking a balance between high performance and complexity. At last, a simulation example is presented to illustrate the arguments in the paper. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Saeidi, N., E-mail: navidsae@gmail.com [Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Ashrafizadeh, F.; Niroumand, B. [Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Forouzan, M.R.; Mohseni mofidi, S. [Department of Mechanical Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Barlat, F. [Materials Mechanics Laboratory (MML), Graduate Institute of Ferrous Technology (GIFT), Pohang University of Science and Technology - POSTECH, San 31 Hyoja-dong, Nam-gu, Pohang, Gyeongbuk 790-784 (Korea, Republic of)
2016-04-01
Ductile fracture mechanisms during uniaxial tensile testing of two different modern high strength dual phase steels, i.e. DP780 and DP980, were studied. Detailed microstructural characterization of the strained and sectioned samples was performed by scanning electron microscopy as well as EBSD examination. The results revealed that interface decohesion, especially at martensite particles located at ferrite grain boundaries, was the most probable mechanism for void nucleation. It was also revealed that the creation of cellular substructure can reduce stored strain energy and thereby, higher true fracture strain was obtained in DP980 than DP780 steel. Prediction of void growth behavior based on some previously proposed models showed unreliable results. Therefore, a modified model based on Rice-Tracey family models was proposed which showed a very lower prediction error compared with other models. - Highlights: • Damage mechanism in two modern high strength dual phase steels was studied. • Creation of cellular substructures can reduce the stored strain energy within the ferrite grains. • The experimental values were examined by Agrawal as well as RT family models. • A modified model was proposed for prediction of void growth behavior of DP steels.
Establishment and analysis of coupled dynamic model for dual-mass silicon micro-gyroscope
Wang, Zhanghui; Qiu, Anping; Shi, Qin; Zhang, Taoyuan
2017-12-01
This paper presents a coupled dynamic model for a dual-mass silicon micro-gyroscope (DMSG). It can quantitatively analyze the influence of left-right stiffness difference on the natural frequencies, modal matrix and modal coupling coefficient of the DMSG. The analytic results are verified by using the finite element method (FEM) simulation. The model shows that with the left-right stiffness difference of 1%, the modal coupling coefficient is 12% in the driving direction and 31% in the sensing direction. It also shows that in order to achieve good separation, the stiffness of base beam should be small enough in both the driving and sensing direction.
Dual-model automatic detection of nerve-fibres in corneal confocal microscopy images.
Dabbah, M A; Graham, J; Petropoulos, I; Tavakoli, M; Malik, R A
2010-01-01
Corneal Confocal Microscopy (CCM) imaging is a non-invasive surrogate of detecting, quantifying and monitoring diabetic peripheral neuropathy. This paper presents an automated method for detecting nerve-fibres from CCM images using a dual-model detection algorithm and compares the performance to well-established texture and feature detection methods. The algorithm comprises two separate models, one for the background and another for the foreground (nerve-fibres), which work interactively. Our evaluation shows significant improvement (p approximately 0) in both error rate and signal-to-noise ratio of this model over the competitor methods. The automatic method is also evaluated in comparison with manual ground truth analysis in assessing diabetic neuropathy on the basis of nerve-fibre length, and shows a strong correlation (r = 0.92). Both analyses significantly separate diabetic patients from control subjects (p approximately 0).
De Dreu, Carsten K. W.; Baas, Matthijs; Nijstad, Bernard A.
To understand when and why mood states influence creativity, the authors developed and tested a dual pathway to creativity model; creative fluency (number of ideas or insights) and originality (novelty) are functions of cognitive flexibility, persistence, or some combination thereof. Invoking work
Ait-El-Fquih, Boujemaa
2016-08-12
Ensemble Kalman filtering (EnKF) is an efficient approach to addressing uncertainties in subsurface ground-water models. The EnKF sequentially integrates field data into simulation models to obtain a better characterization of the model\\'s state and parameters. These are generally estimated following joint and dual filtering strategies, in which, at each assimilation cycle, a forecast step by the model is followed by an update step with incoming observations. The joint EnKF directly updates the augmented state-parameter vector, whereas the dual EnKF empirically employs two separate filters, first estimating the parameters and then estimating the state based on the updated parameters. To develop a Bayesian consistent dual approach and improve the state-parameter estimates and their consistency, we propose in this paper a one-step-ahead (OSA) smoothing formulation of the state-parameter Bayesian filtering problem from which we derive a new dual-type EnKF, the dual EnKF(OSA). Compared with the standard dual EnKF, it imposes a new update step to the state, which is shown to enhance the performance of the dual approach with almost no increase in the computational cost. Numerical experiments are conducted with a two-dimensional (2-D) synthetic groundwater aquifer model to investigate the performance and robustness of the proposed dual EnKFOSA, and to evaluate its results against those of the joint and dual EnKFs. The proposed scheme is able to successfully recover both the hydraulic head and the aquifer conductivity, providing further reliable estimates of their uncertainties. Furthermore, it is found to be more robust to different assimilation settings, such as the spatial and temporal distribution of the observations, and the level of noise in the data. Based on our experimental setups, it yields up to 25% more accurate state and parameter estimations than the joint and dual approaches.
International Nuclear Information System (INIS)
Wang Rui; Zhang Zhaoqi; Xu Lei; Ma Qin; He Yi; Lu Dongxu; Yu Wei; Fan Zhanming
2011-01-01
Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 ± 9.57 HU vs. 72.63 ± 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 ± 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.
Energy Technology Data Exchange (ETDEWEB)
Wang Rui, E-mail: rui_wang1979@yahoo.cn [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Zhang Zhaoqi, E-mail: zhaoqi5000@vip.sohu.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Xu Lei, E-mail: leixu2001@hotmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Ma Qin, E-mail: tel1367@gmail.com [Department of Emergency, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); He Yi, E-mail: heyi139@sina.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Lu Dongxu, E-mail: larry.hi@163.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Yu Wei, E-mail: yuwei02@gmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Fan Zhanming, E-mail: fanzm120@tom.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China)
2011-11-15
Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 {+-} 9.57 HU vs. 72.63 {+-} 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 {+-} 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.
Isoscalar giant resonances in a relativistic model
International Nuclear Information System (INIS)
L'Huillier, M.; Nguyen Van Giai.
1988-07-01
Isoscalar giant resonances in finite nuclei are studied in a relativistic Random Phase Approximation (RRPA) approach. The model is self-consistent in the sense that one set of coupling constants generates the Dirac-Hartree single-particle spectrum and the residual particle-hole interaction. The RRPA is used to calculate response functions of multipolarity L = 0,2,3, and 4 in light and medium nuclei. It is found that monopole and quadrupole modes exhibit a collective character. The peak energies are overestimated, but not as much as one might think if the bulk properties (compression modulus, effective mass) were the only relevant quantities
Numerical simulation and fracture identification of dual laterolog in organic shale
Maojin, Tan; Peng, Wang; Qiong, Liu
2012-09-01
Fracture is one of important spaces in shale oil and shale gas reservoirs, and fractures identification and evaluation are an important part in organic shale interpretation. According to the fractured shale gas reservoir, a physical model is set up to study the dual laterolog logging responses. First, based on the principle of dual laterolog, three-dimensional finite element method (FEM) is used to simulate the dual laterolog responses in various formation models with different fractures widths, different fracture numbers, different fractures inclination angle. All the results are extremely important for the fracture identification and evaluation in shale reservoirs. Appointing to different base rock resistivity models, the fracture models are constructed respectively through a number of numerical simulation, and the fracture porosity can be calculated by solving the corresponding formulas. A case study about organic shale formation is analyst and discussed, and the fracture porosity is calculated from dual laterolog. The fracture evaluation results are also be validated right by Full borehole Micro-resistivity Imaging (FMI). So, in case of the absence of borehole resistivity imaging log, the dual laterolog resistivity can be used to estimate the fracture development.
Fundamentals of nanomechanical resonators
Schmid, Silvan; Roukes, Michael Lee
2016-01-01
This authoritative book introduces and summarizes the latest models and skills required to design and optimize nanomechanical resonators, taking a top-down approach that uses macroscopic formulas to model the devices. The authors cover the electrical and mechanical aspects of nano electromechanical system (NEMS) devices. The introduced mechanical models are also key to the understanding and optimization of nanomechanical resonators used e.g. in optomechanics. Five comprehensive chapters address: The eigenmodes derived for the most common continuum mechanical structures used as nanomechanical resonators; The main sources of energy loss in nanomechanical resonators; The responsiveness of micro and nanomechanical resonators to mass, forces, and temperature; The most common underlying physical transduction mechanisms; The measurement basics, including amplitude and frequency noise. The applied approach found in this book is appropriate for engineering students and researchers working with micro and nanomechanical...
Xu, Yaoshan; Li, Yongjuan; Zhang, Feng
2013-01-01
The present study investigates the determining factors of Chinese pedestrians' intention to violate traffic laws using a dual-process model. This model divides the cognitive processes of intention formation into controlled analytical processes and automatic associative processes. Specifically, the process explained by the augmented theory of planned behavior (TPB) is controlled, whereas the process based on past behavior is automatic. The results of a survey conducted on 323 adult pedestrian respondents showed that the two added TPB variables had different effects on the intention to violate, i.e., personal norms were significantly related to traffic violation intention, whereas descriptive norms were non-significant predictors. Past behavior significantly but uniquely predicted the intention to violate: the results of the relative weight analysis indicated that the largest percentage of variance in pedestrians' intention to violate was explained by past behavior (42%). According to the dual-process model, therefore, pedestrians' intention formation relies more on habit than on cognitive TPB components and social norms. The implications of these findings for the development of intervention programs are discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.
Ziegler, Dennis; Trieschmann, Jan; Mussenbrock, Thomas; Brinkmann, Ralf Peter
2009-10-01
The influence of the relative phase of the driving voltages on heating in asymmetric dual frequency capacitive discharges is investigated. Basis of the analysis is a recently published global model [1] extended by the possibility to freely adjust the phase angles between the driving voltages. In recent publications it was reported that nonlinear electron resonance heating (NERH) drastically enhances dissipation at moments of sheath collapse due to plasma series resonance (PSR) excitation [2]. This work shows that depending on the relative phase of the driving voltages, the total number and exact moments of sheath collapse can be influenced. In case of a collapse directly being followed by a second collapse ("double collapse") a substantial increase in dissipated power, well above the reported growth due to a single PSR excitation event per period, can be observed.[4pt] [1] D.,iegler, T.,ussenbrock, and R.,. Brinkmann, Phys. Plasmas 16, 023503 (2009)[0pt] [2] T.,ussenbrock, R.,. Brinkmann, M.,. Lieberman, A.,. Lichtenberg, and E. Kawamura, Phys. Rev. Lett. 101, 085004 (2008)
The computer simulation of the resonant network for the B-factory model power supply
International Nuclear Information System (INIS)
Zhou, W.; Endo, K.
1993-07-01
A high repetition model power supply and the resonant magnet network are simulated with the computer in order to check and improve the design of the power supply for the B-factory booster. We put our key point on a transient behavior of the power supply and the resonant magnet network. The results of the simulation are given. (author)
Modeling of Nanophotonic Resonators with the Finite-Difference Frequency-Domain Method
DEFF Research Database (Denmark)
Ivinskaya, Aliaksandra; Lavrinenko, Andrei; Shyroki, Dzmitry
2011-01-01
Finite-difference frequency-domain method with perfectly matched layers and free-space squeezing is applied to model open photonic resonators of arbitrary morphology in three dimensions. Treating each spatial dimension independently, nonuniform mesh of continuously varying density can be built ea...
Modeling and control of Type-2 wind turbines for sub-synchronous resonance damping
International Nuclear Information System (INIS)
Mancilla-David, Fernando; Domínguez-García, José Luis; De Prada, Mikel; Gomis-Bellmunt, Oriol; Singh, Mohit; Muljadi, Eduard
2015-01-01
Highlights: • Dynamic modeling of Type-2 wind turbines for sub-synchronous resonance studies. • Systematic design of a power system stabilizer for Type-2 wind turbines. • Assessment of Type-2 wind turbines to suppress sub-synchronous resonance events. - Abstract: The rapid increase of wind power penetration into power systems around the world has led transmission system operators to enforce stringent grid codes requiring novel functionalities from renewable energy-based power generation. For this reason, there exists a need to asses whether wind turbines (WTs) will comply with such functionalities to ensure power system stability. This paper demonstrates that Type-2 WTs may induce sub-synchronous resonance (SSR) events when connected to a series-compensated transmission line, and with proper control, they may also suppress such events. The paper presents a complete dynamic model tailored to study, via eigenanalysis, SSR events in the presence of Type-2 WTs, and a systematic procedure to design a power system stabilizer using only local and measurable signals. Results are validated through a case study based on the IEEE first benchmark model for SSR studies, as well as with transient computer simulations
Fatigue characteristics of dual-phase steel sheets
Energy Technology Data Exchange (ETDEWEB)
Onn, Irwan Herman; Ahmad, Norhayati; Tamin, Mohd Nasir [Universiti Teknologi Malaysia, Skudai (Malaysia)
2015-01-15
Fatigue characteristics of dual-phase steel sheets, commonly used in automobile body construction were established. For this purpose, a series of fatigue tests, each at constant stress amplitude were conducted on 1.2 mm-thick, dual-phase DP600 steel sheet specimens with two different load ratios of minimum-to-maximum stress, R = 0.1 and -1. The resulting fatigue behavior is expressed in terms of fatigue strength-life (S-N) curves. Fatigue behavior of the steel sheets in the high-cycle fatigue region can be represented by Basquin's equation with coefficient and exponent value of 921.2 and 0.093, respectively. An endurance limit of 255 MPa is observed. In addition, fatigue strengths of the dual-phase steel sheets display lower magnitude than their bulk counterparts. Effect of mean stress on fatigue behavior of the steel sheets is well predicted by Walker's model. Exponential calibration factor is introduced to the models by SWT, Goodman and Morrow with comparable prediction to the Walker's model.
High energy charge exchange np and antipp scattering using the dual fermion model
International Nuclear Information System (INIS)
Weigt, G.
1976-01-01
The five independent helicity amplitudes Phisub(i)(s, t) calculated by Mandelstam from the Neveu-Schwarz-Ramond model for fermion-antifermion scattering are used in the Regge limit for a phenomenological description of high energy np and antipp charge exchange scattering. A forward spike which widens with increasing energy as well as an energy dependence changing from lower to higher energy data are reproduced by these non-evasive dual Born amplitudes using π, A 2 and rho Regge pole t-channel exchanges. (author)
Peter, Tracey
2017-08-11
The goal of the study is to investigate whether positive mental health complements mental illness within a theoretically informed (the dual-continua model) and psychometrically tested (the Mental Health Continuum-Short Form) framework. National-level, population-based data from the 2012 Canadian Community Health Survey on Mental Health (CCHS-MH) was used, with comparisons between sexual minority and heterosexual adults. Results show that gay, lesbian, and bisexual Canadians have substantially lower rates of positive mental health and are more likely to have been diagnosed with a mental illness, with the disparities between health and illness being the most pronounced among lesbians and bisexual females. Results show considerable support for the dual-continua model, which posits that the absence of health does not automatically translate into the presence of illness, and vice versa. Suggestions are made for practitioners and researchers toward the use of the dual-continua model as a surveillance tool, especially among sexual minority individuals.
[Treatment program for dual-diagnosis substance abusers].
Kandel, Isack
2007-01-01
Dual-diagnosis mentally ill patients, i.e. those characterized with substance abuse problems combined with mental health problems, are a challenge both for systems treating substance abusers and for mental health services. These patients are not easily integrated in either of these healthcare systems and/or are treated only for one aspect of their problem by each of these systems. For such patients it is necessary to create a separate treatment model, combining care of the problem of substance abuse and attention to the patient's mental pathology, according to his individual personality traits. For purposes of this programme a treatment setting operating on the model of a therapeutic community is proposed. This setting will open an affiliated treatment programme for dual-diagnosed patients in a separate treatment programme that is not part of the therapeutic community but will be affiliated with it and will accept dual-diagnosis patients.
International Nuclear Information System (INIS)
Fuchs, M.; Putzier, M.; Pumberger, M.; Hermann, K.G.; Diekhoff, T.
2016-01-01
Magnetic resonance imaging (MRI) is degraded by metal-implant-induced artifacts when used for the diagnostic assessment of vertebral compression fractures in patients with instrumented spinal fusion. Dual-energy computed tomography (DECT) offers a promising supplementary imaging tool in these patients. This case report describes an 85-year-old woman who presented with a suspected acute vertebral fracture after long posterior lumbar interbody fusion. This is the first report of a vertebral fracture that showed bone marrow edema on DECT; however, edema was missed by an MRI STIR sequence owing to metal artifacts. Bone marrow assessment using DECT is less susceptible to metal artifacts than MRI, resulting in improved visualization of vertebral edema in the vicinity of fused vertebral bodies. (orig.)
Dual computations of non-Abelian Yang-Mills theories on the lattice
International Nuclear Information System (INIS)
Cherrington, J. Wade; Khavkine, Igor; Christensen, J. Daniel
2007-01-01
In the past several decades there have been a number of proposals for computing with dual forms of non-Abelian Yang-Mills theories on the lattice. Motivated by the gauge-invariant, geometric picture offered by dual models and successful applications of duality in the U(1) case, we revisit the question of whether it is practical to perform numerical computation using non-Abelian dual models. Specifically, we consider three-dimensional SU(2) pure Yang-Mills as an accessible yet nontrivial case in which the gauge group is non-Abelian. Using methods developed recently in the context of spin foam quantum gravity, we derive an algorithm for efficiently computing the dual amplitude and describe Metropolis moves for sampling the dual ensemble. We relate our algorithms to prior work in non-Abelian dual computations of Hari Dass and his collaborators, addressing several problems that have been left open. We report results of spin expectation value computations over a range of lattice sizes and couplings that are in agreement with our conventional lattice computations. We conclude with an outlook on further development of dual methods and their application to problems of current interest
Dual fermion approach to disordered correlated systems
International Nuclear Information System (INIS)
Haase, Patrick
2015-01-01
Disorder is ubiquitous in real materials and influences the physical properties like the conductivity to varying degrees. If electron-electron interactions are strong, theoretical and numerical treatment of these systems becomes challenging. In this thesis a numerical approach is developed to address these systems, treating both interactions and disorder on equal footing. The approach is based on the dual fermion approach for interacting systems developed by Rubtsov et al. Terletska et al. applied the ideas of the dual fermion approach to disordered non-interacting systems. In this approach, the replica trick is used to integrate out the disorder in favor of an effective electron-electron interaction. We extended the approach from Terletska et al. to treat disordered interacting systems. Dual Fermions allow to take into account non-local fluctuations by means of a perturbative expansion around an impurity problem. The impurity reference system is determined self-consistently, analogously to the dynamical mean-field theory. The perturbative expansion is expected to yield good results for small and large values of interaction strength and disorder. A priori, it is not clear what to expect for intermediate values, but experience shows that oftentimes good results are obtained for this region. An advantage of the dual fermion approach is that there is no sign-problem for a single orbital model if quantum Monte Carlo is used to solve the interacting reference system. Additionally, perturbation theory is usually numerically much cheaper than fully solving an interacting lattice or cluster problem. Thus, the dual fermion approach allows to address regions of parameter space that are not accessible to lattice quantum Monte Carlo calculations or cluster extension of dynamical mean-field theory. Cluster extensions of the dynamical mean-field theory are for example the dynamical cluster approximation or the cellular dynamical mean-field theory. The new approach is benchmarked