WorldWideScience

Sample records for dual resonance model

  1. Dual resonance models and their currents

    International Nuclear Information System (INIS)

    Johnson, E.A.

    1978-01-01

    It is shown how dual resonance models were rederived from the concept of a string tracing out a surface in space-time. Thus, interacting strings reproduce the dual amplitudes. A scheme for tackling the unitarity problem began to develop. As a consistent theory of hadronic processes began to be built, workers at the same time were naturally led to expect that leptons could be included with hadrons in a unified dual theory. Thus, there is a search for dual amplitudes which would describe interactions between hadrons and currents (for example, electrons), as well as interactions involving only hadrons. Such amplitudes, it is believed, will be the correct ones, describing the real world. Such amplitudes will provide valuable information concerning such things as hadronic form factors. The great difficulties in building current-amplitudes with the required properties of proper factorization on a good spectrum, duality, current algebra, and proper asymptotic behavior are described. Dual models at the present time require for consistency, an intercept value of α 0 = 1 and a dimension value of d = 26 (or d = 10). There have been speculations that the unphysical dimension may be made physical by associating the ''extra dimensions'' with certain internal degrees of freedom. However, it is desired that the theory itself, force the dimension d = 4. It is quite possible that the dimension problem and the intercept problem are tied together and that resolving either problem will resolve the other. Order by order, a new dual current is constructed that is manifestly factorizable and which appears to be valid for arbitrary space-time dimension. The fact that this current is not bound at d = 26, leads to interesting speculations on the nature of dual currents

  2. On the quark structure of resonance states in dual models

    International Nuclear Information System (INIS)

    Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.

    1975-01-01

    It is shown using as an example the Veneziano dual model, that each particular dual model already contains a certain latent quark structure unambiauously determined by internal properties of the dual model. To prove this degeneration of the resonance state spectrum is studied by introducing an additional disturbing interaction into the model being considered. Induced transitions of particles into a vacuum act as such an additional disturbance. This method complements the known factorization method of Fubini, Gordon and Veneziano and turns out to be free from an essential limitation of the latter connected with implicit assumption about the basence of internal additive laws of conservation in the model. By using the method of induced transitions of particles into a vacuum it has been possible to show that the resonance state spectrum is indeed more degenerated than it should be expected from the factorization theorem, and that the supplementary degeneration corresponds to the quark model with an infinite number of quarks of the increasing mass. Structures of some terms of the dual amplitude expansion over the degrees of the constant of the induced transition of particles to vacuum are considered; it is shown that the summation of this expansion may be reduced to a solution of a certain integral equation. On the basis of the integral equation obtained an integral representation ofr dual amplitudes is established. The problems related with degeneration of resonance states and with determination of additive quantum numbers leading to the quark interpretation of the degeneration being considered are discussed

  3. The early years of string theory: The dual resonance model

    International Nuclear Information System (INIS)

    Ramond, P.

    1987-10-01

    This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story

  4. A dual resonance model for high energy electroweak reactions

    International Nuclear Information System (INIS)

    Picard, Jean-Francois

    1995-01-01

    The aim of this work is to propose an original model for the weak interaction at high energy (about 1 TeV) that is inspired from resonance dual models established for hadron physics. The first chapter details the basis and assumptions of the standard model. The second chapter deals with various scenarios that go beyond the standard model and that involve a strong interaction and a perturbative approach to assess coupling. The third chapter is dedicated to the main teachings of hadron physics concerning resonances, the model of Regge poles and the concept of duality. We present our new model in the fourth chapter, we build a scenario in which standard fermions and the 3 massive gauge bosons would have a sub-structure alike that of hadrons. In order to give non-null values to the width of resonances we use the K matrix method, we describe this method in the last chapter and we apply it for the computation of the width of the Z 0 boson. Our model predicts a large spectra of states particularly with the 143-up-lets of ff-bar states. The K matrix method has allowed us to compute amplitudes for helicity, then to collapse them in amplitudes invariant with SU(2) and to project these amplitudes in partial waves of helicity. For most resonances partial widths are very low compared to their mass

  5. Interacting-string picture of dual-resonance models

    International Nuclear Information System (INIS)

    Mandelstam, S.

    1985-01-01

    Dual-resonance models are an alyzed by means of operators which act within the physical Hilbert space of positive-metric states. The basis of the method is to extend the relativistic-string picture of a previous study to interacting particles. Functional methods are used, but their relation to the operator is evident, and factorization is maintained. An expression is given for the N-point amplitude in terms of physical-particle operators. For the three-point function the Neumann functions which occur in this expression are evaluated, so that we have a formula for the on- and off-energy-shell vertex. The authors assume that the string has no longitudinal degrees of freedom, and their results are Lorentz invariant and dual only if d=26

  6. Covariant introduction of quark spin into the dual resonance model

    International Nuclear Information System (INIS)

    Iroshnikov, G.S.

    1979-01-01

    A very simple method of insertion of a quark spin into the dual resonance model of hadron interaction is proposed. The method is suitable for amplitudes with an arbitrary number of particles. The amplitude of interaction of real particles is presented as a product of contribution of oscillatory excitations in the (q anti q) system and of a spin factor. The latter is equal to the trace of the product of the external particle wave functions constructed from structural quarks and satisfying the relativistic Bargman-Wigner equations. Two examples of calculating the meson interaction amplitudes are presented

  7. Modelling and analysis of the transformer current resonance in dual active bridge converters

    DEFF Research Database (Denmark)

    Qin, Zian; Shen, Zhan; Blaabjerg, Frede

    2017-01-01

    Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency....... In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model...

  8. Modelling and simulation of a thermally induced optical transparency in a dual micro-ring resonator.

    Science.gov (United States)

    Lydiate, Joseph

    2017-07-01

    This paper introduces the simulation and modelling of a novel dual micro-ring resonator. The geometric configuration of the resonators, and the implementation of a simulated broadband excitation source, results in the realization of optical transparencies in the combined through port output spectrum. The 130 nm silicon on insulator rib fabrication process is adopted for the simulation of the dual-ring configuration. Two titanium nitride heaters are positioned over the coupling regions of the resonators, which can be operated independently, to control the spectral position of the optical transparency. A third heater, centrally located above the dual resonator rings, can be used to red shift the entire spectrum to a required reference resonant wavelength. The free spectral range with no heater currents applied is 4.29 nm. For a simulated heater current of 7 mA (55.7 mW heater power) applied to one of the through coupling heaters, the optical transparency exhibits a red shift of 1.79 nm from the reference resonant wavelength. The ring-to-ring separation of approximately 900 nm means that it can be assumed that there is a zero ring-to-ring coupling field in this model. This novel arrangement has potential applications as a gas mass airflow sensor or a gas species identification sensor.

  9. The Hagedorn Spectrum and the Dual Resonance Model: An Old Love Affair

    CERN Document Server

    Veneziano, Gabriele

    2016-01-01

    In this contribution I recall how people working in the late 1960s on the dual resonance model came to the surprising discovery of a Hagedorn-like spectrum, and why they should not have been surprised. I will then turn to discussing the Hagedorn spectrum from a string theory viewpoint (which adds a huge degeneracy to the exponential spectrum). Finally, I will discuss how all this can be reinterpreted in the new incarnation of string theory through the properties of quantum black holes.

  10. Intermediate mass distribution of the dual resonance pomeron

    International Nuclear Information System (INIS)

    Chiu, C.B.; Matsuda, S.

    1978-01-01

    The intermediate mass distribution of the dual resonance pomeron is determined at the one-loop level and it is shown that the mass distribution obtained is remarkably similar to a suitably defined mass distribution in the dual multiperipheral model. Thus it is suggestive to identify the intermediate states of the dual resonance pomeron with multiperipheral processes. (Auth.)

  11. Generalized viscothermoelasticity theory of dual-phase-lagging model for damping analysis in circular micro-plate resonators

    Science.gov (United States)

    Grover, D.; Seth, R. K.

    2018-05-01

    Analysis and numerical results are presented for the thermoelastic dissipation of a homogeneous isotropic, thermally conducting, Kelvin-Voigt type circular micro-plate based on Kirchhoff's Love plate theory utilizing generalized viscothermoelasticity theory of dual-phase-lagging model. The analytical expressions for thermoelastic damping of vibration and frequency shift are obtained for generalized dual-phase-lagging model and coupled viscothermoelastic plates. The scaled thermoelastic damping has been illustrated in case of circular plate and axisymmetric circular plate for fixed aspect ratio for clamped and simply supported boundary conditions. It is observed that the damping of vibrations significantly depend on time delay and mechanical relaxation times in addition to thermo-mechanical coupling in circular plate under resonance conditions and plate dimensions.

  12. Vacuum transitions in dual models

    International Nuclear Information System (INIS)

    Pashnev, A.I.; Volkov, D.V.; Zheltukhin, A.A.

    1976-01-01

    The investigation is continued of the spontaneous vacuum transition problem in the Neview-Schwartz dual model (NSDM). It is shown that vacuum transitions allow disclosing of supplementary degeneration in the resonance state spectrum. The dual amplitudes possess an internal structure corresponding to the presence of an infinite number of quarks with increasing masses and retained charges. The Adler principle holds. Analytic continuation on the constant of induced vacuum transitions makes it possible to establish the existence of spontaneous vacuum transitions in the NSDM. The consequence of this fact is the exact SU(2) symmetry of π, rho meson trajectories and the Higgs mechanism in the model. In this case the ratios of masses of particles leading trajectories are analogous to those obtained in the current algebra. It is shown that in the NSDM there arises chiral SU(2) x SU(2) x U(1) x U(1) x ... symmetry resulting from spontaneous vacuum transitions

  13. Analysis and measurement of the stability of dual-resonator oscillators

    KAUST Repository

    Ghaed, Hassan

    2012-01-01

    This paper investigates the stability of oscillators with dual-resonating tanks. After deriving oscillator models, it is shown that contrary to prior belief, there can be only one stable oscillating state. Sufficient conditions for stable oscillating states are derived and silicon measurement results are used to prove their validity. A fully integrated transmitter for intraocular pressure sensing that leverages the dual-resonator tank is designed and fabricated based on the derived models. An unstable version of the transmitter is also demonstrated to prove the concept of instability in dual-resonator oscillators © 2012 IEEE.

  14. Dual-Schemata Model

    Science.gov (United States)

    Taniguchi, Tadahiro; Sawaragi, Tetsuo

    In this paper, a new machine-learning method, called Dual-Schemata model, is presented. Dual-Schemata model is a kind of self-organizational machine learning methods for an autonomous robot interacting with an unknown dynamical environment. This is based on Piaget's Schema model, that is a classical psychological model to explain memory and cognitive development of human beings. Our Dual-Schemata model is developed as a computational model of Piaget's Schema model, especially focusing on sensori-motor developing period. This developmental process is characterized by a couple of two mutually-interacting dynamics; one is a dynamics formed by assimilation and accommodation, and the other dynamics is formed by equilibration and differentiation. By these dynamics schema system enables an agent to act well in a real world. This schema's differentiation process corresponds to a symbol formation process occurring within an autonomous agent when it interacts with an unknown, dynamically changing environment. Experiment results obtained from an autonomous facial robot in which our model is embedded are presented; an autonomous facial robot becomes able to chase a ball moving in various ways without any rewards nor teaching signals from outside. Moreover, emergence of concepts on the target movements within a robot is shown and discussed in terms of fuzzy logics on set-subset inclusive relationships.

  15. A dual resonant rectilinear-to-rotary oscillation converter for low frequency broadband electromagnetic energy harvesting

    Science.gov (United States)

    Deng, Wei; Wang, Ya

    2017-09-01

    This paper reports a dual resonant rectilinear-to-rotary oscillation converter (RROC) for low frequency broadband electromagnetic energy harvesting from ambient vibrations. An approximate theoretical model has been established to integrate the electromechanical coupling into a comprehensive electromagnetic-dynamic model of the dual resonant RROC. Numerical simulation has proved the nature of dual resonances by revealing that both the rectilinear resonance and the rotary resonance could be achieved when the stand-alone rectilinear oscillator (RLO) and the stand-alone rotary oscillator (RTO) were excited independently. Simulation on the magnetically coupled RROC has also shown that the rectilinear resonance and the rotary resonance could be obtained simultaneously in the low-frequency region (2-14 Hz) with well-defined restoring torque (M r ) and the initial rotation angle of the RLO (ψ). The magnetic interaction patterns between the rectilinear and the RTOs have been categorized based on aforementioned simulation results. Both simulation and experimental results have demonstrated broadband output attributing from the dual resonances. Experimental results have also indicated that the RROC could have wide bandwidth in a much lower frequency region (2-8 Hz) even without the rotary resonance as long as the system parameters are carefully tuned. Parameter analysis on different values of M r and ψ are experimentally carried out to provide a quantitative guidance of designing the RROC to achieve an optimal power density.

  16. Dual band metamaterial perfect absorber based on Mie resonances

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiaoming; Lan, Chuwen; Li, Bo; Zhou, Ji, E-mail: zhouji@tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Bi, Ke [School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhao, Qian [State Key Lab of Tribology, Department of Precision Instruments and Mechanology, Tsinghua University, Beijing 100084 (China)

    2016-08-08

    We numerically and experimentally demonstrated a polarization insensitive dual-band metamaterial perfect absorber working in wide incident angles based on the two magnetic Mie resonances of a single dielectric “atom” with simple structure. Two absorption bands with simulated absorptivity of 99% and 96%, experimental absorptivity of 97% and 94% at 8.45 and 11.97 GHz were achieved due to the simultaneous magnetic and electric resonances in dielectric “atom” and copper plate. Mie resonances of dielectric “atom” provide a simple way to design metamaterial perfect absorbers with high symmetry.

  17. Design of a dual linear polarization antenna using split ring resonators at X-band

    Science.gov (United States)

    Ahmed, Sadiq; Chandra, Madhukar

    2017-11-01

    Dual linear polarization microstrip antenna configurations are very suitable for high-performance satellites, wireless communication and radar applications. This paper presents a new method to improve the co-cross polarization discrimination (XPD) for dual linear polarized microstrip antennas at 10 GHz. For this, three various configurations of a dual linear polarization antenna utilizing metamaterial unit cells are shown. In the first layout, the microstrip patch antenna is loaded with two pairs of spiral ring resonators, in the second model, a split ring resonator is placed between two microstrip feed lines, and in the third design, a complementary split ring resonators are etched in the ground plane. This work has two primary goals: the first is related to the addition of metamaterial unit cells to the antenna structure which permits compensation for an asymmetric current distribution flow on the microstrip antenna and thus yields a symmetrical current distribution on it. This compensation leads to an important enhancement in the XPD in comparison to a conventional dual linear polarized microstrip patch antenna. The simulation reveals an improvement of 7.9, 8.8, and 4 dB in the E and H planes for the three designs, respectively, in the XPD as compared to the conventional dual linear polarized patch antenna. The second objective of this paper is to present the characteristics and performances of the designs of the spiral ring resonator (S-RR), split ring resonator (SRR), and complementary split ring resonator (CSRR) metamaterial unit cells. The simulations are evaluated using the commercial full-wave simulator, Ansoft High-Frequency Structure Simulator (HFSS).

  18. Theory and Applications of Surface Plasmon Resonance, Resonant Mirror, Resonant Waveguide Grating, and Dual Polarization Interferometry Biosensors

    Directory of Open Access Journals (Sweden)

    Billy W. Day

    2010-11-01

    Full Text Available Biosensors have been used extensively in the scientific community for several purposes, most notably to determine association and dissociation kinetics, protein-ligand, protein-protein, or nucleic acid hybridization interactions. A number of different types of biosensors are available in the field, each with real or perceived benefits over the others. This review discusses the basic theory and operational arrangements of four commercially available types of optical biosensors: surface plasmon resonance, resonant mirror, resonance waveguide grating, and dual polarization interferometry. The different applications these techniques offer are discussed from experiments and results reported in recently published literature. Additionally, recent advancements or modifications to the current techniques are also discussed.

  19. Compact Dual-Band Zeroth-Order Resonance Antenna

    International Nuclear Information System (INIS)

    Xu He-Xiu; Wang Guang-Ming; Gong Jian-Qiang

    2012-01-01

    A novel microstrip zeroth-order resonator (ZOR) antenna and its equivalent circuit model are exploited with two zeroth-order resonances. It is constructed based on a resonant-type composite right/left handed transmission line (CRLH TL) using a Wunderlich-shaped extended complementary single split ring resonator pair (W-ECSSRRP) and a series capacitive gap. The gap either can be utilized for double negative (DNG) ZOR antenna or be removed to engineer a simplified elision-negative ZOR (ENG) antenna. For verification, a DNG ZOR antenna sample is fabricated and measured. Numerical and experimental results agree well with each other, indicating that the omnidirectional radiations occur at two frequency bands which are accounted for by two shunt branches in the circuit model. The size of the antenna is 49% more compact than its previous counterpart. The superiority of W-ECSSRRP over CSSRRP lies in the lower fundamental resonance of the antenna by 38.2% and the introduction of a higher zeroth-order resonance. (fundamental areas of phenomenology(including applications))

  20. Dual resonant structure for energy harvesting from random vibration sources at low frequency

    Directory of Open Access Journals (Sweden)

    Shanshan Li

    2016-01-01

    Full Text Available We introduce a design with dual resonant structure which can harvest energy from random vibration sources at low frequency range. The dual resonant structure consists of two spring-mass subsystems with different frequency responses, which exhibit strong coupling and broad bandwidth when the two masses collide with each other. Experiments with piezoelectric elements show that the energy harvesting device with dual resonant structure can generate higher power output than the sum of the two separate devices from random vibration sources.

  1. Dual-Resonant Implantable Circular Patch Antenna for Biotelemetry Communication

    Directory of Open Access Journals (Sweden)

    Rongqiang Li

    2016-01-01

    Full Text Available A compact broadband implantable circular patch antenna is designed and experimentally demonstrated for Medical Implant Communications Service (MICS band (402–405 MHz. Compared with other similar implantable antennas, the proposed antenna incorporates three advantages for biotelemetry communication. First, it can realize a broad impedance bandwidth by exhibiting dual resonances. Second, it can obtain a compact structure by introducing two arc-shaped slots, a rectangular slot and a circular slot on metal radiating patch. Finally, it can display a friendly shape by using a circular structure. The proposed antenna occupies a volume of about 431.5 mm3 (10.42 × 1.27π mm3, which is a compromise between miniaturization and bandwidth. The measured −10 dB impedance bandwidth is 55 MHz (385–440 MHz. Furthermore, the radiation performance and human body safety consideration of the antenna are examined and characterized.

  2. Measurement of vertebral bone marrow lipid profile at 1.5-T proton magnetic resonance spectroscopy and bone mineral density at dual-energy X-ray absorptiometry: correlation in a swine model

    Energy Technology Data Exchange (ETDEWEB)

    Di Leo, Giovanni; Fina, Laura [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Bandirali, Michele; Messina, Carmelo [Universita degli Studi di Milano, Scuola di Specializzazione in Radiodiagnostica, Milan (Italy); Sardanelli, Francesco [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Universita degli Studi di Milano, Dipartimento di Scienze Biomediche per la Salute, San Donato Milanese (Italy)

    2014-08-15

    Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.

  3. Measurement of vertebral bone marrow lipid profile at 1.5-T proton magnetic resonance spectroscopy and bone mineral density at dual-energy X-ray absorptiometry: correlation in a swine model

    International Nuclear Information System (INIS)

    Di Leo, Giovanni; Fina, Laura; Bandirali, Michele; Messina, Carmelo; Sardanelli, Francesco

    2014-01-01

    Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.

  4. Dual-band plasmonic resonator based on Jerusalem cross-shaped nanoapertures

    Science.gov (United States)

    Cetin, Arif E.; Kaya, Sabri; Mertiri, Alket; Aslan, Ekin; Erramilli, Shyamsunder; Altug, Hatice; Turkmen, Mustafa

    2015-06-01

    In this paper, we both experimentally and numerically introduce a dual-resonant metamaterial based on subwavelength Jerusalem cross-shaped apertures. We numerically investigate the physical origin of the dual-resonant behavior, originating from the constituting aperture elements, through finite difference time domain calculations. Our numerical calculations show that at the dual-resonances, the aperture system supports large and easily accessible local electromagnetic fields. In order to experimentally realize the aperture system, we utilize a high-precision and lift-off free fabrication method based on electron-beam lithography. We also introduce a fine-tuning mechanism for controlling the dual-resonant spectral response through geometrical device parameters. Finally, we show the aperture system's highly advantageous far- and near-field characteristics through numerical calculations on refractive index sensitivity. The quantitative analyses on the availability of the local fields supported by the aperture system are employed to explain the grounds behind the sensitivity of each spectral feature within the dual-resonant behavior. Possessing dual-resonances with large and accessible electromagnetic fields, Jerusalem cross-shaped apertures can be highly advantageous for wide range of applications demanding multiple spectral features with strong nearfield characteristics.

  5. Fluorescence and Magnetic Resonance Dual-Modality Imaging-Guided Photothermal and Photodynamic Dual-Therapy with Magnetic Porphyrin-Metal Organic Framework Nanocomposites

    Science.gov (United States)

    Zhang, Hui; Li, Yu-Hao; Chen, Yang; Wang, Man-Man; Wang, Xue-Sheng; Yin, Xue-Bo

    2017-03-01

    Phototherapy shows some unique advantages in clinical application, such as remote controllability, improved selectivity, and low bio-toxicity, than chemotherapy. In order to improve the safety and therapeutic efficacy, imaging-guided therapy seems particularly important because it integrates visible information to speculate the distribution and metabolism of the probe. Here we prepare biocompatible core-shell nanocomposites for dual-modality imaging-guided photothermal and photodynamic dual-therapy by the in situ growth of porphyrin-metal organic framework (PMOF) on Fe3O4@C core. Fe3O4@C core was used as T2-weighted magnetic resonance (MR) imaging and photothermal therapy (PTT) agent. The optical properties of porphyrin were well remained in PMOF, and PMOF was therefore selected for photodynamic therapy (PDT) and fluorescence imaging. Fluorescence and MR dual-modality imaging-guided PTT and PDT dual-therapy was confirmed with tumour-bearing mice as model. The high tumour accumulation of Fe3O4@C@PMOF and controllable light excitation at the tumour site achieved efficient cancer therapy, but low toxicity was observed to the normal tissues. The results demonstrated that Fe3O4@C@PMOF was a promising dual-imaging guided PTT and PDT dual-therapy platform for tumour diagnosis and treatment with low cytotoxicity and negligible in vivo toxicity.

  6. Dual model for parton densities

    International Nuclear Information System (INIS)

    El Hassouni, A.; Napoly, O.

    1981-01-01

    We derive power-counting rules for quark densities near x=1 and x=0 from parton interpretations of one-particle inclusive dual amplitudes. Using these rules, we give explicit expressions for quark distributions (including charm) inside hadrons. We can then show the compatibility between fragmentation and recombination descriptions of low-p/sub perpendicular/ processes

  7. Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

    DEFF Research Database (Denmark)

    Pu, Minhao; Liu, Liu; Xue, Weiqi

    2010-01-01

    We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator...

  8. Compact Dual-Band Bandpass Filter Using Stubs Loaded Ring Resonator

    Science.gov (United States)

    Xu, Jin

    2016-01-01

    This paper presents a novel second-order dual-band bandpass filter (BPF) by using proposed stubs loaded ring resonator. The resonant behavior of proposed stubs loaded ring resonator is analyzed by even-/odd-mode method, which shows its multiple-mode resonant characteristic. Parameters sweep is done so as to give the design guidelines. As an example, a second-order dual-band BPF operating at 1.8/5.2 GHz for GSM and WLAN applications is designed, fabricated and measured. The fabricated filter has a very compact size of 0.05λg×0.15λg. Measured results also show that the proposed dual-band BPF has a better than 20 dB rejection upper stopband from 5.47 GHz to 12.56 GHz. Good agreement is shown between the simulated and measured results.

  9. Nonword Reading: Comparing Dual-Route Cascaded and Connectionist Dual-Process Models with Human Data

    Science.gov (United States)

    Pritchard, Stephen C.; Coltheart, Max; Palethorpe, Sallyanne; Castles, Anne

    2012-01-01

    Two prominent dual-route computational models of reading aloud are the dual-route cascaded (DRC) model, and the connectionist dual-process plus (CDP+) model. While sharing similarly designed lexical routes, the two models differ greatly in their respective nonlexical route architecture, such that they often differ on nonword pronunciation. Neither…

  10. Ultrasmall Dual-Band Metamaterial Antennas Based on Asymmetrical Hybrid Resonators

    Directory of Open Access Journals (Sweden)

    Ji-Xu Zhu

    2016-01-01

    Full Text Available A new type of hybrid resonant circuit model is investigated theoretically and experimentally. The resonant model consists of a right hand (RH patch part and a composite right and left handed (CRLH part (RH + CRLH, which determines a compact size and also a convenient frequency modulation characteristic for the proposed antennas. For experimental demonstration, two antennas are fabricated. The former dual-band antenna operating at f-1=3.5 GHz (Wimax and f+1=5.25 GHz (WLAN occupies an area of 0.21λ0×0.08λ0, and two dipolar radiation patterns are obtained with comparable gains of about 6.1 and 6.2 dB, respectively. The latter antenna advances in many aspects such as an ultrasmall size of only 0.16λ0×0.08λ0, versatile radiation patterns with a monopolar pattern at f0=2.4 GHz (Bluetooth, and a dipole one at f+1=3.5 GHz (Wimax and also comparable antenna gains. Circuit parameters are extracted and researched. Excellent performances of the antennas based on hybrid resonators predict promising applications in multifunction wireless communication systems.

  11. Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

    Energy Technology Data Exchange (ETDEWEB)

    Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)

    2017-12-15

    Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

  12. Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

    International Nuclear Information System (INIS)

    Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian

    2017-01-01

    Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

  13. Animal Modeling and Neurocircuitry of Dual Diagnosis

    Science.gov (United States)

    Chambers, R. Andrew

    2010-01-01

    Dual diagnosis is a problem of tremendous depth and scope, spanning many classes of mental disorders and addictive drugs. Animal models of psychiatric disorders studied in addiction paradigms suggest a unitary nature of mental illness and addiction vulnerability both on the neurocircuit and clinical-behavioral levels. These models provide platforms for exploring the interactive roles of biological, environmental and developmental factors on neurocircuits commonly involved in psychiatric and addiction diseases. While suggestive of the artifice of segregated research, training, and clinical cultures between psychiatric and addiction fields, this research may lead to more parsimonious, integrative and preventative treatments for dual diagnosis. PMID:20585464

  14. Theoretical approach for plasma series resonance effect in geometrically symmetric dual radio frequency plasma

    International Nuclear Information System (INIS)

    Bora, B.; Bhuyan, H.; Favre, M.; Wyndham, E.; Chuaqui, H.

    2012-01-01

    Plasma series resonance (PSR) effect is well known in geometrically asymmetric capacitively couple radio frequency plasma. However, plasma series resonance effect in geometrically symmetric plasma has not been properly investigated. In this work, a theoretical approach is made to investigate the plasma series resonance effect and its influence on Ohmic and stochastic heating in geometrically symmetric discharge. Electrical asymmetry effect by means of dual frequency voltage waveform is applied to excite the plasma series resonance. The results show considerable variation in heating with phase difference between the voltage waveforms, which may be applicable in controlling the plasma parameters in such plasma.

  15. Model for resonant plasma probe.

    Energy Technology Data Exchange (ETDEWEB)

    Warne, Larry Kevin; Johnson, William Arthur; Hebner, Gregory Albert; Jorgenson, Roy E.; Coats, Rebecca Sue

    2007-04-01

    This report constructs simple circuit models for a hairpin shaped resonant plasma probe. Effects of the plasma sheath region surrounding the wires making up the probe are determined. Electromagnetic simulations of the probe are compared to the circuit model results. The perturbing effects of the disc cavity in which the probe operates are also found.

  16. 360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

    DEFF Research Database (Denmark)

    Pu, Minhao; Xue, Weiqi; Liu, Liu

    2010-01-01

    We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...

  17. Dual elaboration models in attitude change processes

    Directory of Open Access Journals (Sweden)

    Žeželj Iris

    2005-01-01

    Full Text Available This article examines empirical and theoretical developments in research on attitude change in the past 50 years. It focuses the period from 1980 till present as well as cognitive response theories as the dominant theoretical approach in the field. The postulates of Elaboration Likelihood Model, as most-researched representative of dual process theories are studied, based on review of accumulated research evidence. Main research findings are grouped in four basic factors: message source, message content, message recipient and its context. Most influential criticisms of the theory are then presented regarding its empirical base and dual process assumption. Some possible applications and further research perspectives are discussed at the end.

  18. Distributed Model Predictive Control via Dual Decomposition

    DEFF Research Database (Denmark)

    Biegel, Benjamin; Stoustrup, Jakob; Andersen, Palle

    2014-01-01

    This chapter presents dual decomposition as a means to coordinate a number of subsystems coupled by state and input constraints. Each subsystem is equipped with a local model predictive controller while a centralized entity manages the subsystems via prices associated with the coupling constraints...

  19. Hybrid method to predict the resonant frequencies and to characterise dual band proximity coupled microstrip antennas

    Science.gov (United States)

    Varma, Ruchi; Ghosh, Jayanta

    2018-06-01

    A new hybrid technique, which is a combination of neural network (NN) and support vector machine, is proposed for designing of different slotted dual band proximity coupled microstrip antennas. Slots on the patch are employed to produce the second resonance along with size reduction. The proposed hybrid model provides flexibility to design the dual band antennas in the frequency range from 1 to 6 GHz. This includes DCS (1.71-1.88 GHz), PCS (1.88-1.99 GHz), UMTS (1.92-2.17 GHz), LTE2300 (2.3-2.4 GHz), Bluetooth (2.4-2.485 GHz), WiMAX (3.3-3.7 GHz), and WLAN (5.15-5.35 GHz, 5.725-5.825 GHz) bands applications. Also, the comparative study of this proposed technique is done with the existing methods like knowledge based NN and support vector machine. The proposed method is found to be more accurate in terms of % error and root mean square % error and the results are in good accord with the measured values.

  20. Electrostatic energy harvesting device with dual resonant structure for wideband random vibration sources at low frequency.

    Science.gov (United States)

    Zhang, Yulong; Wang, Tianyang; Zhang, Ai; Peng, Zhuoteng; Luo, Dan; Chen, Rui; Wang, Fei

    2016-12-01

    In this paper, we present design and test of a broadband electrostatic energy harvester with a dual resonant structure, which consists of two cantilever-mass subsystems each with a mass attached at the free edge of a cantilever. Comparing to traditional devices with single resonant frequency, the proposed device with dual resonant structure can resonate at two frequencies. Furthermore, when one of the cantilever-masses is oscillating at resonance, the vibration amplitude is large enough to make it collide with the other mass, which provides strong mechanical coupling between the two subsystems. Therefore, this device can harvest a decent power output from vibration sources at a broad frequency range. During the measurement, continuous power output up to 6.2-9.8 μW can be achieved under external vibration amplitude of 9.3 m/s 2 at a frequency range from 36.3 Hz to 48.3 Hz, which means the bandwidth of the device is about 30% of the central frequency. The broad bandwidth of the device provides a promising application for energy harvesting from the scenarios with random vibration sources. The experimental results indicate that with the dual resonant structure, the vibration-to-electricity energy conversion efficiency can be improved by 97% when an external random vibration with a low frequency filter is applied.

  1. Experimental evidence for dual diffractive resonances in nucleon-nucleus scattering

    International Nuclear Information System (INIS)

    Ion, D.B.; Ion-Mihai, R.

    1981-09-01

    Experimental data on nucleon-nucleus scattering for laboratory momenta between 0.9:10 GeV/c are analysed in terms of the dual diffractive resonance (DDR) mechanism. The experimental data for all the nuclei are found to agree well with the predictions of the collective DDR states dominance. (authors)

  2. On Goldstone particles and the Adler principle in dual models

    International Nuclear Information System (INIS)

    Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.

    1975-01-01

    The results that have been obtained on the basis of considering the spontaneous vacuum transitions for the cases of Veneziano dual model and dual M-model are generalized to model containing internal quantum numbers of SU(N)-group. This generalization allows to consider how in dual models the spontaneous violation of symmetry occurs, which Goldstone particles appear in this process, how Adler's principle is realized for dual amplitudes and their topics related of spontaneous violation of symmetry

  3. Experimental results of high power dual frequency resonant magnet excitation at TRIUMF

    International Nuclear Information System (INIS)

    Reiniger, K.W.; Heritier, G.

    1988-06-01

    We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)

  4. Design and analysis of a novel dual-mass MEMS resonant output gyroscope

    Directory of Open Access Journals (Sweden)

    Yang Gao

    2018-02-01

    Full Text Available This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS resonant output gyroscope (ROG, which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.

  5. Dual-axis resonance testing of wind turbine blades

    Science.gov (United States)

    Hughes, Scott; Musial, Walter; White, Darris

    2014-01-07

    An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.

  6. Dual superconductor models of color confinement

    CERN Document Server

    Ripka, Georges

    2004-01-01

    The lectures, delivered at ECT (European Centre for Theoretical Studies in Nuclear Physics and Related Areas) in Trento (Italy) in 2002 and 2003, are addressed to physicists who wish to acquire a minimal background to understand present day attempts to model the confinement of quantum chromo-dynamics (QCD) in terms of dual superconductors. The lectures focus more on the models than on attempts to derive them from QCD. They discuss the Dirac theory of magnetic monopoles, the world sheet swept out by Dirac strings, deformations of Dirac strings and charge quantization, gauge fields associated to the field tensor and to the dual field tensor, the Landau-Ginzburg (Abelian Higgs) model of a dual superconductor, the flux tube joining two equal and opposite color-electric charges, the Abrikosov-Nielsen-Olesen vortex, the divergencies of the London limit, the comparison of the calculated flux tube and string tension with lattice data, duality transformations and the use of Kalb-Ramond fields, the two-potential Zwanzi...

  7. Dual and tri-band bandpass filters based on novel Π-shaped resonator

    Science.gov (United States)

    Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei

    2014-05-01

    A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.

  8. Geometrical optics model of Mie resonances

    Science.gov (United States)

    Roll; Schweiger

    2000-07-01

    The geometrical optics model of Mie resonances is presented. The ray path geometry is given and the resonance condition is discussed with special emphasis on the phase shift that the rays undergo at the surface of the dielectric sphere. On the basis of this model, approximate expressions for the positions of first-order resonances are given. Formulas for the cavity mode spacing are rederived in a simple manner. It is shown that the resonance linewidth can be calculated regarding the cavity losses. Formulas for the mode density of Mie resonances are given that account for the different width of resonances and thus may be adapted to specific experimental situations.

  9. Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency

    Directory of Open Access Journals (Sweden)

    C. Baccouch

    2016-11-01

    Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally   it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.

  10. The dual of the Carroll-Field-Jackiw model

    International Nuclear Information System (INIS)

    Guimaraes, M.S.; Grigorio, L.; Wotzasek, C.

    2006-01-01

    In this work we apply different duality techniques, both the dual projection, based on the soldering formalism and the master action, in order to obtain and study the dual description of the Carroll- Field-Jackiw model [1], a theory with a Chern-Simons-like explicitly Lorentz and CPT violating term, including the interaction with external charges. This Maxwell-Chern-Simons-like model may be rewritten in terms of the interacting modes of a massless scalar model and a topologically massive model [2], that are mapped, through duality, into interacting massless Maxwell and massive self-dual modes [3]. It is also shown that these dual modes might be represented into an unified rank-two self-dual model that represents the direct dual of the vector Maxwell-Chern-Simons-like model

  11. Design of ultrathin dual-resonant reflective polarization converter with customized bandwidths

    Science.gov (United States)

    Kundu, Debidas; Mohan, Akhilesh; Chakrabarty, Ajay

    2017-10-01

    In this paper, an ultrathin dual-resonant reflective polarization converter is proposed to obtain customized bandwidths using precise space-filling technique to its top geometry. The unit cell of the dual-resonant prototype consists of conductive square ring with two diagonally arranged slits, supported by metal-backed thin dielectric layer. It offers two narrow bands with fractional bandwidths of 3.98 and 6.65% and polarization conversion ratio (PCR) of 97.16 and 98.87% at 4.52 and 6.97 GHz, respectively. The resonances are brought in proximity to each other by changing the length of surface current paths of the two resonances. By virtue of this mechanism, two polarization converters with two different types of bandwidths are obtained. One polarization converter produces a full-width at half-maxima PCR bandwidth of 34%, whereas another polarization converter produces a 90% PCR bandwidth of 19%. All the proposed polarization converters are insensitive to wide variations of incident angle for both TE- and TM-polarized incident waves. Measured results show good agreement with the numerically simulated results.

  12. Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams

    Directory of Open Access Journals (Sweden)

    Xiaohui Du

    2016-01-01

    Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.

  13. Dual models with SL(2, C) symmetry

    CERN Document Server

    Brink, L

    1972-01-01

    Making use of homogeneous space techniques, the authors construct a class of dual models, which is a generalization of the Virasoro- Shapiro type of model. The integrand in the integral representation for the N-point function depends not only on the modulus of the distances between two-dimensional Koba-Nielsen variables, but also on the corresponding phases. This is in fact the most general SL(2, C) invariant amplitude that can be constructed using complex integration variables. The extra phase factors in the integrand provide a possible means of avoiding tachyons both as external particles and as intermediate states in the amplitude. When factorized in a simple- minded fashion the intercepts are fixed to be integers. Although the external particles can be chosen not to be tachyons, such states appear as intermediate states. Within this factorization one can show that there are gauge conditions for the amplitude that can provide a ghostkilling mechanism. (19 refs).

  14. Dual Numbers Approach in Multiaxis Machines Error Modeling

    Directory of Open Access Journals (Sweden)

    Jaroslav Hrdina

    2014-01-01

    Full Text Available Multiaxis machines error modeling is set in the context of modern differential geometry and linear algebra. We apply special classes of matrices over dual numbers and propose a generalization of such concept by means of general Weil algebras. We show that the classification of the geometric errors follows directly from the algebraic properties of the matrices over dual numbers and thus the calculus over the dual numbers is the proper tool for the methodology of multiaxis machines error modeling.

  15. Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.

    Science.gov (United States)

    Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun

    2014-03-01

    To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.

  16. Dual-band reflective polarization converter based on slotted wire resonators

    Science.gov (United States)

    Li, Fengxia; Zhang, Linbo; Zhou, Peiheng; Chen, Haiyan; Zhao, Rui; Zhou, Yang; Liang, Difei; Lu, Haipeng; Deng, Longjiang

    2018-02-01

    A dual-band and high-efficiency reflective linear polarization converter composed of a layer of slotted metal wires has been proposed. Both the simulated and experimental results indicate that the structure can convert a linearly polarized wave to its cross-polarized state for two distinct frequency bands under normal incidence: 9.8-15.1 and 19.2-25.7 GHz. This phenomenon is attributed to a resonance that corresponds to the "trapped mode" at 15.8 GHz. This mode is stable with structural parameters and incident angle at a relatively wide range, and thus becomes promising for dual-band (also multiband) devices design. By surface current distribution and electric field analysis, the operation mechanism has been illuminated, especially for the "trapped mode", identified by the equally but also oppositely directed currents in each unit cell.

  17. Topics in dual models and extended solutions

    International Nuclear Information System (INIS)

    Roth, R.S.

    1977-01-01

    Two main topics are explored. The first deals with the infinities arising from the one loop planar string diagram of the standard dual model. It is shown that for the number of dimensions d = 25 or 26, these infinities lead to a renormalization of the slope of the Regge trajectories, in addition to a renormalization of the coupling constant. The second topic deals with the propagator for a confined particle (monopole) in a field theory. When summed to all orders, this propagator is altogether free of singularities in the finite momentum plane, and an attempt is made to illustrate this. The Bethe-Salpeter equation is examined and it is shown that ladder diagrams are not sufficient to obtain this result. However, in a nonrelativistic approximation confinement is obtained and all poles disappear

  18. New results in the Dual Parton Model

    International Nuclear Information System (INIS)

    Van, J.T.T.; Capella, A.

    1984-01-01

    In this paper, the similarity between the x distribution for particle production and the fragmentation functions are observed in e+e- collisions and in deep inelastic scattering are presented. Based on the observation, the authors develop a complete approach to multiparticle production which incorporates the most important features and concepts learned about high energy collisions. 1. Topological expansion : the dominant diagram at high energy corresponds to the simplest topology. 2. Unitarity : diagrams of various topology contribute to the cross sections in a way that unitary is preserved. 3. Regge behaviour and Duality. 4. Partonic structure of hadrons. These general theoretical ideas, result from many joint experimental and theoretical efforts on the study of soft hadron physics. The dual parton model is able to explain all the experimental features from FNAL to SPS collider energies. It has all the properties of an S-matrix theory and provides a unified description of hadron-hadron, hadron-nucleus and nucleus-nucleus collisions

  19. The dual model of perfectionism and depression among Chinese ...

    African Journals Online (AJOL)

    The dual model of perfectionism was adopted to explore the influence of adaptive and maladaptive perfectionism on depression in college students. The results support the dual process model of perfectionism in Chinese undergraduates. A sample of 206 Chinese undergraduates completed measures of perfectionism, ...

  20. Study of loading by beam of dual-resonator structure of linear electron accelerator

    International Nuclear Information System (INIS)

    Milovanov, O.S.; Smirnov, I.A.

    1988-01-01

    Loading by the beam of the accelerating structure of an Argus dual-resonator linear electron accelerator with a kinetic energy of ∼ 1 MeV and a pulsed beam current of up to 0.5 A is studied experimentally. It is shown that the conditions for stable single-frequency operation of the magnetron are disrupted and the acceleration process is cut off at certain electron-beam currents. Experimental curves of the maximum beam current and maximum electron efficiency of the Argus linear electron accelerator as functions of rf power are given

  1. Modeling of supermodes in coupled unstable resonators

    International Nuclear Information System (INIS)

    Townsend, S.S.

    1986-01-01

    A general formalism describing the supermodes of an array of N identical, circulantly coupled resonators is presented. The symmetry of the problem results in a reduction of the N coupled integral equations to N decoupled integral equations. Each independent integral equation defines a set of single-resonator modes derived for a hypothetical resonator whose geometry resembles a member of the real array with the exception that all coupling beams are replaced by feedback beams, each with a prescribed constant phase. A given array supermode consists of a single equivalent resonator mode appearing repetitively in each resonator with a prescribed relative phase between individual resonators. The specific array design chosen for example is that of N adjoint coupled confocal unstable resonators. The impact of coupling on the computer modeling of this system is discussed and computer results for the cases of two- and four-laser coupling are presented

  2. Dielectric Meta-Holograms Enabled with Dual Magnetic Resonances in Visible Light.

    Science.gov (United States)

    Li, Zile; Kim, Inki; Zhang, Lei; Mehmood, Muhammad Q; Anwar, Muhammad S; Saleem, Murtaza; Lee, Dasol; Nam, Ki Tae; Zhang, Shuang; Luk'yanchuk, Boris; Wang, Yu; Zheng, Guoxing; Rho, Junsuk; Qiu, Cheng-Wei

    2017-09-26

    Efficient transmission-type meta-holograms have been demonstrated using high-index dielectric nanostructures based on Huygens' principle. It is crucial that the geometry size of building blocks be judiciously optimized individually for spectral overlap of electric and magnetic dipoles. In contrast, reflection-type meta-holograms using the metal/insulator/metal scheme and geometric phase can be readily achieved with high efficiency and small thickness. Here, we demonstrate a general platform for design of dual magnetic resonance based meta-holograms based on the geometric phase using silicon nanostructures that are quarter wavelength thick for visible light. Significantly, the projected holographic image can be unambiguously observed without a receiving screen even under the illumination of natural light. Within the well-developed semiconductor industry, our ultrathin magnetic resonance-based meta-holograms may have promising applications in anticounterfeiting and information security.

  3. The Complexity of Developmental Predictions from Dual Process Models

    Science.gov (United States)

    Stanovich, Keith E.; West, Richard F.; Toplak, Maggie E.

    2011-01-01

    Drawing developmental predictions from dual-process theories is more complex than is commonly realized. Overly simplified predictions drawn from such models may lead to premature rejection of the dual process approach as one of many tools for understanding cognitive development. Misleading predictions can be avoided by paying attention to several…

  4. A Dual System Model of Preferences under Risk

    Science.gov (United States)

    Mukherjee, Kanchan

    2010-01-01

    This article presents a dual system model (DSM) of decision making under risk and uncertainty according to which the value of a gamble is a combination of the values assigned to it independently by the affective and deliberative systems. On the basis of research on dual process theories and empirical research in Hsee and Rottenstreich (2004) and…

  5. Performance Improvement of Polymer Solar Cells by Surface-Energy-Induced Dual Plasmon Resonance.

    Science.gov (United States)

    Yao, Mengnan; Shen, Ping; Liu, Yan; Chen, Boyuan; Guo, Wenbin; Ruan, Shengping; Shen, Liang

    2016-03-09

    The surface plasmon resonance (SPR) effect of metal nanoparticles (MNPs) is effectively applied on polymer solar cells (PSCs) to improve power conversion efficiency (PCE). However, universality of the reported results mainly focused on utilizing single type of MNPs to enhance light absorption only in specific narrow wavelength range. Herein, a surface-energy-induced dual MNP plasmon resonance by thermally evaporating method was presented to achieve the absorption enhancement in wider range. The differences of surface energy between silver (Ag), gold (Au), and tungsten trioxide (WO3) compared by contact angle images enable Ag and Au prefer to respectively aggregate into isolated islands rather than films at the initial stage of the evaporation process, which was clearly demonstrated in the atomic force microscopy (AFM) measurement. The sum of plasmon-enhanced wavelength range induced by both Ag NPs (350-450 nm) and Au NPs (450-600 nm) almost cover the whole absorption spectra of active layers, which compatibly contribute a significant efficiency improvement from 4.57 ± 0.16 to 6.55 ± 0.12% compared to the one without MNPs. Besides, steady state photoluminescence (PL) measurements provide strong evidence that the SPR induced by the Ag-Au NPs increase the intensity of light absorption. Finally, ultraviolet photoelectron spectroscopy (UPS) reveals that doping Au and Ag causes upper shift of both the work function and valence band of WO3, which is directly related to hole collection ability. We believe the surface-energy-induced dual plasmon resonance enhancement by simple thermally evaporating technique might pave the way toward higher-efficiency PSCs.

  6. Charge distribution in an two-chain dual model

    International Nuclear Information System (INIS)

    Fialkowski, K.; Kotanski, A.

    1983-01-01

    Charge distributions in the multiple production processes are analysed using the dual chain model. A parametrisation of charge distributions for single dual chains based on the νp and anti vp data is proposed. The rapidity charge distributions are then calculated for pp and anti pp collisions and compared with the previous calculations based on the recursive cascade model of single chains. The results differ at the SPS collider energies and in the energy dependence of the net forward charge supplying the useful tests of the dual chain model. (orig.)

  7. Throughput Measurement of a Dual-Band MIMO Rectangular Dielectric Resonator Antenna for LTE Applications.

    Science.gov (United States)

    Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais

    2017-01-13

    An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.

  8. Hyperon resonances in SU(3) soliton models

    International Nuclear Information System (INIS)

    Scoccola, N.N.

    1990-01-01

    Hyperon resonances excited in kaon-nucleon scattering are investigated in the framework of an SU(3) soliton model in which kaon degrees of freedom are treated as small fluctuations around an SU(2) soliton. For partial waves l≥2 the model predicts correctly the quantum numbers and average excitation energies of most of the experimentally observed Λ and Σ resonances. Some disagreements are found for lower partial waves. (orig.)

  9. Dual processing model of medical decision-making

    OpenAIRE

    Djulbegovic, Benjamin; Hozo, Iztok; Beckstead, Jason; Tsalatsanis, Athanasios; Pauker, Stephen G

    2012-01-01

    Abstract Background Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I) and/or an analytical, deliberative (system II) processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administe...

  10. Establishment of animal model of dual liver transplantation in rat.

    Directory of Open Access Journals (Sweden)

    Ying Zhang

    Full Text Available The animal model of the whole-size and reduced-size liver transplantation in both rat and mouse has been successfully established. Because of the difficulties and complexities in microsurgical technology, the animal model of dual liver transplantation was still not established for twelve years since the first human dual liver transplantation has been made a success. There is an essential need to establish this animal model to lay a basic foundation for clinical practice. To study the physiological and histopathological changes of dual liver transplantation, "Y" type vein from the cross part between vena cava and two iliac of donor and "Y' type prosthesis were employed to recanalize portal vein and the bile duct between dual liver grafts and recipient. The dual right upper lobes about 45-50% of the recipient liver volume were taken as donor, one was orthotopically implanted at its original position, the other was rotated 180° sagitally and heterotopically positioned in the left upper quadrant. Microcirculation parameters, liver function, immunohistochemistry and survival were analyzed to evaluate the function of dual liver grafts. No significant difference in the hepatic microcirculatory flow was found between two grafts in the first 90 minutes after reperfusion. Light and electronic microscope showed the liver architecture was maintained without obvious features of cellular destruction and the continuity of the endothelium was preserved. Only 3 heterotopically positioned graft appeared patchy desquamation of endothelial cell, mitochondrial swelling and hepatocytes cytoplasmic vacuolization. Immunohistochemistry revealed there is no difference in hepatocyte activity and the ability of endothelia to contract and relax after reperfusion between dual grafts. Dual grafts made a rapid amelioration of liver function after reperfusion. 7 rats survived more than 7 days with survival rate of 58.3.%. Using "Y" type vein and bile duct prosthesis, we

  11. Dynamic Breast Magnetic Resonance Imaging without Complications in a Patient with Dual-Chamber Demand Pacemaker

    International Nuclear Information System (INIS)

    Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M.

    2006-01-01

    Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma

  12. Dynamic Breast Magnetic Resonance Imaging without Complications in a Patient with Dual-Chamber Demand Pacemaker

    Energy Technology Data Exchange (ETDEWEB)

    Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M. [Policlinico San Donato, San Donato Milanese, Milan (Italy). Depts. of Radiology, Arrhythmia and Electrophysiology Center

    2006-02-15

    Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma.

  13. Integrated nanohole array surface plasmon resonance sensing device using a dual-wavelength source

    International Nuclear Information System (INIS)

    Escobedo, C; Vincent, S; Choudhury, A I K; Campbell, J; Gordon, R; Brolo, A G; Sinton, D

    2011-01-01

    In this paper, we demonstrate a compact integrated nanohole array-based surface plasmon resonance sensing device. The unit includes a LED light source, driving circuitry, CCD detector, microfluidic network and computer interface, all assembled from readily available commercial components. A dual-wavelength LED scheme was implemented to increase spectral diversity and isolate intensity variations to be expected in the field. The prototype shows bulk sensitivity of 266 pixel intensity units/RIU and a limit of detection of 6 × 10 −4 RIU. Surface binding tests were performed, demonstrating functionality as a surface-based sensing system. This work is particularly relevant for low-cost point-of-care applications, especially those involving multiple tests and field studies. While nanohole arrays have been applied to many sensing applications, and their suitability to device integration is well established, this is the first demonstration of a fully integrated nanohole array-based sensing device.

  14. Superoperators in the dual model with coloured quarks

    International Nuclear Information System (INIS)

    Manida, S.N.

    1978-01-01

    The derivation of the dual model with coloured quarks is considered. The model is represented as a superoperator generalization of the Bardakci-Halpern model. It is shown that the three-regeon vertex of the model appears to be more compact and transparent

  15. [The dual process model of addiction. Towards an integrated model?].

    Science.gov (United States)

    Vandermeeren, R; Hebbrecht, M

    2012-01-01

    Neurobiology and cognitive psychology have provided us with a dual process model of addiction. According to this model, behavior is considered to be the dynamic result of a combination of automatic and controlling processes. In cases of addiction the balance between these two processes is severely disturbed. Automated processes will continue to produce impulses that ensure the continuance of addictive behavior. Weak, reflective or controlling processes are both the reason for and the result of the inability to forgo addiction. To identify features that are common to current neurocognitive insights into addiction and psychodynamic views on addiction. The picture that emerges from research is not clear. There is some evidence that attentional bias has a causal effect on addiction. There is no evidence that automatic associations have a causal effect, but there is some evidence that automatic action-tendencies do have a causal effect. Current neurocognitive views on the dual process model of addiction can be integrated with an evidence-based approach to addiction and with psychodynamic views on addiction.

  16. A Low-Cost and Portable Dual-Channel Fiber Optic Surface Plasmon Resonance System.

    Science.gov (United States)

    Liu, Qiang; Liu, Yun; Chen, Shimeng; Wang, Fang; Peng, Wei

    2017-12-04

    A miniaturization and integration dual-channel fiber optic surface plasmon resonance (SPR) system was proposed and demonstrated in this paper. We used a yellow light-emitting diode (LED, peak wavelength 595 nm) and built-in web camera as a light source and detector, respectively. Except for the detection channel, one of the sensors was used as a reference channel to compensate nonspecific binding and physical absorption. We packaged the LED and surface plasmon resonance (SPR) sensors together, which are flexible enough to be applied to mobile devices as a compact and portable system. Experimental results show that the normalized intensity shift and refractive index (RI) of the sample have a good linear relationship in the RI range from 1.328 to 1.348. We used this sensor to monitor the reversible, specific interaction between lectin concanavalin A (Con A) and glycoprotein ribonuclease B (RNase B), which demonstrate its capabilities of specific identification and biochemical samples concentration detection. This sensor system has potential applications in various fields, such as medical diagnosis, public health, food safety, and environment monitoring.

  17. An extended dual search space model of scientific discovery learning

    NARCIS (Netherlands)

    van Joolingen, Wouter; de Jong, Anthonius J.M.

    1997-01-01

    This article describes a theory of scientific discovery learning which is an extension of Klahr and Dunbar''s model of Scientific Discovery as Dual Search (SDDS) model. We present a model capable of describing and understanding scientific discovery learning in complex domains in terms of the SDDS

  18. A dynamic dual process model of risky decision making.

    Science.gov (United States)

    Diederich, Adele; Trueblood, Jennifer S

    2018-03-01

    Many phenomena in judgment and decision making are often attributed to the interaction of 2 systems of reasoning. Although these so-called dual process theories can explain many types of behavior, they are rarely formalized as mathematical or computational models. Rather, dual process models are typically verbal theories, which are difficult to conclusively evaluate or test. In the cases in which formal (i.e., mathematical) dual process models have been proposed, they have not been quantitatively fit to experimental data and are often silent when it comes to the timing of the 2 systems. In the current article, we present a dynamic dual process model framework of risky decision making that provides an account of the timing and interaction of the 2 systems and can explain both choice and response-time data. We outline several predictions of the model, including how changes in the timing of the 2 systems as well as time pressure can influence behavior. The framework also allows us to explore different assumptions about how preferences are constructed by the 2 systems as well as the dynamic interaction of the 2 systems. In particular, we examine 3 different possible functional forms of the 2 systems and 2 possible ways the systems can interact (simultaneously or serially). We compare these dual process models with 2 single process models using risky decision making data from Guo, Trueblood, and Diederich (2017). Using this data, we find that 1 of the dual process models significantly outperforms the other models in accounting for both choices and response times. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  19. Stochastic resonance in models of neuronal ensembles

    International Nuclear Information System (INIS)

    Chialvo, D.R.; Longtin, A.; Mueller-Gerkin, J.

    1997-01-01

    Two recently suggested mechanisms for the neuronal encoding of sensory information involving the effect of stochastic resonance with aperiodic time-varying inputs are considered. It is shown, using theoretical arguments and numerical simulations, that the nonmonotonic behavior with increasing noise of the correlation measures used for the so-called aperiodic stochastic resonance (ASR) scenario does not rely on the cooperative effect typical of stochastic resonance in bistable and excitable systems. Rather, ASR with slowly varying signals is more properly interpreted as linearization by noise. Consequently, the broadening of the open-quotes resonance curveclose quotes in the multineuron stochastic resonance without tuning scenario can also be explained by this linearization. Computation of the input-output correlation as a function of both signal frequency and noise for the model system further reveals conditions where noise-induced firing with aperiodic inputs will benefit from stochastic resonance rather than linearization by noise. Thus, our study clarifies the tuning requirements for the optimal transduction of subthreshold aperiodic signals. It also shows that a single deterministic neuron can perform as well as a network when biased into a suprathreshold regime. Finally, we show that the inclusion of a refractory period in the spike-detection scheme produces a better correlation between instantaneous firing rate and input signal. copyright 1997 The American Physical Society

  20. High-temperature superconducting coplanar-waveguide quarter-wavelength resonator with odd- and even-mode resonant frequencies for dual-band bandpass filter

    Energy Technology Data Exchange (ETDEWEB)

    Satoh, Kei; Takagi, Yuta; Narahashi, Shoichi [Research Laboratories, NTT DOCOMO, INC., 3-6 Hikari-no-oka Yokosuka, Kanagawa 239-8536 Japan (Japan); Nojima, Toshio, E-mail: satokei@nttdocomo.co.j [Graduate School of Information Science and Technology, Hokkaido University, Kita 14, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-0814 Japan (Japan)

    2010-06-01

    This paper presents a high-temperature superconducting coplanar-waveguide quarter-wavelength resonator that has two different resonant modes for use in a dual-band bandpass filter (DBPF). An RF filter with multiple passbands such as the DBPF is a basic element that is expected to achieve broadband transmission by using separated frequency bands aggregately and simultaneously in future mobile communication systems. The proposed resonator has a folded center conductor and two open stubs that are aligned close to it. The odd- and even-mode resonant frequencies are configured using the space between the folded center conductor and the open stubs. It is easy to configure the odd- and even-mode coupling coefficients independently because the two resonant modes have different current density distributions. Consequently, a DBPF with two different bandwidths can be easily designed. This paper presents three design examples for a four-pole Chebyshev DBPF with different combinations of fractional bandwidths in order to investigate the validity of the proposed resonator. This paper also presents measured results of the DBPF based on the design examples from the standpoint of experimental investigation. The designed and measured frequency responses confirm that the proposed resonator is effective in achieving DBPFs not only with two of the same bandwidths but also with two different bandwidths.

  1. Slow light based on plasmon-induced transparency in dual-ring resonator-coupled MDM waveguide system

    International Nuclear Information System (INIS)

    Zhan, Shiping; Li, Hongjian; He, Zhihui; Li, Boxun; Yang, Hui; Cao, Guangtao

    2014-01-01

    We report a theoretical and numerical investigation of the plasmon-induced transparency (PIT) effect in a dual-ring resonator-coupled metal–dielectric–metal waveguide system. A transfer matrix method (TMM) is introduced to analyse the transmission and dispersion properties in the transparency window. A tunable PIT is realized in a constant separation design. The phase dispersion and slow-light effect are discussed in both the resonance and non-resonance conditions. Finally, a propagation constant based on the TMM is derived for the periodic system. It is found that the group index in the transparency window of the proposed structure can be easily tuned by the period p, which provides a new understanding, and a group index ∼51 is achieved. The quality factor of resonators can also be effective in adjusting the dispersion relation. These observations could be helpful to fundamental research and applications for integrated plasmonic devices. (paper)

  2. Dual-mode ferromagnetic resonance in an FeCoB/Ru/FeCoB synthetic antiferromagnet with uniaxial anisotropy

    Science.gov (United States)

    Wang, Cuiling; Zhang, Shouheng; Qiao, Shizhu; Du, Honglei; Liu, Xiaomin; Sun, Ruicong; Chu, Xian-Ming; Miao, Guo-Xing; Dai, Youyong; Kang, Shishou; Yan, Shishen; Li, Shandong

    2018-05-01

    Dual-mode ferromagnetic resonance is observed in FeCoB/Ru/FeCoB trilayer synthetic antiferromagnets with uniaxial in-plane magnetic anisotropy. The optical mode is present in the (0-108 Oe) magnetic field range, where the top and bottom layer magnetizations are aligned in opposite directions. The strong acoustic mode appears, when the magnetic field exceeds the 300 Oe value, which corresponds to the flop transition in the trilayer. Magnetic field and angular dependences of resonant frequencies are studied for both optical (low-field) and acoustic (high field) modes. The low-field mode is found to be anisotropic but insensitive to the magnetic field value. In contrast, the high field mode is quasi-isotropic, but its resonant frequency is tunable by the value of the magnetic field. The coexistence of two modes of ferromagnetic resonance as well as switching between them with the increase in the magnetic field originates from the difference in the sign of interlayer coupling energy at the parallel and antiparallel configurations of the synthetic antiferromagnet. The dual-mode resonance in the studied trilayer structures provides greater flexibility in the design and functionalization of micro-inductors in monolithic microwave integrated circuits.

  3. A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications

    DEFF Research Database (Denmark)

    Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng

    2017-01-01

    This paper proposes a dual-bridge (DB) LLC resonant converter for wide input applications. The topology is an integration of a half-bridge (HB) LLC circuit and a full-bridge (FB) LLC circuit. The fixed-frequency PWM control is employed and a range of twice the minimum input voltage can be covered....... Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...

  4. Real-time biodetection using a smartphone-based dual-color surface plasmon resonance sensor

    Science.gov (United States)

    Liu, Qiang; Yuan, Huizhen; Liu, Yun; Wang, Jiabin; Jing, Zhenguo; Peng, Wei

    2018-04-01

    We proposed a compact and cost-effective red-green dual-color fiber optic surface plasmon resonance (SPR) sensor based on the smartphone. Inherent color selectivity of phone cameras was utilized for real-time monitoring of red and green color channels simultaneously, which can reduce the chance of false detection and improve the sensitivity. Because there are no external prisms, complex optical lenses, or diffraction grating, simple optical configuration is realized. It has a linear response in a refractive index range of 1.326 to 1.351 (R2 = 0.991) with a resolution of 2.3 × 10 - 4 RIU. We apply it for immunoglobulin G (IgG) concentration measurement. Experimental results demonstrate that a linear SPR response was achieved for IgG concentrations varying from 0.02 to 0.30 mg / ml with good repeatability. It may find promising applications in the fields of public health and environment monitoring owing to its simple optics design and applicability in real-time, label-free biodetection.

  5. Dual peripheral model up to Serpukhov energies

    CERN Document Server

    Schrempp, Barbara

    1974-01-01

    The high energy behaviour of the s-channel Regge residues is inferred from three plausible requirements. The resulting s-channel helicity amplitudes allow-in a dual sense-the following t-channel interpretation: for -t>or=0.25 GeV/sup 2/ the flip amplitude has the form of a t-channel Regge pole, while the non-flip amplitude looks like a Regge cut. Finally, a quantitative comparison of the predictions with the data available for the set of SU(3) related processes pi N CEX, KN, KN CEX and pi /sup -/p to eta n is performed, covering the energy range 2

  6. A dual model approach to ground water recovery trench design

    International Nuclear Information System (INIS)

    Clodfelter, C.L.; Crouch, M.S.

    1992-01-01

    The design of trenches for contaminated ground water recovery must consider several variables. This paper presents a dual-model approach for effectively recovering contaminated ground water migrating toward a trench by advection. The approach involves an analytical model to determine the vertical influence of the trench and a numerical flow model to determine the capture zone within the trench and the surrounding aquifer. The analytical model is utilized by varying trench dimensions and head values to design a trench which meets the remediation criteria. The numerical flow model is utilized to select the type of backfill and location of sumps within the trench. The dual-model approach can be used to design a recovery trench which effectively captures advective migration of contaminants in the vertical and horizontal planes

  7. White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 2: Radiation Dose and Iodine Sensitivity.

    Science.gov (United States)

    Foley, W Dennis; Shuman, William P; Siegel, Marilyn J; Sahani, Dushyant V; Boll, Daniel T; Bolus, David N; De Cecco, Carlo N; Kaza, Ravi K; Morgan, Desiree E; Schoepf, U Joseph; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

    This is the second of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography. This paper, part 2, addresses radiation dose and iodine sensitivity in dual-energy computed tomography.

  8. 3D modeling of dual wind-up extensional rheometers

    DEFF Research Database (Denmark)

    Yu, Kaijia; Román Marín, José Manuel; Rasmussen, Henrik K.

    2010-01-01

    Fully three-dimensional numerical simulations of a dual wind-up drum rheometer of the Sentmanat Extensional Rheometer (SER; Sentmanat, 2004 [1]) or the Extensional Viscosity Fixture (EVF; Garritano and Berting, 2006 [2]) type have been performed. In the SER and EVF a strip of rectangular shape...... is attached onto two drums, followed by a rotation of both drums in opposite direction. The numerical modeling is based on integral constitutive equations of the K-BKZ type. Generally, to ensure a proper uni-axial extensional deformation in dual wind-up drum rheometers the simulations show that a very small...

  9. Accelerating the reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning using CUDA.

    Science.gov (United States)

    Jiansen Li; Jianqi Sun; Ying Song; Yanran Xu; Jun Zhao

    2014-01-01

    An effective way to improve the data acquisition speed of magnetic resonance imaging (MRI) is using under-sampled k-space data, and dictionary learning method can be used to maintain the reconstruction quality. Three-dimensional dictionary trains the atoms in dictionary in the form of blocks, which can utilize the spatial correlation among slices. Dual-dictionary learning method includes a low-resolution dictionary and a high-resolution dictionary, for sparse coding and image updating respectively. However, the amount of data is huge for three-dimensional reconstruction, especially when the number of slices is large. Thus, the procedure is time-consuming. In this paper, we first utilize the NVIDIA Corporation's compute unified device architecture (CUDA) programming model to design the parallel algorithms on graphics processing unit (GPU) to accelerate the reconstruction procedure. The main optimizations operate in the dictionary learning algorithm and the image updating part, such as the orthogonal matching pursuit (OMP) algorithm and the k-singular value decomposition (K-SVD) algorithm. Then we develop another version of CUDA code with algorithmic optimization. Experimental results show that more than 324 times of speedup is achieved compared with the CPU-only codes when the number of MRI slices is 24.

  10. International Family Migration and the Dual-Earner Model

    DEFF Research Database (Denmark)

    Munk, Martin D.; Nikolka, Till; Poutvaara, Panu

    2018-01-01

    Gender differences in labor force participation are exceptionally small in Nordic countries. We investigate how couples emigrating from Denmark self-select and sort into different destinations and whether couples pursue the dual-earner model, in which both partners work, when abroad. Female labor...

  11. Scale-invariant inclusive spectra in a dual model

    International Nuclear Information System (INIS)

    Chikovani, Z.E.; Jenkovsky, L.L.; Martynov, E.S.

    1979-01-01

    One-particle inclusive distributions at large transverse momentum phisub(tr) are shown to scale, Edσ/d 3 phi approximately phisub(tr)sup(-N)(1-Xsub(tr))sup(1+N/2)lnphisub(tr), in a dual model with Mandelstam analyticity if the Regge trajectories are logarithmic asymptotically

  12. Functional Dual Adaptive Control with Recursive Gaussian Process Model

    International Nuclear Information System (INIS)

    Prüher, Jakub; Král, Ladislav

    2015-01-01

    The paper deals with dual adaptive control problem, where the functional uncertainties in the system description are modelled by a non-parametric Gaussian process regression model. Current approaches to adaptive control based on Gaussian process models are severely limited in their practical applicability, because the model is re-adjusted using all the currently available data, which keeps growing with every time step. We propose the use of recursive Gaussian process regression algorithm for significant reduction in computational requirements, thus bringing the Gaussian process-based adaptive controllers closer to their practical applicability. In this work, we design a bi-criterial dual controller based on recursive Gaussian process model for discrete-time stochastic dynamic systems given in an affine-in-control form. Using Monte Carlo simulations, we show that the proposed controller achieves comparable performance with the full Gaussian process-based controller in terms of control quality while keeping the computational demands bounded. (paper)

  13. A dual-trace model for visual sensory memory.

    Science.gov (United States)

    Cappiello, Marcus; Zhang, Weiwei

    2016-11-01

    Visual sensory memory refers to a transient memory lingering briefly after the stimulus offset. Although previous literature suggests that visual sensory memory is supported by a fine-grained trace for continuous representation and a coarse-grained trace of categorical information, simultaneous separation and assessment of these traces can be difficult without a quantitative model. The present study used a continuous estimation procedure to test a novel mathematical model of the dual-trace hypothesis of visual sensory memory according to which visual sensory memory could be modeled as a mixture of 2 von Mises (2VM) distributions differing in standard deviation. When visual sensory memory and working memory (WM) for colors were distinguished using different experimental manipulations in the first 3 experiments, the 2VM model outperformed Zhang and Luck (2008) standard mixture model (SM) representing a mixture of a single memory trace and random guesses, even though SM outperformed 2VM for WM. Experiment 4 generalized 2VM's advantages of fitting visual sensory memory data over SM from color to orientation. Furthermore, a single trace model and 4 other alternative models were ruled out, suggesting the necessity and sufficiency of dual traces for visual sensory memory. Together these results support the dual-trace model of visual sensory memory and provide a preliminary inquiry into the nature of information loss from visual sensory memory to WM. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  14. The sympletic model for giant monopole resonances

    International Nuclear Information System (INIS)

    Oliveira, M.M.B.M.

    1985-01-01

    Following recently published articles, it's investigated how to apply the sympletic model to the study of giant monopole resonances in spherical nuclei. The results obtained agree with those already published for monopole mode energies, wave functions, radii and nuclear incompressibility of 16 O and 40 Ca nuclei. An analyse of how the spurious center-of-mass motion influence resonance energies is made. The sum rules of the monopole operator, m-bar e , o ≤ e ≤ 3, are calculated, demonstrating at first that they are conserved in the sympletic model. Then it's studied, for those sum rules, the importance of n-boson correlations in the fundamental state, which is an extension of those sum rules, of the analysis for the nuclear incompressibility, performed in above mentioned articles. (Author) [pt

  15. Predicting sugar consumption: Application of an integrated dual-process, dual-phase model.

    Science.gov (United States)

    Hagger, Martin S; Trost, Nadine; Keech, Jacob J; Chan, Derwin K C; Hamilton, Kyra

    2017-09-01

    Excess consumption of added dietary sugars is related to multiple metabolic problems and adverse health conditions. Identifying the modifiable social cognitive and motivational constructs that predict sugar consumption is important to inform behavioral interventions aimed at reducing sugar intake. We tested the efficacy of an integrated dual-process, dual-phase model derived from multiple theories to predict sugar consumption. Using a prospective design, university students (N = 90) completed initial measures of the reflective (autonomous and controlled motivation, intentions, attitudes, subjective norm, perceived behavioral control), impulsive (implicit attitudes), volitional (action and coping planning), and behavioral (past sugar consumption) components of the proposed model. Self-reported sugar consumption was measured two weeks later. A structural equation model revealed that intentions, implicit attitudes, and, indirectly, autonomous motivation to reduce sugar consumption had small, significant effects on sugar consumption. Attitudes, subjective norm, and, indirectly, autonomous motivation to reduce sugar consumption predicted intentions. There were no effects of the planning constructs. Model effects were independent of the effects of past sugar consumption. The model identified the relative contribution of reflective and impulsive components in predicting sugar consumption. Given the prominent role of the impulsive component, interventions that assist individuals in managing cues-to-action and behavioral monitoring are likely to be effective in regulating sugar consumption. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Finiteness of PST self-dual models

    International Nuclear Information System (INIS)

    Del Cima, Oswaldo M.; Piguet, Olivier; Sarandy, Marcelo S.

    2000-12-01

    The Pasti-Sorokin-Tonin model for describing chiral forms is considered at the quantum level. We study the ultraviolet and infrared behaviour of the model in two, four and six dimensions in the framework of algebraic renormalization. The absence of anomalies, as well as the finiteness, up to non-physical renormalizations, are shown in all dimensions analyzed. (author)

  17. Dual Value Creation and Business Model Design

    DEFF Research Database (Denmark)

    Turcan, Romeo V.

    This ethnographic research explores the process of business model design in the context of an NGO internationalizing to an emerging market. It contributes to the business model literature by investigating how this NGO - targeting multiple key stakeholders - was experimenting (1) with value...

  18. A Low-Profile Dual-Layer Patch Antenna with a Circular Polarizer Consisting of Dual Semicircular Resonators

    Directory of Open Access Journals (Sweden)

    Li Guo

    2018-06-01

    Full Text Available In this paper, a circular polarizer comprising dual semicircular split-rings (DSSRs is presented. By placing it above an elliptical radiator that radiates linearly polarized (LP waves, dual-layer patch antennas capable of radiating right-hand (RH or left-hand (LH circularly polarized (CP waves are achieved in terms of the different offset direction of the bottom splits of the DSSRs. Because of both the capacitive coupling to the radiator and the degenerate modes existing in the excited DSSRs, the DSSRs collaboratively result in a circularly polarized radiation, successfully converting incident LP waves into CP ones. Simulated results show that the impedance, axial ratio (AR, and gain frequency response of both proposed CP antennas are identical, with a simulated 3-dB AR bandwidth of 72 MHz covering 2.402–2.474 GHz and a gain enhanced by 3.9 dB. The proposed antennas were fabricated and measured, revealing an operational bandwidth of 65 MHz (2.345–2.41 GHz and a peak gain up to 9 dBi. Moreover, a low profile of 0.063λ0 is maintained. The proposed CP antennas could be as a candidate for wireless target detection applications in terms of their identical frequency response property.

  19. Comparing single- and dual-process models of memory development.

    Science.gov (United States)

    Hayes, Brett K; Dunn, John C; Joubert, Amy; Taylor, Robert

    2017-11-01

    This experiment examined single-process and dual-process accounts of the development of visual recognition memory. The participants, 6-7-year-olds, 9-10-year-olds and adults, were presented with a list of pictures which they encoded under shallow or deep conditions. They then made recognition and confidence judgments about a list containing old and new items. We replicated the main trends reported by Ghetti and Angelini () in that recognition hit rates increased from 6 to 9 years of age, with larger age changes following deep than shallow encoding. Formal versions of the dual-process high threshold signal detection model and several single-process models (equal variance signal detection, unequal variance signal detection, mixture signal detection) were fit to the developmental data. The unequal variance and mixture signal detection models gave a better account of the data than either of the other models. A state-trace analysis found evidence for only one underlying memory process across the age range tested. These results suggest that single-process memory models based on memory strength are a viable alternative to dual-process models for explaining memory development. © 2016 John Wiley & Sons Ltd.

  20. Development of a universal dual-bolus injection scheme for the quantitative assessment of myocardial perfusion cardiovascular magnetic resonance

    Directory of Open Access Journals (Sweden)

    Alfakih Khaled

    2011-05-01

    Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined

  1. Implementation and Investigation of a Compact Circular Wide Slot UWB Antenna with Dual Notched Band Characteristics using Stepped Impedance Resonators

    Directory of Open Access Journals (Sweden)

    Yingsong Li

    2012-04-01

    Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.

  2. HTS dual-band bandpass filters using stub-loaded hair-pin resonators for mobile communication systems

    Energy Technology Data Exchange (ETDEWEB)

    Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.

    2014-09-15

    Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.

  3. High effective inverse dynamics modelling for dual-arm robot

    Science.gov (United States)

    Shen, Haoyu; Liu, Yanli; Wu, Hongtao

    2018-05-01

    To deal with the problem of inverse dynamics modelling for dual arm robot, a recursive inverse dynamics modelling method based on decoupled natural orthogonal complement is presented. In this model, the concepts and methods of Decoupled Natural Orthogonal Complement matrices are used to eliminate the constraint forces in the Newton-Euler kinematic equations, and the screws is used to express the kinematic and dynamics variables. On this basis, the paper has developed a special simulation program with symbol software of Mathematica and conducted a simulation research on the a dual-arm robot. Simulation results show that the proposed method based on decoupled natural orthogonal complement can save an enormous amount of CPU time that was spent in computing compared with the recursive Newton-Euler kinematic equations and the results is correct and reasonable, which can verify the reliability and efficiency of the method.

  4. A dual porosity model of nutrient uptake by root hairs

    KAUST Repository

    Zygalakis, K. C.; Kirk, G. J. D.; Jones, D. L.; Wissuwa, M.; Roose, T.

    2011-01-01

    Summary: • The importance of root hairs in the uptake of sparingly soluble nutrients is understood qualitatively, but not quantitatively, and this limits efforts to breed plants tolerant of nutrient-deficient soils. • Here, we develop a mathematical model of nutrient uptake by root hairs allowing for hair geometry and the details of nutrient transport through soil, including diffusion within and between soil particles. We give illustrative results for phosphate uptake. • Compared with conventional 'single porosity' models, this 'dual porosity' model predicts greater root uptake because more nutrient is available by slow release from within soil particles. Also the effect of soil moisture is less important with the dual porosity model because the effective volume available for diffusion in the soil is larger, and the predicted effects of hair length and density are different. • Consistent with experimental observations, with the dual porosity model, increases in hair length give greater increases in uptake than increases in hair density per unit main root length. The effect of hair density is less in dry soil because the minimum concentration in solution for net influx is reached more rapidly. The effect of hair length is much less sensitive to soil moisture. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  5. A dual porosity model of nutrient uptake by root hairs

    KAUST Repository

    Zygalakis, K. C.

    2011-08-09

    Summary: • The importance of root hairs in the uptake of sparingly soluble nutrients is understood qualitatively, but not quantitatively, and this limits efforts to breed plants tolerant of nutrient-deficient soils. • Here, we develop a mathematical model of nutrient uptake by root hairs allowing for hair geometry and the details of nutrient transport through soil, including diffusion within and between soil particles. We give illustrative results for phosphate uptake. • Compared with conventional \\'single porosity\\' models, this \\'dual porosity\\' model predicts greater root uptake because more nutrient is available by slow release from within soil particles. Also the effect of soil moisture is less important with the dual porosity model because the effective volume available for diffusion in the soil is larger, and the predicted effects of hair length and density are different. • Consistent with experimental observations, with the dual porosity model, increases in hair length give greater increases in uptake than increases in hair density per unit main root length. The effect of hair density is less in dry soil because the minimum concentration in solution for net influx is reached more rapidly. The effect of hair length is much less sensitive to soil moisture. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  6. Adler zero and the dual multiperipheral model

    International Nuclear Information System (INIS)

    Balazs, L.A.P.

    1978-01-01

    We show that the ππ → ππ Adler PCAC (partial conservation of axial-vector current) condition requires a Reggeon intercept α (0) approx. = 0.5 within a broad class of multiperipheral models at the planar and cylinder levels. In the planar approximation this is closely related to the cancellation of the Reggeon-Reggeon cut

  7. Model tracking dual stochastic controller design under irregular internal noises

    International Nuclear Information System (INIS)

    Lee, Jong Bok; Heo, Hoon; Cho, Yun Hyun; Ji, Tae Young

    2006-01-01

    Although many methods about the control of irregular external noise have been introduced and implemented, it is still necessary to design a controller that will be more effective and efficient methods to exclude for various noises. Accumulation of errors due to model tracking, internal noises (thermal noise, shot noise and l/f noise) that come from elements such as resistor, diode and transistor etc. in the circuit system and numerical errors due to digital process often destabilize the system and reduce the system performance. New stochastic controller is adopted to remove those noises using conventional controller simultaneously. Design method of a model tracking dual controller is proposed to improve the stability of system while removing external and internal noises. In the study, design process of the model tracking dual stochastic controller is introduced that improves system performance and guarantees robustness under irregular internal noises which can be created internally. The model tracking dual stochastic controller utilizing F-P-K stochastic control technique developed earlier is implemented to reveal its performance via simulation

  8. Enhanced optical transmission through a star-shaped bull's eye at dual resonant-bands in UV and the visible spectral range.

    Science.gov (United States)

    Nazari, Tavakol; Khazaeinezhad, Reza; Jung, Woohyun; Joo, Boram; Kong, Byung-Joo; Oh, Kyunghwan

    2015-07-13

    Dual resonant bands in UV and the visible range were simultaneously observed in the enhanced optical transmission (EOT) through star-shaped plasmonic structures. EOTs through four types of polygonal bull's eyes with a star aperture surrounded by the concentric star grooves were analyzed and compared for 3, 4, 5, and 6 corners, using finite difference time domain (FDTD) method. In contrast to plasmonic resonances in the visible range, the UV-band resonance intensity was found to scale with the number of corners, which is related with higher order multipole interactions. Spectral positions and relative intensities of the dual resonances were analyzed parametrically to find optimal conditions to maximize EOT in UV-visible dual bands.

  9. A dual system model of preferences under risk.

    Science.gov (United States)

    Mukherjee, Kanchan

    2010-01-01

    This article presents a dual system model (DSM) of decision making under risk and uncertainty according to which the value of a gamble is a combination of the values assigned to it independently by the affective and deliberative systems. On the basis of research on dual process theories and empirical research in Hsee and Rottenstreich (2004) and Rottenstreich and Hsee (2001) among others, the DSM incorporates (a) individual differences in disposition to rational versus emotional decision making, (b) the affective nature of outcomes, and (c) different task construals within its framework. The model has good descriptive validity and accounts for (a) violation of nontransparent stochastic dominance, (b) fourfold pattern of risk attitudes, (c) ambiguity aversion, (d) common consequence effect, (e) common ratio effect, (f) isolation effect, and (g) coalescing and event-splitting effects. The DSM is also used to make several novel predictions of conditions under which specific behavior patterns may or may not occur.

  10. Charm production in the dual topological unitarization model

    International Nuclear Information System (INIS)

    Batunin, A.V.

    1986-01-01

    The open and hidden charm hadroproduction has been traced up to the SPS energies in the framework of the dual parton model. The free parameter (the suppression of the charmed sea) comes from the experiments on D-meson hadroproduction. Then the hidden-charm production data are described assuming that the J/ψ-meson production suggests only one cc-bar pair in the string, while the pair ψψ production suggests two cc-bar pairs

  11. An AdS3 dual for minimal model CFTs

    International Nuclear Information System (INIS)

    Gaberdiel, Matthias R.; Gopakumar, Rajesh

    2011-01-01

    We propose a duality between the 2d W N minimal models in the large N't Hooft limit, and a family of higher spin theories on AdS 3 . The 2d conformal field theories (CFTs) can be described as Wess-Zumino-Witten coset models, and include, for N=2, the usual Virasoro unitary series. The dual bulk theory contains, in addition to the massless higher spin fields, two complex scalars (of equal mass). The mass is directly related to the 't Hooft coupling constant of the dual CFT. We give convincing evidence that the spectra of the two theories match precisely for all values of the 't Hooft coupling. We also show that the renormalization group flows in the 2d CFT agree exactly with the usual AdS/CFT prediction of the gravity theory. Our proposal is in many ways analogous to the Klebanov-Polyakov conjecture for an AdS 4 dual for the singlet sector of large N vector models.

  12. Modeling and analysis of a resonant nanosystem

    Science.gov (United States)

    Calvert, Scott L.

    The majority of investigations into nanoelectromechanical resonators focus on a single area of the resonator's function. This focus varies from the development of a model for a beam's vibration, to the modeling of electrostatic forces, to a qualitative explanation of experimentally-obtained currents. Despite these efforts, there remains a gap between these works, and the level of sophistication needed to truly design nanoresonant systems for efficient commercial use. Towards this end, a comprehensive system model for both a nanobeam resonator and its related experimental setup is proposed. Furthermore, a simulation arrangement is suggested as a method for facilitating the study of the system-level behavior of these devices in a variety of cases that could not be easily obtained experimentally or analytically. The dynamics driving the nanoresonator's motion, as well as the electrical interactions influencing the forcing and output of the system, are modeled, experimentally validated, and studied. The model seeks to develop both a simple circuit representation of the nanoresonator, and to create a mathematical system that can be used to predict and interpret the observed behavior. Due to the assumptions used to simplify the model to a point of reasonable comprehension, the model is most accurate for small beam deflections near the first eigenmode of the beam. The process and results of an experimental investigation are documented, and compared with a circuit simulation modeling the full test system. The comparison qualitatively proves the functionality of the model, while a numerical analysis serves to validate the functionality and setup of the circuit simulation. The use of the simulation enables a much broader investigation of both the electrical behavior and the physical device's dynamics. It is used to complement an assessment of the tuning behavior of the system's linear natural frequency by demonstrating the tuning behavior of the full nonlinear response. The

  13. Isoscalar giant resonances in a relativistic model

    International Nuclear Information System (INIS)

    L'Huillier, M.; Nguyen Van Giai.

    1988-07-01

    Isoscalar giant resonances in finite nuclei are studied in a relativistic Random Phase Approximation (RRPA) approach. The model is self-consistent in the sense that one set of coupling constants generates the Dirac-Hartree single-particle spectrum and the residual particle-hole interaction. The RRPA is used to calculate response functions of multipolarity L = 0,2,3, and 4 in light and medium nuclei. It is found that monopole and quadrupole modes exhibit a collective character. The peak energies are overestimated, but not as much as one might think if the bulk properties (compression modulus, effective mass) were the only relevant quantities

  14. Vector and tensor meson production in quasi-two-body final states using the dual fermion model

    International Nuclear Information System (INIS)

    Becker, L.; Matthaeus, E.; Weigt, G.

    1975-01-01

    Phenomenological dual fermion amplitudes are obtained by using the Neveu-Schwarz-Ramond model as a guide to incorporate half-integer spin. The model relates the production mechanism of different resonances lying on the same degenerated Regge trajectory, thus allowing a simultaneous description of vector and tensor meson production. A characteristic feature of the amplitudes is their non-evasive coupling structure. Predictions of the model for rho 0 - f - g 0 , ω - A 2 - and anti K-890 and anti K-1420 resonances production in quasi-two-body reactions are compared with experimental data. The differential cross sections for natural and unnatural spin-parity t-channel exchanges as well as their contributions to different helicities of the produced resonances are given. In particular, new properties arise from the non-evasive pion exchange. Reasonable agreement with the data is found. (author)

  15. Multiparticle production in a two-component dual parton model

    International Nuclear Information System (INIS)

    Aurenche, P.; Bopp, F.W.; Capella, A.; Kwiecinski, J.; Maire, M.; Ranft, J.; Tran Thanh Van, J.

    1992-01-01

    The dual parton model (DPM) describes soft and semihard multiparticle production. The version of the DPM presented in this paper includes soft and hard mechanisms as well as diffractive processes. The model is formulated as a Monte Carlo event generator. We calculate in this model, in the energy range of the hadron colliders, rapidity distributions and the rise of the rapidity plateau with the collision energy, transverse-momentum distributions and the rise of average transverse momenta with the collision energy, multiplicity distributions in different pseudorapidity regions, and transverse-energy distributions. For most of these quantities we find a reasonable agreement with experimental data

  16. Dual Contrast - Magnetic Resonance Fingerprinting (DC-MRF): A Platform for Simultaneous Quantification of Multiple MRI Contrast Agents.

    Science.gov (United States)

    Anderson, Christian E; Donnola, Shannon B; Jiang, Yun; Batesole, Joshua; Darrah, Rebecca; Drumm, Mitchell L; Brady-Kalnay, Susann M; Steinmetz, Nicole F; Yu, Xin; Griswold, Mark A; Flask, Chris A

    2017-08-16

    Injectable Magnetic Resonance Imaging (MRI) contrast agents have been widely used to provide critical assessments of disease for both clinical and basic science imaging research studies. The scope of available MRI contrast agents has expanded over the years with the emergence of molecular imaging contrast agents specifically targeted to biological markers. Unfortunately, synergistic application of more than a single molecular contrast agent has been limited by MRI's ability to only dynamically measure a single agent at a time. In this study, a new Dual Contrast - Magnetic Resonance Fingerprinting (DC - MRF) methodology is described that can detect and independently quantify the local concentration of multiple MRI contrast agents following simultaneous administration. This "multi-color" MRI methodology provides the opportunity to monitor multiple molecular species simultaneously and provides a practical, quantitative imaging framework for the eventual clinical translation of molecular imaging contrast agents.

  17. Dual coding: a cognitive model for psychoanalytic research.

    Science.gov (United States)

    Bucci, W

    1985-01-01

    Four theories of mental representation derived from current experimental work in cognitive psychology have been discussed in relation to psychoanalytic theory. These are: verbal mediation theory, in which language determines or mediates thought; perceptual dominance theory, in which imagistic structures are dominant; common code or propositional models, in which all information, perceptual or linguistic, is represented in an abstract, amodal code; and dual coding, in which nonverbal and verbal information are each encoded, in symbolic form, in separate systems specialized for such representation, and connected by a complex system of referential relations. The weight of current empirical evidence supports the dual code theory. However, psychoanalysis has implicitly accepted a mixed model-perceptual dominance theory applying to unconscious representation, and verbal mediation characterizing mature conscious waking thought. The characterization of psychoanalysis, by Schafer, Spence, and others, as a domain in which reality is constructed rather than discovered, reflects the application of this incomplete mixed model. The representations of experience in the patient's mind are seen as without structure of their own, needing to be organized by words, thus vulnerable to distortion or dissolution by the language of the analyst or the patient himself. In these terms, hypothesis testing becomes a meaningless pursuit; the propositions of the theory are no longer falsifiable; the analyst is always more or less "right." This paper suggests that the integrated dual code formulation provides a more coherent theoretical framework for psychoanalysis than the mixed model, with important implications for theory and technique. In terms of dual coding, the problem is not that the nonverbal representations are vulnerable to distortion by words, but that the words that pass back and forth between analyst and patient will not affect the nonverbal schemata at all. Using the dual code

  18. Two-point active microrheology in a viscous medium exploiting a motional resonance excited in dual-trap optical tweezers

    Science.gov (United States)

    Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan

    2018-04-01

    Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.

  19. Compact Microstrip Triple-Mode Bandpass Filters Using Dual-Stub-Loaded Spiral Resonators

    Directory of Open Access Journals (Sweden)

    K. D. Xu

    2017-04-01

    Full Text Available Two new microstrip triple-mode resonators loaded with T-shaped open stubs using axially and centrally symmetric spiral structures, respectively, are presented. Spiraled for circuit size reduction, these two half-wavelength resonators can both generate three resonant modes over a wide frequency band by loading two T-stubs with different lengths. Due to the structural symmetry, they can be analyzed by odd- and even-mode method. To validate the design concept, two compact bandpass filters (BPFs using these two novel resonators with center frequencies of 1.76 GHz and 2.44 GHz for the GSM1800 and WLAN/Zigbee applications, respectively, have been designed, fabricated and tested. The center frequencies and bandwidths can be tunable through the analysis of resonant frequency responses, fractional bandwidths and external quality factor versus the resonator parameters. The final measured results have achieved good consistence with the simulations of these two BPFs.

  20. 3D modeling of dual-gate FinFET.

    Science.gov (United States)

    Mil'shtein, Samson; Devarakonda, Lalitha; Zanchi, Brian; Palma, John

    2012-11-13

    The tendency to have better control of the flow of electrons in a channel of field-effect transistors (FETs) did lead to the design of two gates in junction field-effect transistors, field plates in a variety of metal semiconductor field-effect transistors and high electron mobility transistors, and finally a gate wrapping around three sides of a narrow fin-shaped channel in a FinFET. With the enhanced control, performance trends of all FETs are still challenged by carrier mobility dependence on the strengths of the electrical field along the channel. However, in cases when the ratio of FinFET volume to its surface dramatically decreases, one should carefully consider the surface boundary conditions of the device. Moreover, the inherent non-planar nature of a FinFET demands 3D modeling for accurate analysis of the device performance. Using the Silvaco modeling tool with quantization effects, we modeled a physical FinFET described in the work of Hisamoto et al. (IEEE Tran. Elec. Devices 47:12, 2000) in 3D. We compared it with a 2D model of the same device. We demonstrated that 3D modeling produces more accurate results. As 3D modeling results came close to experimental measurements, we made the next step of the study by designing a dual-gate FinFET biased at Vg1 >Vg2. It is shown that the dual-gate FinFET carries higher transconductance than the single-gate device.

  1. User Preference-Based Dual-Memory Neural Model With Memory Consolidation Approach.

    Science.gov (United States)

    Nasir, Jauwairia; Yoo, Yong-Ho; Kim, Deok-Hwa; Kim, Jong-Hwan; Nasir, Jauwairia; Yong-Ho Yoo; Deok-Hwa Kim; Jong-Hwan Kim; Nasir, Jauwairia; Yoo, Yong-Ho; Kim, Deok-Hwa; Kim, Jong-Hwan

    2018-06-01

    Memory modeling has been a popular topic of research for improving the performance of autonomous agents in cognition related problems. Apart from learning distinct experiences correctly, significant or recurring experiences are expected to be learned better and be retrieved easier. In order to achieve this objective, this paper proposes a user preference-based dual-memory adaptive resonance theory network model, which makes use of a user preference to encode memories with various strengths and to learn and forget at various rates. Over a period of time, memories undergo a consolidation-like process at a rate proportional to the user preference at the time of encoding and the frequency of recall of a particular memory. Consolidated memories are easier to recall and are more stable. This dual-memory neural model generates distinct episodic memories and a flexible semantic-like memory component. This leads to an enhanced retrieval mechanism of experiences through two routes. The simulation results are presented to evaluate the proposed memory model based on various kinds of cues over a number of trials. The experimental results on Mybot are also presented. The results verify that not only are distinct experiences learned correctly but also that experiences associated with higher user preference and recall frequency are consolidated earlier. Thus, these experiences are recalled more easily relative to the unconsolidated experiences.

  2. Dual processing model of medical decision-making

    Science.gov (United States)

    2012-01-01

    Background Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I) and/or an analytical, deliberative (system II) processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administered to the patient who may or may not have a disease. Methods We developed a mathematical model in which we linked a recently proposed descriptive psychological model of cognition with the threshold model of medical decision-making and show how this approach can be used to better understand decision-making at the bedside and explain the widespread variation in treatments observed in clinical practice. Results We show that physician’s beliefs about whether to treat at higher (lower) probability levels compared to the prescriptive therapeutic thresholds obtained via system II processing is moderated by system I and the ratio of benefit and harms as evaluated by both system I and II. Under some conditions, the system I decision maker’s threshold may dramatically drop below the expected utility threshold derived by system II. This can explain the overtreatment often seen in the contemporary practice. The opposite can also occur as in the situations where empirical evidence is considered unreliable, or when cognitive processes of decision-makers are biased through recent experience: the threshold will increase relative to the normative threshold value derived via system II using expected utility threshold. This inclination for the higher diagnostic certainty may, in turn, explain undertreatment that is also documented in the current medical practice. Conclusions We have developed the first dual processing model of medical decision-making that has potential to enrich the current medical

  3. Dual processing model of medical decision-making.

    Science.gov (United States)

    Djulbegovic, Benjamin; Hozo, Iztok; Beckstead, Jason; Tsalatsanis, Athanasios; Pauker, Stephen G

    2012-09-03

    Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I) and/or an analytical, deliberative (system II) processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administered to the patient who may or may not have a disease. We developed a mathematical model in which we linked a recently proposed descriptive psychological model of cognition with the threshold model of medical decision-making and show how this approach can be used to better understand decision-making at the bedside and explain the widespread variation in treatments observed in clinical practice. We show that physician's beliefs about whether to treat at higher (lower) probability levels compared to the prescriptive therapeutic thresholds obtained via system II processing is moderated by system I and the ratio of benefit and harms as evaluated by both system I and II. Under some conditions, the system I decision maker's threshold may dramatically drop below the expected utility threshold derived by system II. This can explain the overtreatment often seen in the contemporary practice. The opposite can also occur as in the situations where empirical evidence is considered unreliable, or when cognitive processes of decision-makers are biased through recent experience: the threshold will increase relative to the normative threshold value derived via system II using expected utility threshold. This inclination for the higher diagnostic certainty may, in turn, explain undertreatment that is also documented in the current medical practice. We have developed the first dual processing model of medical decision-making that has potential to enrich the current medical decision-making field, which is still to the

  4. Dual processing model of medical decision-making

    Directory of Open Access Journals (Sweden)

    Djulbegovic Benjamin

    2012-09-01

    Full Text Available Abstract Background Dual processing theory of human cognition postulates that reasoning and decision-making can be described as a function of both an intuitive, experiential, affective system (system I and/or an analytical, deliberative (system II processing system. To date no formal descriptive model of medical decision-making based on dual processing theory has been developed. Here we postulate such a model and apply it to a common clinical situation: whether treatment should be administered to the patient who may or may not have a disease. Methods We developed a mathematical model in which we linked a recently proposed descriptive psychological model of cognition with the threshold model of medical decision-making and show how this approach can be used to better understand decision-making at the bedside and explain the widespread variation in treatments observed in clinical practice. Results We show that physician’s beliefs about whether to treat at higher (lower probability levels compared to the prescriptive therapeutic thresholds obtained via system II processing is moderated by system I and the ratio of benefit and harms as evaluated by both system I and II. Under some conditions, the system I decision maker’s threshold may dramatically drop below the expected utility threshold derived by system II. This can explain the overtreatment often seen in the contemporary practice. The opposite can also occur as in the situations where empirical evidence is considered unreliable, or when cognitive processes of decision-makers are biased through recent experience: the threshold will increase relative to the normative threshold value derived via system II using expected utility threshold. This inclination for the higher diagnostic certainty may, in turn, explain undertreatment that is also documented in the current medical practice. Conclusions We have developed the first dual processing model of medical decision-making that has potential to

  5. Markov Chain Models for Stochastic Behavior in Resonance Overlap Regions

    Science.gov (United States)

    McCarthy, Morgan; Quillen, Alice

    2018-01-01

    We aim to predict lifetimes of particles in chaotic zoneswhere resonances overlap. A continuous-time Markov chain model isconstructed using mean motion resonance libration timescales toestimate transition times between resonances. The model is applied todiffusion in the co-rotation region of a planet. For particles begunat low eccentricity, the model is effective for early diffusion, butnot at later time when particles experience close encounters to the planet.

  6. Novel baryon resonances in the Skyrme model

    International Nuclear Information System (INIS)

    Hussain, F.; Sri Ram, M.S.

    1985-01-01

    We predict a novel family of baryons with or without the charm quantum number by quantizing the ''maximal solitons'' in the SU(4) Skyrme model. The baryon number B of these solitons can take any integer value. The low-lying states with B = 1 belong to 4( with spin (3/2), 20( with spin (1/2), (3/2), (5/2), or (7/2), and 20('' with spin (3/2), (5/2), or (9/2). The charm-zero states among them could correspond to some of the observed resonances in meson-baryon scattering between 1.5--2 GeV. The lowest among the dibaryon states is an SU(3) singlet contained in the 10( of SU(4) with spin 1, with mass in the range 2.5--3 GeV

  7. Nonscaling parametrization of hadronic spectra and dual parton model

    International Nuclear Information System (INIS)

    Gaponenko, O.N.

    2001-01-01

    Using the popular Wdowczyk-Wolfendale parametrization (WW-parametrization) as an example one studies restrictions imposed by a dual parton model for different nonscaling parametrizations of the pulsed hadron spectra in soft hadron-hadron and hadron-nuclear interactions. One derived a new parametrization free from basic drawback of the WW-formulae. In the central range the determined parametrization show agreement with the Wdowczyk-Wolfendale formula, but in contrast to the last-named one it does not result in contradiction with the experiment due to fast reduction of inelastic factor reduction with energy increase [ru

  8. Conical Refraction: new observations and a dual cone model.

    Science.gov (United States)

    Sokolovskii, G S; Carnegie, D J; Kalkandjiev, T K; Rafailov, E U

    2013-05-06

    We propose a paraxial dual-cone model of conical refraction involving the interference of two cones of light behind the exit face of the crystal. The supporting experiment is based on beam selecting elements breaking down the conically refracted beam into two separate hollow cones which are symmetrical with one another. The shape of these cones of light is a product of a 'competition' between the divergence caused by the conical refraction and the convergence due to the focusing by the lens. The developed mathematical description of the conical refraction demonstrates an excellent agreement with experiment.

  9. Dual degree partnership in nursing: an innovative undergraduate educational model.

    Science.gov (United States)

    Bastable, Susan B; Markowitz, Marianne

    2012-10-01

    We report the success of a unique articulation Dual Degree Partnership in Nursing (DDPN) model. The process used to establish and implement this approach is described. Unlike typical 2+2 agreements between associate degree (AD) and bachelor degree (BS) nursing education programs, the DDPN is designed with a 1+2+1 sequence. Intended to attract high school students, this model provides the opportunity to earn two degrees (AD and BS) while experiencing a 4-year campus living and learning environment. This configuration was accomplished without compromising the integrity of either of the established programs. After collecting data over the past 6 years, this model demonstrates popularity with the traditional-aged student, as well as success from an academic perspective. Statistics on retention, graduation, and NCLEX® pass rates indicate the feasibility and success of the model. Based on the findings, the potential for replication is promising for other colleges interested in a similar collaboration. Copyright 2012, SLACK Incorporated.

  10. Mathematical Modeling of Dual Intake Transparent Transpired Solar Collector

    Directory of Open Access Journals (Sweden)

    Thomas Semenou

    2015-01-01

    Full Text Available Nowadays, in several types of commercial or institutional buildings, a significant rise of transpired solar collectors used to preheat the fresh air of the building can be observed. Nevertheless, when the air mass flow rate is low, the collector efficiency collapses and a large amount of energy remains unused. This paper presents a simple yet effective mathematical model of a transparent transpired solar collector (TTC with dual intake in order to remove stagnation problems in the plenum and ensure a better thermal efficiency and more heat recovery. A thermal model and a pressure loss model were developed. Then, the combined model was validated with experimental data from the Solar Rating and Certification Corporation (SRCC. The results show that the collector efficiency can be up to 70% and even 80% regardless of operating conditions. The temperature gain is able to reach 20°K when the solar irradiation is high.

  11. Improved dual sided doped memristor: modelling and applications

    Directory of Open Access Journals (Sweden)

    Anup Shrivastava

    2014-05-01

    Full Text Available Memristor as a novel and emerging electronic device having vast range of applications suffer from poor frequency response and saturation length. In this paper, the authors present a novel and an innovative device structure for the memristor with two active layers and its non-linear ionic drift model for an improved frequency response and saturation length. The authors investigated and compared the I–V characteristics for the proposed model with the conventional memristors and found better results in each case (different window functions for the proposed dual sided doped memristor. For circuit level simulation, they developed a SPICE model of the proposed memristor and designed some logic gates based on hybrid complementary metal oxide semiconductor memristive logic (memristor ratioed logic. The proposed memristor yields improved results in terms of noise margin, delay time and dynamic hazards than that of the conventional memristors (single active layer memristors.

  12. Dual regression physiological modeling of resting-state EPI power spectra: Effects of healthy aging.

    Science.gov (United States)

    Viessmann, Olivia; Möller, Harald E; Jezzard, Peter

    2018-02-02

    Aging and disease-related changes in the arteriovasculature have been linked to elevated levels of cardiac cycle-induced pulsatility in the cerebral microcirculation. Functional magnetic resonance imaging (fMRI), acquired fast enough to unalias the cardiac frequency contributions, can be used to study these physiological signals in the brain. Here, we propose an iterative dual regression analysis in the frequency domain to model single voxel power spectra of echo planar imaging (EPI) data using external recordings of the cardiac and respiratory cycles as input. We further show that a data-driven variant, without external physiological traces, produces comparable results. We use this framework to map and quantify cardiac and respiratory contributions in healthy aging. We found a significant increase in the spatial extent of cardiac modulated white matter voxels with age, whereas the overall strength of cardiac-related EPI power did not show an age effect. Copyright © 2018. Published by Elsevier Inc.

  13. Dual imaging probes for magnetic resonance imaging and fluorescence microscopy based on perovskite manganite nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Kačenka, M.; Kaman, Ondřej; Kotek, J.; Falteisek, L.; Černý, J.; Jirák, D.; Herynek, V.; Zacharovová, K.; Berková, A.; Jendelová, Pavla; Kupčík, Jaroslav; Pollert, Emil; Veverka, Pavel; Lukeš, I.

    2011-01-01

    Roč. 21, č. 1 (2011), s. 157-164 ISSN 0959-9428 R&D Projects: GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z50390703; CEZ:AV0Z40720504 Keywords : cellular labelling * dual probe * magnetic nanoparticles * MRI * silica coating Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  14. Vector and tensor meson production in quasi-two-body final states using the dual fermion model

    International Nuclear Information System (INIS)

    Becker, L.; Matthaeus, E.; Weigt, G.

    1976-01-01

    Phenomenological dual fermion amplitudes are obtained by using Neveu-Schwarz-Ramond model as a guide to incorporate half-integer spin. The model relates the production mechanism of different resonances lying on the same degenerate Regge trajectory, thus allowing a simultaneous description of vector and tensor meson production. A characteristic feature of the amplitudes is their non-evasive coupling structure. Predictions of the model for rho 0 -f-g 0 , ω-A 2 - and anti K*(890)-anti K*(1420) production in quasi-two-body reactions are compared with experimental data. The differential cross sections for natural and unnatural spin-parity t-channel exchanges as well as their contributions to different helicities of the produced resonances are given. In particular, new properties arise from the non-evasive pion exchange. Reasonable agreement with the data is found. (Auth.)

  15. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    DEFF Research Database (Denmark)

    Amoudache, Samira; Moiseyenko, Rayisa; Pennec, Yan

    2016-01-01

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defi...... of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.......-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation...

  16. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    Energy Technology Data Exchange (ETDEWEB)

    Amoudache, Samira [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria); Moiseyenko, Rayisa [Department of Physics, Technical University of Denmark, DTU Physics, Building 309, DK-2800 Kongens Lyngby (Denmark); Pennec, Yan, E-mail: yan.pennec@univ-lille1.fr; Rouhani, Bahram Djafari [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Khater, Antoine [Institut des Molécules et Matériaux du Mans (IMMM), UMR CNRS 6283, l' UNAM, Université du Maine, 72085 Le Mans (France); Lucklum, Ralf [Institute of Micro and Sensor Systems (IMOS), Otto-von-Guericke-University, P.O. Box 4120, D-39016 Magdeburg (Germany); Tigrine, Rachid [Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria)

    2016-03-21

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.

  17. Dual Resonant Frequencies Effects on an Induction-Based Oil Palm Fruit Sensor

    Directory of Open Access Journals (Sweden)

    Noor Hasmiza Harun

    2014-11-01

    Full Text Available As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB. Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB. A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA. To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

  18. Dual resonant frequencies effects on an induction-based oil palm fruit sensor.

    Science.gov (United States)

    Harun, Noor Hasmiza; Misron, Norhisam; Mohd Sidek, Roslina; Aris, Ishak; Wakiwaka, Hiroyuki; Tashiro, Kunihisa

    2014-11-19

    As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB). Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB). A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA). To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

  19. Polymer dual ring resonators for label-free optical biosensing using microfluidics.

    Science.gov (United States)

    Salleh, Muhammad H M; Glidle, Andrew; Sorel, Marc; Reboud, Julien; Cooper, Jonathan M

    2013-04-18

    We demonstrate a polymer resonator microfluidic biosensor that overcomes the complex manufacturing procedures required to fabricate traditional devices. In this new format, we show that a gapless light coupling photonic configuration, fabricated in SU8 polymer, can achieve high sensitivity, label-free chemical sensing in solution and high sensitivity biological sensing, at visible wavelengths.

  20. Dual deep modeling: multi-level modeling with dual potencies and its formalization in F-Logic.

    Science.gov (United States)

    Neumayr, Bernd; Schuetz, Christoph G; Jeusfeld, Manfred A; Schrefl, Michael

    2018-01-01

    An enterprise database contains a global, integrated, and consistent representation of a company's data. Multi-level modeling facilitates the definition and maintenance of such an integrated conceptual data model in a dynamic environment of changing data requirements of diverse applications. Multi-level models transcend the traditional separation of class and object with clabjects as the central modeling primitive, which allows for a more flexible and natural representation of many real-world use cases. In deep instantiation, the number of instantiation levels of a clabject or property is indicated by a single potency. Dual deep modeling (DDM) differentiates between source potency and target potency of a property or association and supports the flexible instantiation and refinement of the property by statements connecting clabjects at different modeling levels. DDM comes with multiple generalization of clabjects, subsetting/specialization of properties, and multi-level cardinality constraints. Examples are presented using a UML-style notation for DDM together with UML class and object diagrams for the representation of two-level user views derived from the multi-level model. Syntax and semantics of DDM are formalized and implemented in F-Logic, supporting the modeler with integrity checks and rich query facilities.

  1. Modeling of nanofabricated paddle bridges for resonant mass sensing

    International Nuclear Information System (INIS)

    Lobontiu, N.; Ilic, B.; Garcia, E.; Reissman, T.; Craighead, H. G.

    2006-01-01

    The modeling of nanopaddle bridges is studied in this article by proposing a lumped-parameter mathematical model which enables structural characterization in the resonant domain. The distributed compliance and inertia of all three segments composing a paddle bridge are taken into consideration in order to determine the equivalent lumped-parameter stiffness and inertia fractions, and further on the bending and torsion resonant frequencies. The approximate model produces results which are confirmed by finite element analysis and experimental measurements. The model is subsequently utilized to quantify the amount of mass which attaches to the bridge by predicting the modified resonant frequencies in either bending or torsion

  2. Uncertainty in dual permeability model parameters for structured soils

    Science.gov (United States)

    Arora, B.; Mohanty, B. P.; McGuire, J. T.

    2012-01-01

    Successful application of dual permeability models (DPM) to predict contaminant transport is contingent upon measured or inversely estimated soil hydraulic and solute transport parameters. The difficulty in unique identification of parameters for the additional macropore- and matrix-macropore interface regions, and knowledge about requisite experimental data for DPM has not been resolved to date. Therefore, this study quantifies uncertainty in dual permeability model parameters of experimental soil columns with different macropore distributions (single macropore, and low- and high-density multiple macropores). Uncertainty evaluation is conducted using adaptive Markov chain Monte Carlo (AMCMC) and conventional Metropolis-Hastings (MH) algorithms while assuming 10 out of 17 parameters to be uncertain or random. Results indicate that AMCMC resolves parameter correlations and exhibits fast convergence for all DPM parameters while MH displays large posterior correlations for various parameters. This study demonstrates that the choice of parameter sampling algorithms is paramount in obtaining unique DPM parameters when information on covariance structure is lacking, or else additional information on parameter correlations must be supplied to resolve the problem of equifinality of DPM parameters. This study also highlights the placement and significance of matrix-macropore interface in flow experiments of soil columns with different macropore densities. Histograms for certain soil hydraulic parameters display tri-modal characteristics implying that macropores are drained first followed by the interface region and then by pores of the matrix domain in drainage experiments. Results indicate that hydraulic properties and behavior of the matrix-macropore interface is not only a function of saturated hydraulic conductivity of the macroporematrix interface (Ksa) and macropore tortuosity (lf) but also of other parameters of the matrix and macropore domains.

  3. Extended charge banking model of dual path shocks for implantable cardioverter defibrillators.

    Science.gov (United States)

    Dosdall, Derek J; Sweeney, James D

    2008-08-01

    Single path defibrillation shock methods have been improved through the use of the Charge Banking Model of defibrillation, which predicts the response of the heart to shocks as a simple resistor-capacitor (RC) circuit. While dual path defibrillation configurations have significantly reduced defibrillation thresholds, improvements to dual path defibrillation techniques have been limited to experimental observations without a practical model to aid in improving dual path defibrillation techniques. The Charge Banking Model has been extended into a new Extended Charge Banking Model of defibrillation that represents small sections of the heart as separate RC circuits, uses a weighting factor based on published defibrillation shock field gradient measures, and implements a critical mass criteria to predict the relative efficacy of single and dual path defibrillation shocks. The new model reproduced the results from several published experimental protocols that demonstrated the relative efficacy of dual path defibrillation shocks. The model predicts that time between phases or pulses of dual path defibrillation shock configurations should be minimized to maximize shock efficacy. Through this approach the Extended Charge Banking Model predictions may be used to improve dual path and multi-pulse defibrillation techniques, which have been shown experimentally to lower defibrillation thresholds substantially. The new model may be a useful tool to help in further improving dual path and multiple pulse defibrillation techniques by predicting optimal pulse durations and shock timing parameters.

  4. Cultural differences of a dual-motivation model on health risk behaviour

    NARCIS (Netherlands)

    Ohtomo, S.; Hirose, Y.; Midden, C.J.H.

    2011-01-01

    This study investigated the cultural differences of a dual-motivation model of unhealthy risk behaviour in the Netherlands and Japan. Our model assumes dual motivations involved in unhealthy eating behaviour, a behavioural willingness that leads behaviour unintentionally or subconsciously and a

  5. Microvascular obstruction on delayed enhancement cardiac magnetic resonance imaging after acute myocardial infarction, compared with myocardial {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings

    Energy Technology Data Exchange (ETDEWEB)

    Mori, Hiroaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Cardiology, Kainan Hospital, Yatomi (Japan); Isobe, Satoshi, E-mail: sisobe@med.nagoya-u.ac.jp [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Sakai, Shinichi [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Yamada, Takashi [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Watanabe, Naoki; Miura, Manabu [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Uchida, Yasuhiro; Kanashiro, Masaaki; Ichimiya, Satoshi [Department of Cardiology, Yokkaichi Municipal Hospital, Yokkaichi (Japan); Okumura, Takahiro; Murohara, Toyoaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan)

    2015-08-15

    Highlights: • The percentage infarct size (%IS) was significantly greater in the microvascular obstruction (MO) group than in the non-MO group. • The percentage mismatch score (%MMS) on dual scintigraphy significantly correlated with the %IS and the percentage MO. • The %MMS was significantly greater in the non-MO group than in the MO group, and was an independent predictor for MO. - Abstract: Background: The hypo-enhanced regions within the hyper-enhanced infarct areas detected by cardiac magnetic resonance (CMR) imaging reflect microvascular obstruction (MO) after acute myocardial infarction (AMI). The combined myocardial thallium-201 ({sup 201}Tl)/iodine-123-15-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ({sup 123}I-BMIPP) dual single-photon emission computed tomography (SPECT) is a useful tool for detecting myocardial reversibility after AMI. We evaluated whether MO could be an early predictor of irreversible myocardial damage in comparison with {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings in AMI patients. Methods: Sixty-two patients with initial AMI who successfully underwent coronary revascularization were enrolled. MO was defined by CMR imaging. Patients were divided into 2 groups as follows: MO group (n = 32) and non-MO group (n = 30). Scintigraphic defect scores were calculated using a 17-segment model with a 5-point scoring system. The mismatch score (MMS) was calculated as follows: the total sum of (Σ) {sup 123}I-BMIPP defect score minus Σ{sup 201}Tl defect score. The percentage mismatch score (%MMS) was calculated as follows: MMS/(Σ{sup 123}I-BMIPP score) × 100 (%). Results: The percentage infarct size (%IS) was significantly greater in the MO group than in the non-MO group (32.2 ± 13.8% vs. 18.3 ± 12.1%, p < 0.001). The %MMS significantly correlated with the %IS and the percentage MO (r = −0.26, p = 0.03; r = −0.45, p < 0.001, respectively). The %MMS was significantly greater in the non-MO group than in the MO group (45.4

  6. The Linked Dual Representation model of vocal perception and production

    Directory of Open Access Journals (Sweden)

    Sean eHutchins

    2013-11-01

    Full Text Available The voice is one of the most important media for communication, yet there is a wide range of abilities in both the perception and production of the voice. In this article, we review this range of abilities, focusing on pitch accuracy as a particularly informative case, and look at the factors underlying these abilities. Several classes of models have been posited describing the relationship between vocal perception and production, and we review the evidence for and against each class of model. We look at how the voice is different from other musical instruments and review evidence about both the association and the dissociation between vocal perception and production abilities. Finally, we introduce the Linked Dual Representation model, a new approach which can account for the broad patterns in prior findings, including trends in the data which might seem to be countervailing. We discuss how this model interacts with higher-order cognition and examine its predictions about several aspects of vocal perception and production.

  7. Chrystal and Proudman resonances simulated with three numerical models

    Science.gov (United States)

    Bubalo, Maja; Janeković, Ivica; Orlić, Mirko

    2018-05-01

    The aim of this work was to study Chrystal and Proudman resonances in a simple closed basin and to explore and compare how well the two resonant mechanisms are reproduced with different, nowadays widely used, numerical ocean models. The test case was based on air pressure disturbances of two commonly used shapes (a sinusoidal and a boxcar), having various wave lengths, and propagating at different speeds. Our test domain was a closed rectangular basin, 300 km long with a uniform depth of 50 m, with the theoretical analytical solution available for benchmark. In total, 2250 simulations were performed for each of the three different numerical models: ADCIRC, SCHISM and ROMS. During each of the simulations, we recorded water level anomalies and computed the integral of the energy density spectrum for a number of points distributed along the basin. We have successfully documented the transition from Proudman to Chrystal resonance that occurs for a sinusoidal air pressure disturbance having a wavelength between one and two basin lengths. An inter-model comparison of the results shows that different models represent the two resonant phenomena in a slightly different way. For Chrystal resonance, all the models showed similar behavior; however, ADCIRC model providing slightly higher values of the mean resonant period than the other two models. In the case of Proudman resonance, the most consistent results, closest to the analytical solution, were obtained using ROMS model, which reproduced the mean resonant speed equal to 22.00 m/s— i.e., close to the theoretical value of 22.15 m/s. ADCIRC and SCHISM models showed small deviations from that value, with the mean speed being slightly lower—21.97 m/s (ADCIRC) and 21.93 m/s (SCHISM). The findings may seem small but could play an important role when resonance is a crucial process producing enhancing effects by two orders of magnitude (i.e., meteotsunamis).

  8. Entanglement Evolution of Jaynes-Cummings Model in Resonance Case and Non-resonance Case

    Science.gov (United States)

    Cheng, Jing; Chen, Xi; Shan, Chuan-Jia

    2018-03-01

    We investigate the entanglement evolution of a two-level atom and a quantized single model electromagnetic filed in the resonance and non-resonance cases. The effects of the initial state, detuning degree, photon number on the entanglement are shown in detail. The results show that the atom-cavity entanglement state appears with periodicity. The increasing of the photon number can make the period of quantum entanglement be shorter. In the non-resonant case, if we choose the suitable initial state the entanglement of atom-cavity can be 1.0

  9. Dyon Condensation and Dual Superconductivity in Abelian Higgs Model of QCD

    Directory of Open Access Journals (Sweden)

    B. S. Rajput

    2010-01-01

    Full Text Available Constructing the effective action for dyonic field in Abelian projection of QCD, it has been demonstrated that any charge (electrical or magnetic of dyon screens its own direct potential to which it minimally couples and antiscreens the dual potential leading to dual superconductivity in accordance with generalized Meissner effect. Taking the Abelian projection of QCD, an Abelian Higgs model, incorporating dual superconductivity and confinement, has been constructed and its representation has been obtained in terms of average of Wilson loop.

  10. The Friedrichs model and its use in resonance phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Gadella, M. [Departamento de Fisica Teorica, Atomica y Optica, Facultad de Ciencias, 47071 Valladolid (Spain); Pronko, G.P. [Institute for High Energy Physics, Protvino 142284, Moscow Region (Russian Federation)

    2011-09-15

    We present here a relation of different types of Friedrichs models and their use in the description and comprehension of resonance phenomena. We first discuss the basic Friedrichs model and obtain its resonance in the case that this is simple or doubly degenerated. Next, we discuss the model with N levels and show how the probability amplitude has an oscillatory behavior. Two generalizations of the Friedrichs model are suitable to introduce resonance behavior in quantum field theory. We also discuss a discrete version of the Friedrichs model and also a resonant interaction between two systems both with continuous spectrum. In an appendix, we review the mathematics of rigged Hilbert spaces. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. Relativistic strings and dual models of strong interactions

    International Nuclear Information System (INIS)

    Marinov, M.S.

    1977-01-01

    The theory of strong interactions,based on the model depicting a hardon as a one-dimentional elastic relativistic system(''string'') is considered. The relationship between this model and the concepts of quarks and partons is discussed. Presented are the principal results relating to the Veneziano dual theory, which may be considered as the consequence of the string model, and to its modifications. The classical string theory is described in detail. Attention is focused on questions of importance to the construction of the quantum theory - the Hamilton mechanisms and conformal symmetry. Quantization is described, and it is shown that it is not contradictory only in the 26-dimentional space and with a special requirement imposed on the spectrum of states. The theory of a string with a distributed spin is considered. The spin is introduced with the aid of the Grassman algebra formalism. In this case quantization is possible only in the 10-dimentional space. The strings interact by their ruptures and gluings. A method for calculating the interaction amplitudes is indicated

  12. A dual surface plasmon resonance assay for the determination of ribonuclease H activity

    Czech Academy of Sciences Publication Activity Database

    Šípová, Hana; Vaisocherová, Hana; Štepánek, J.; Homola, Jiří

    2010-01-01

    Roč. 26, č. 4 (2010), s. 1605-1611 ISSN 0956-5663 R&D Projects: GA AV ČR KAN200670701; GA MŠk OC09058; GA ČR GA202/09/0193 Grant - others:Univerzita Karlova(CZ) SVV-2010-261 304 Institutional research plan: CEZ:AV0Z20670512 Keywords : Surface plasmon resonance * Enzyme activity assay * Ribonuclease H * Biosensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 5.361, year: 2010

  13. War and peace: morphemes and full forms in a noninteractive activation parallel dual-route model.

    Science.gov (United States)

    Baayen, H; Schreuder, R

    This article introduces a computational tool for modeling the process of morphological segmentation in visual and auditory word recognition in the framework of a parallel dual-route model. Copyright 1999 Academic Press.

  14. A Test of Two Alternative Cognitive Processing Models: Learning Styles and Dual Coding

    Science.gov (United States)

    Cuevas, Joshua; Dawson, Bryan L.

    2018-01-01

    This study tested two cognitive models, learning styles and dual coding, which make contradictory predictions about how learners process and retain visual and auditory information. Learning styles-based instructional practices are common in educational environments despite a questionable research base, while the use of dual coding is less…

  15. A dual-wavelength overlapping resonance Rayleigh scattering method for the determination of chondroitin sulfate with nile blue sulfate

    Science.gov (United States)

    Cui, Zhiping; Hu, Xiaoli; Liu, Shaopu; Liu, Zhongfang

    2011-12-01

    A dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) method was developed to detect chondroitin sulfate (CS) with nile blue sulfate (NBS). At pH 3.0-4.0 Britton-Robinson (BR) buffer medium, CS interacted with NBS to form an ion-association complex. As a result, the new spectra of resonance Rayleigh scattering (RRS), second order scattering (SOS) and frequence doubling scattering (FDS) appeared and their intensities were enhanced greatly. Their maximum wavelengths were located at 303 nm (RRS), 362 nm (RRS), 588 nm (SOS) and 350 nm (FDS), respectively. The scattering intensities of the three methods were proportional to the concentration of CS in certain ranges. The methods had high sensitivity and the detection limits were between 1.5 and 7.1 ng mL -1. The DWO-RRS method had the highest sensitivity with the detection limit being 1.5 ng mL -1. The characteristics of the spectra and optimal reaction conditions of RRS method were investigated. The effects of coexistent substances on the determination of CS were evaluated. Owing to the high sensitivity, RRS method had been applied to the determination of CS in eye drops with satisfactory results. The recovery range was between 99.4% and 104.6% and the relative standard deviation (RSD) was between 0.4% and 0.8%. In addition, the reasons for RRS enhancement were discussed and the shape of ion-association complex was characterized by atomic force microscopy (AFM).

  16. Dual curved photonic crystal ring resonator based channel drop filter using two-dimensional photonic crystal structure

    Energy Technology Data Exchange (ETDEWEB)

    Chhipa, Mayur Kumar, E-mail: mayurchhipa1@gmail.com [Deptt. of Electronics and Communication Engineering, Government Engineering College Ajmer Rajasthan INDIA (India); Dusad, Lalit Kumar [Rajasthan Technical University Kota, Rajasthan (India)

    2016-05-06

    In this paper channel drop filter (CDF) is designed using dual curved photonic crystal ring resonator (PCRR). The photonic band gap (PBG) is calculated by plane wave expansion (PWE) method and the photonic crystal (PhC) based on two dimensional (2D) square lattice periodic arrays of silicon (Si) rods in air structure have been investigated using finite difference time domain (FDTD) method. The number of rods in Z and X directions is 21 and 20 respectively with lattice constant 0.540 nm and rod radius r = 0.1 µm. The channel drop filter has been optimized for telecommunication wavelengths λ = 1.591 µm with refractive indices 3.533. In the designed structure further analysis is also done by changing whole rods refractive index and it has been observed that this filter may be used for filtering several other channels also. The designed structure is useful for CWDM systems. This device may serve as a key component in photonic integrated circuits. The device is ultra compact with the overall size around 123 µm{sup 2}.

  17. Magnetic resonance imaging and dual energy X-ray absorptiometry of the lumbar spine in professional wrestlers and untrained men.

    Science.gov (United States)

    Hu, M; Sheng, J; Kang, Z; Zou, L; Guo, J; Sun, P

    2014-08-01

    The aim of this study was to examine the relation between bone marrow adipose tissue (BMAT) and bone mineral density (BMD) of lumbar spine in male professional wrestlers and healthy untrained men. A total of 14 wrestlers (22.9±3.4 years) and 11 controls (24.4±1.6 years) were studied cross-sectionally. Body composition and BMD were measured by dual-energy X-ray absorptiometry. Magnetic resonance imaging of the lumbar spine was examined in a sagittal T1-weighted (T1-w) spin-echo (SE) sequence. The averaged bone marrow signal intensity (SI) of L2-L4 was related to the signal of an adjacent nondegenerative disk. Mean SI of T1-w SE in wrestlers was lower than controls (P=0.001), indicating L2-L4 BMAT in wrestlers was lower compared to controls. L2-L4 BMD in wrestlers was higher than controls (PBMAT and BMD was confirmed in this relatively small subject sample with narrow age range, which implies that exercise training is an important determinant of this association.

  18. Study on Brilliant Blue-chitosan System by Dual-wavelength Overlapping Resonance Rayleigh Scattering Method and its Analytical Applications

    Science.gov (United States)

    Ma, Caijuan; Sun, Zijun; Liu, Guihua; Su, Zhengquan; Bai, Yan

    2018-02-01

    The method was presented for the sensitive and selective determination of chitosan (CTS) in health products with Brilliant Blue (BB) as a probe, based on dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS). In weakly acidic buffer solution, the binding of CTS and BB could result in the RRS intensities getting enhanced significantly at RRS peaks of 344 nm and 452 nm, and the scattering intensities of the two peaks were proportional to the concentration of CTS within a certain range. When the RRS intensities of the two wavelengths were superposed, the results showed higher sensitivity. Under the optimum experimental conditions, the total of the two increased RRS intensities was linear to the CTS concentration in the range of 0.02-1.80 μg/mL and the limit of detection (LOD) was 7.45 ng/mL. In this work, the optimum conditions and the effects of some foreign substances were studied. Accordingly, the new method based on DWO-RRS for the determination of CTS was developed. In addition, the effect of the molecular weight and the deacetylation degree between different chitosan molecules was discussed. Finally, this assay was applied to determine the concentration of CTS in health products with satisfactory results.

  19. Modeling of Perpendicularly Driven Dual-Frequency Capacitively Coupled Plasma

    International Nuclear Information System (INIS)

    Wang Hongyu; Sun Peng; Zhao Shuangyun; Li Yang; Jiang Wei

    2016-01-01

    We analyzed perpendicularly configured dual-frequency (DF) capacitively coupled plasmas (CCP). In this configuration, two pairs of electrodes are arranged oppositely, and the discharging is perpendicularly driven by two radio frequency (RF) sources. Particle-in-cell/Monte Carlo (PIC/MC) simulation showed that the configuration had some advantages as this configuration eliminated some dual frequency coupling effects. Some variation and potential application of the discharging configuration is discussed briefly. (paper)

  20. The dual-gate lumen model of renal monoamine transport

    Directory of Open Access Journals (Sweden)

    Marty Hinz

    2010-07-01

    Full Text Available Marty Hinz1, Alvin Stein2, Thomas Uncini31Clinical Research, NeuroResearch Clinics, Inc. Cape Coral, Florida, USA; 2Stein Orthopedic Associates, Plantation, Florida, USA; 3DBS Labs, Duluth, Minnesota, USAAbstract: The three-phase response of urinary serotonin and dopamine in subjects ­simultaneously taking amino acid precursors of serotonin and dopamine has been defined.1,2 No model exists regarding the renal etiology of the three-phase response. This writing outlines a model explaining the origin of the three-phase response of urinary serotonin and dopamine. A “dual-gate lumen transporter model” for the basolateral monoamine transporters of the kidneys is proposed as being the etiology of the three-phase urinary serotonin and dopamine responses.Purpose: The purpose of this writing is to document the internal renal function model that has evolved in research during large-scale assay with phase interpretation of urinary serotonin and dopamine.Patients and methods: In excess of 75,000 urinary monoamine assays from more than 7,500 patients were analyzed. The serotonin and the dopamine phase were determined for specimens submitted in the competitive inhibition state. The phase determination findings were then correlated with peer-reviewed literature.Results: The correlation between the three-phase response of urinary serotonin and dopamine with internal renal processes of the bilateral monoamine transporter and the apical monoamine transporter of the proximal convoluted renal tubule cells is defined.Conclusion: The phase of urinary serotonin and dopamine is dependent on the status of the serotonin gate, dopamine gate, and lumen of the basolateral monoamine transporter while in the competitive inhibition state.Keywords: serotonin, dopamine, basolateral, apical, kidney, proximal

  1. White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 1: Technology and Terminology.

    Science.gov (United States)

    Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

    This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.

  2. Dual breath-hold magnetic resonance cine evaluation of global and regional cardiac function

    International Nuclear Information System (INIS)

    Wintersperger, Bernd J.; Dietrich, Olaf; Huber, Armin; Reiser, Maximilian F.; Schoenberg, Stefan O.; Sincleair, Spencer; Runge, Val M.

    2007-01-01

    The purpose of our study was to evaluate the accuracy of a multislice cine magnetic resonance imaging (MRI) technique with parallel imaging in regard to global and regional left ventricular function. Forty-two individuals underwent cine MRI on a 1.5-tesla scanner. Cine MRI used a steady-state free precession technique and was performed as a single-slice technique (nonTSENSE cine) and an accelerated multislice technique (TSENSE cine) with five slices per breath-hold. End diastolic volume (EDV), end systolic volume (ESV), and ejection fraction (EF) were evaluated for all data sets and in regard to regional wall motion and regional wall motion analysis, and quantitative regional wall thickness and systolic thickening were also assessed. EDV, ESV, and EF based on TSENSE cine showed excellent correlation to the nonTSENSE cine approach (all r 2 =0.99, P<0.001). While EDV evaluations showed a small underestimation for TSENSE cine, ESV and EF showed accurate results compared with nonTSENSE cine. Both readers showed good agreement (κ=0.72) in regional wall motion assessment comparing both techniques. Data acquisition for the multislice approach was significantly shorter (∝75%) that in single-slice cine. We conclude that accurate evaluation of regional wall motion and left ventricular EF is possible using accelerated multislice cine MR with high spatial and temporal resolution. (orig.)

  3. Slow Steps towards Dual Earner/Dual Carer Family Model: Why Do Fathers Not Take Parental Leave

    Directory of Open Access Journals (Sweden)

    Marre Karu

    2011-06-01

    Full Text Available The article looks at the transition of Estonian society towards dual earner/dual carer family model and focuses on fathers’ decision regarding taking their parental leave. Based on theory of planned behaviour by Ajzen, data from 20 qualitative interviews with fathers of small children are analysed to explore the beliefs fathers have when it comes to parental leave. The analysis distinguishes between two images of ‘good parenting’ that play a role in the fathers’ intention to take parental leave. First, there is an image of an outcome-oriented ‘project manager’ affected by failure anxiety, and second, there is a much more relaxed image of a ‘good parent’ as a ‘companion’ who values everyday contact and a close relationship with the child(ren.

  4. Analytical Model of Planar Double Split Ring Resonator

    DEFF Research Database (Denmark)

    Zhurbenko, Vitaliy; Jensen, Thomas; Krozer, Viktor

    2007-01-01

    This paper focuses on accurate modelling of microstrip double split ring resonators. The impedance matrix representation for coupled lines is applied for the first time to model the SRR, resulting in excellent model accuracy over a wide frequency range. Phase compensation is implemented to take i...

  5. Semi classical model of the neutron resonance compound nucleus

    International Nuclear Information System (INIS)

    Ohkubo, Makio

    1995-01-01

    A Semi-classical model of compound nucleus is developed, where time evolution and recurrence for many degrees of freedom (oscillators) excited simultaneously are explicitly considered. The effective number of oscillators plays the role in the compound nucleus, and the nuclear temperatures are derived, which are in good agreement with the traditional values. Time structures of the compound nucleus at resonance are considered, from which equidistant level series with an envelope of strength function of giant resonance nature is obtained. S-matrix formulation for fine structure resonance is derived. (author)

  6. Model-based crosstalk compensation in simultaneous dual isotope SPECT

    International Nuclear Information System (INIS)

    Frey, E.C.; Tsui, B.M.W.; Du, A.Y.; Song, X.Y.

    2002-01-01

    Simultaneous dual isotope imaging has the potential of allowing imaging of two different physiological processes at the same time. Two examples are Tc-99m stress and Tl-201 rest myocardial perfusion imaging and Tc-99m perfusion and I-123 neuroreceptor brain imaging. However, for both of these cases crosstalk is a significant problem that results in degradation of the simultaneously acquired images. For the Tc-99m and Tl-201 case, the crosstalk includes downscatter and the generation of Pb x-rays detected in the Tl-201 energy window. For the Tc-99m/I-123 case, the crosstalk includes overlap of the two photopeaks, downscatter, especially of the 159 keV photons into the Tc-99m energy window, and contamination of the images of both isotopes by low abundance, high-energy I-123 photons. We have developed methods to accurately model the crosstalk in both cases. For the Tc-99m/Tl-201 case, the crosstalk model uses a previously described method for modeling scatter, effective source scatter estimation (ESSE). The scatter estimates are combined with a parameterization of the Pb x-ray response of the collimator to estimate the crosstalk. For the I-123/Tc-99m case we combine ESSE with a MC simulated collimator scatter and penetration responses to model the contamination due to the high-energy photons from I-123. In both cases the crosstalk models have been incorporated into an iterative reconstruction procedure that allows simultaneous reconstruction of the activity distributions from two isotopes including crosstalk compensation We have evaluated these methods both by Monte Carlo simulation studies and using physical phantom experiments. We find that the methods perform well and produce images with a quality and contrast approaching that of separately acquired images. However, the compensated simultaneously acquired images do have an increase in image noise. To reduce the noise we have applied ideal observer methodology to determine optimal energy windows and relative

  7. Dual-Mode Gas Sensor Composed of a Silicon Nanoribbon Field Effect Transistor and a Bulk Acoustic Wave Resonator: A Case Study in Freons

    Directory of Open Access Journals (Sweden)

    Ye Chang

    2018-01-01

    Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.

  8. Validation of an Acoustic Impedance Prediction Model for Skewed Resonators

    Science.gov (United States)

    Howerton, Brian M.; Parrott, Tony L.

    2009-01-01

    An impedance prediction model was validated experimentally to determine the composite impedance of a series of high-aspect ratio slot resonators incorporating channel skew and sharp bends. Such structures are useful for packaging acoustic liners into constrained spaces for turbofan noise control applications. A formulation of the Zwikker-Kosten Transmission Line (ZKTL) model, incorporating the Richards correction for rectangular channels, is used to calculate the composite normalized impedance of a series of six multi-slot resonator arrays with constant channel length. Experimentally, acoustic data was acquired in the NASA Langley Normal Incidence Tube over the frequency range of 500 to 3500 Hz at 120 and 140 dB OASPL. Normalized impedance was reduced using the Two-Microphone Method for the various combinations of channel skew and sharp 90o and 180o bends. Results show that the presence of skew and/or sharp bends does not significantly alter the impedance of a slot resonator as compared to a straight resonator of the same total channel length. ZKTL predicts the impedance of such resonators very well over the frequency range of interest. The model can be used to design arrays of slot resonators that can be packaged into complex geometries heretofore unsuitable for effective acoustic treatment.

  9. Nanoparticles in magnetic resonance imaging: from simple to dual contrast agents

    Directory of Open Access Journals (Sweden)

    Estelrich J

    2015-03-01

    Full Text Available Joan Estelrich,1,2 María Jesús Sánchez-Martín,1 Maria Antònia Busquets1,2 1Departament de Fisicoquímica, Facultat de Farmàcia, Universitat de Barcelona, Barcelona, Catalonia, Spain; 2Institut de Nanociència I Nanotecnologia (IN2UB, Barcelona, Catalonia, SpainAbstract: Magnetic resonance imaging (MRI has become one of the most widely used and powerful tools for noninvasive clinical diagnosis owing to its high degree of soft tissue contrast, spatial resolution, and depth of penetration. MRI signal intensity is related to the relaxation times (T1, spin–lattice relaxation and T2, spin–spin relaxation of in vivo water protons. To increase contrast, various inorganic nanoparticles and complexes (the so-called contrast agents are administered prior to the scanning. Shortening T1 and T2 increases the corresponding relaxation rates, 1/T1 and 1/T2, producing hyperintense and hypointense signals respectively in shorter times. Moreover, the signal-to-noise ratio can be improved with the acquisition of a large number of measurements. The contrast agents used are generally based on either iron oxide nanoparticles or ferrites, providing negative contrast in T2-weighted images; or complexes of lanthanide metals (mostly containing gadolinium ions, providing positive contrast in T1-weighted images. Recently, lanthanide complexes have been immobilized in nanostructured materials in order to develop a new class of contrast agents with functions including blood-pool and organ (or tumor targeting. Meanwhile, to overcome the limitations of individual imaging modalities, multimodal imaging techniques have been developed. An important challenge is to design all-in-one contrast agents that can be detected by multimodal techniques. Magnetoliposomes are efficient multimodal contrast agents. They can simultaneously bear both kinds of contrast and can, furthermore, incorporate targeting ligands and chains of polyethylene glycol to enhance the accumulation of

  10. Glioma-targeting micelles for optical/magnetic resonance dual-mode imaging

    Directory of Open Access Journals (Sweden)

    Zhou Q

    2015-03-01

    Full Text Available Qing Zhou,1,* Ketao Mu,2,* Lingyu Jiang,1 Hui Xie,3 Wei Liu,1 Zhengzheng Li,1 Hui Qi,1 Shuyan Liang,1 Huibi Xu,1 Yanhong Zhu,1 Wenzhen Zhu,2 Xiangliang Yang11National Engineering Research Center for Nanomedicine, College of Life Science and Technology, 2Radiology Department, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, 3Department of Information Processing, China Patent Information Center, Wuhan, People’s Republic of China*These authors contributed equally to this workAbstract: Surgical resection is the primary mode for glioma treatment, while gross total resection is difficult to achieve, due to the invasiveness of the gliomas. Meanwhile, the tumor-resection region is closely related to survival rate and life quality. Therefore, we developed optical/magnetic resonance imaging (MRI bifunctional targeted micelles for glioma so as to delineate the glioma location before and during operation. The micelles were constructed through encapsulation of hydrophobic superparamagnetic iron oxide nanoparticles (SPIONs with polyethylene glycol-block-polycaprolactone (PEG-b-PCL by using a solvent-evaporation method, and modified with a near-infrared fluorescent probe, Cy5.5, in addition to the glioma-targeting ligand lactoferrin (Lf. Being encapsulated by PEG-b-PCL, the hydrophobic SPIONs dispersed well in phosphate-buffered saline over 4 weeks, and the relaxivity (r2 of micelles was 215.4 mM–1·s–1, with sustained satisfactory fluorescent imaging ability, which might have been due to the interval formed by PEG-b-PCL for avoiding the fluorescence quenching caused by SPIONs. The in vivo results indicated that the nanoparticles with Lf accumulated efficiently in glioma cells and prolonged the duration of hypointensity at the tumor site over 48 hours in the MR image compared to the nontarget group. Corresponding with the MRI results, the margin of the glioma was clearly demarcated in the fluorescence image

  11. Dual permeability FEM models for distributed fiber optic sensors development

    Science.gov (United States)

    Aguilar-López, Juan Pablo; Bogaard, Thom

    2017-04-01

    Fiber optic cables are commonly known for being robust and reliable mediums for transferring information at the speed of light in glass. Billions of kilometers of cable have been installed around the world for internet connection and real time information sharing. Yet, fiber optic cable is not only a mean for information transfer but also a way to sense and measure physical properties of the medium in which is installed. For dike monitoring, it has been used in the past for detecting inner core and foundation temperature changes which allow to estimate water infiltration during high water events. The DOMINO research project, aims to develop a fiber optic based dike monitoring system which allows to directly sense and measure any pore pressure change inside the dike structure. For this purpose, questions like which location, how many sensors, which measuring frequency and which accuracy are required for the sensor development. All these questions may be initially answered with a finite element model which allows to estimate the effects of pore pressure change in different locations along the cross section while having a time dependent estimation of a stability factor. The sensor aims to monitor two main failure mechanisms at the same time; The piping erosion failure mechanism and the macro-stability failure mechanism. Both mechanisms are going to be modeled and assessed in detail with a finite element based dual permeability Darcy-Richards numerical solution. In that manner, it is possible to assess different sensing configurations with different loading scenarios (e.g. High water levels, rainfall events and initial soil moisture and permeability conditions). The results obtained for the different configurations are later evaluated based on an entropy based performance evaluation. The added value of this kind of modelling approach for the sensor development is that it allows to simultaneously model the piping erosion and macro-stability failure mechanisms in a time

  12. Nontopological bare solutions in the relativistic self-dual Maxwell-Chern-Simons-Higgs model

    International Nuclear Information System (INIS)

    Han, Jongmin; Jang, Jaeduk

    2005-01-01

    In this paper we prove the existence of the radially symmetric nontopological bare solutions in the relativistic self-dual Maxwell-Chern-Simons-Higgs model. We also verify the Chern-Simons limit for those solutions

  13. Hybrid model for the decay of nuclear giant resonances

    International Nuclear Information System (INIS)

    Hussein, M.S.

    1986-12-01

    The decay properties of nuclear giant multipole resonances are discussed within a hybrid model that incorporates, in a unitary consistent way, both the coherent and statistical features. It is suggested that the 'direct' decay of the GR is described with continuum first RPA and the statistical decay calculated with a modified Hauser-Feshbach model. Application is made to the decay of the giant monopole resonance in 208 Pb. Suggestions are made concerning the calculation of the mixing parameter using the statistical properties of the shell model eigenstates at high excitation energies. (Author) [pt

  14. Relativistic Coulomb excitation of giant resonances in the hydrodynamic model

    International Nuclear Information System (INIS)

    Vasconcellos Gomes, Ana Cristina de.

    1990-05-01

    We investigate the Coulomb excitation of giant dipole resonances in relativistic heavy ion collisions using a macroscopic hydrodynamical model for the harmonic vibrations of the nuclear fluid. The motion is treated as a combination of the Goldhaber-Teller displacement mode and the Steinwedel-Jensen acoustic mode, and the restoring forces are calculated using the droplet model. This model is used as input to study the characteristics of multiple excitation of giant dipole resonances in nuclei. Possible signatures for the existence of such states are also discussed quantitatively. (author). 52 refs., 14 figs., 3 tabs

  15. Model predictive control for a dual active bridge inverter with a floating bridge

    OpenAIRE

    Chowdhury, Shajjad; Wheeler, Patrick W.; Gerada, C.; Patel, Chintan

    2016-01-01

    This paper presents a Model Predictive Control technique applied to a dual active bridge inverter where one of the bridges is floating. The proposed floating bridge topology eliminates the need for isolation transformer in a dual inverter system and therefore reduces the size, weight and losses in the system. To achieve multilevel output voltage waveforms the floating inverter DC link capacitor is charged to the half of the main DC link voltage. A finite-set Model Predictive Control technique...

  16. Application of the dual reciprocity boundary element method for numerical modelling of solidification process

    Directory of Open Access Journals (Sweden)

    E. Majchrzak

    2008-12-01

    Full Text Available The dual reciprocity boundary element method is applied for numerical modelling of solidification process. This variant of the BEM is connected with the transformation of the domain integral to the boundary integrals. In the paper the details of the dual reciprocity boundary element method are presented and the usefulness of this approach to solidification process modelling is demonstrated. In the final part of the paper the examples of computations are shown.

  17. Quark-parton model from dual topological unitarization

    International Nuclear Information System (INIS)

    Cohen-Tannoudji, G.; El Hassouni, A.; Kalinowski, J.; Peschanski, R.

    1979-01-01

    Topology, which occurs in the topological expansion of quantum chromodynamics (QCD) and in the dual topological unitarization (DTU) schemes, allows us to establish a quantitative correspondence between QCD and the dual S-matrix approaches. This topological correspondence, proposed by Veneziano and made more explicit in a recent paper for current-induced reactions, provides a clarifying and unifying quark-parton interpretation of soft inclusive processes. Precise predictions for inclusive cross sections in hadron-hadron collisions, structure functions of hadrons, and quark fragmentation functions including absolute normalizations are shown to agree with data. On a more theoretical ground the proposed scheme suggests a new approach to the confinement problem

  18. Pricing Model for Dual Sales Channel with Promotion Effect Consideration

    OpenAIRE

    Chuiri Zhou

    2016-01-01

    We focus on the pricing strategy of a dual sales channel member when his/her online retailer faces an upcoming overloaded express delivery service due to the sales peak of online shopping, especially referring to the occurring affairs in China. We characterize the pricing problem of the dual selling channel system as a two-period game. When the price discount is only provided by the online seller, we find that the prices of the traditional channel and the online channel in the two periods are...

  19. Modeling and Control of a Dual-Input Isolated Full-Bridge Boost Converter

    DEFF Research Database (Denmark)

    Zhang, Zhe; Thomsen, Ole Cornelius; Andersen, Michael A. E.

    2012-01-01

    In this paper, a steady-state model, a large-signal (LS) model and an ac small-signal (SS) model for a recently proposed dual-input transformer-isolated boost converter are derived respectively by the switching flow-graph (SFG) nonlinear modeling technique. Based upon the converter’s model...

  20. A fuzzy-stochastic power system planning model: Reflection of dual objectives and dual uncertainties

    International Nuclear Information System (INIS)

    Zhang, X.Y.; Huang, G.H.; Zhu, H.; Li, Y.P.

    2017-01-01

    In this study, a fuzzy stochastic dynamic fractional programming (FSDFP) method is proposed for supporting sustainable management of electric power system (EPS) under dual uncertainties. As an improvement upon the mixed-integer linear fractional programming, FSDFP can not only tackle multi-objective issues effectively without setting weights, but also can deal with uncertain parameters which have both stochastic and fuzzy characteristics. Thus, the developed method can help provide valuable information for supporting capacity-expansion planning and in-depth policy analysis of EPS management problems. For demonstrating these advantages, FSDFP has been applied to a case study of a typical regional EPS planning, where the decision makers have to deal with conflicts between economic development that maximizes the system profit and environmental protection that minimizes the carbon dioxide emissions. The obtained results can be analyzed to generate several decision alternatives, and can then help decision makers make suitable decisions under different input scenarios. Furthermore, comparisons of the solution from FSDFP method with that from fuzzy stochastic dynamic linear programming, linear fractional programming and dynamic stochastic fractional programming methods are undertaken. The contrastive analysis reveals that FSDFP is a more effective approach that can better characterize the complexities and uncertainties of real EPS management problems. - Highlights: • A fuzzy stochastic dynamic fractional programming (FSDFP) method is proposed. • FSDFP can address multiple conflicting objectives without setting weights. • FSDFP can reflect dual uncertainties with both stochastic and fuzzy characteristics. • Some reasonable solutions for a case of power system sustainable planning are generated. • Comparisons of the solutions from FSDFP with other optimization methods are undertaken.

  1. Nonlinear Dynamics of a Helicopter Model in Ground Resonance

    Science.gov (United States)

    Tang, D. M.; Dowell, E. H.

    1985-01-01

    An approximate theoretical method is presented which determined the limit cycle behavior of a helicopter model which has one or two nonlinear dampers. The relationship during unstable ground resonance oscillations between lagging motion of the blades and fuselage motion is discussed. An experiment was carried out on using a helicopter scale model. The experimental results agree with those of the theoretical analysis.

  2. Quantitative assessment of left ventricular function with dual-source CT in comparison to cardiac magnetic resonance imaging: initial findings

    Energy Technology Data Exchange (ETDEWEB)

    Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K. [University of Munich, Department of Clinical Radiology, Munich (Germany)

    2008-03-15

    Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 {+-} 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 {+-} 41.9 ml and 54.9 {+-} 29.6 ml, respectively, compared with 132.1 {+-} 40.8 ml EDV and 57.6 {+-} 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 {+-} 12.4% in DSCT and 57.9 {+-} 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P = 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter

  3. Quantitative assessment of left ventricular function with dual-source CT in comparison to cardiac magnetic resonance imaging: initial findings

    International Nuclear Information System (INIS)

    Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K.

    2008-01-01

    Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 ± 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 ± 41.9 ml and 54.9 ± 29.6 ml, respectively, compared with 132.1 ± 40.8 ml EDV and 57.6 ± 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 ± 12.4% in DSCT and 57.9 ± 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter-observer variability were

  4. Determination of trace uranium by resonance fluorescence method coupled with photo-catalytic technology and dual cloud point extraction.

    Science.gov (United States)

    Li, Jiekang; Li, Guirong; Han, Qian

    2016-12-05

    In this paper, two kinds of salophens (Sal) with different solubilities, Sal1 and Sal2, have been respectively synthesized, and they all can combine with uranyl to form stable complexes: [UO2(2+)-Sal1] and [UO2(2+)-Sal2]. Among them, [UO2(2+)-Sal1] was used as ligand to extract uranium in complex samples by dual cloud point extraction (dCPE), and [UO2(2+)-Sal2] was used as catalyst for the determination of uranium by photocatalytic resonance fluorescence (RF) method. The photocatalytic characteristic of [UO2(2+)-Sal2] on the oxidized pyronine Y (PRY) by potassium bromate which leads to the decrease of RF intensity of PRY were studied. The reduced value of RF intensity of reaction system (ΔF) is in proportional to the concentration of uranium (c), and a novel photo-catalytic RF method was developed for the determination of trace uranium (VI) after dCPE. The combination of photo-catalytic RF techniques and dCPE procedure endows the presented methods with enhanced sensitivity and selectivity. Under optimal conditions, the linear calibration curves range for 0.067 to 6.57ngmL(-1), the linear regression equation was ΔF=438.0 c (ngmL(-1))+175.6 with the correlation coefficient r=0.9981. The limit of detection was 0.066ngmL(-1). The proposed method was successfully applied for the separation and determination of uranium in real samples with the recoveries of 95.0-103.5%. The mechanisms of the indicator reaction and dCPE are discussed. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Dual-echo, chemical shift gradient-echo magnetic resonance imaging to quantify hepatic steatosis: Implications for living liver donation.

    Science.gov (United States)

    Rinella, Mary E; McCarthy, Richard; Thakrar, Kiran; Finn, John Paul; Rao, Sambasiva M; Koffron, Alan J; Abecassis, Michael; Blei, Andres T

    2003-08-01

    In living liver donation, a fatty liver poses risks for both recipient and donor. Currently, liver biopsy is the standard for assessing the presence and extent of steatosis. The goals of this study were to correlate a steatosis index derived from magnetic resonance imaging (MRI) to the histologic grade on biopsy as well as to determine the topographic distribution of steatosis within the liver. We examined the ability of dual-echo, chemical shift gradient-echo MRI to predict the degree of steatosis on liver biopsy. A total of 22 subjects received both a liver biopsy and detailed MRI evaluation. These individuals included 15 potential living donors and 7 patients with nonalcoholic fatty liver disease. MRI steatosis index was then compared with histologic grade on liver biopsy. The topographic distribution of hepatic steatosis was determined from those subjects in whom MRI detected hepatic steatosis. The steatosis index had a positive correlation with grade of steatosis on liver biopsy (correlation coefficient, 0.84). There was no significant variation in the degree of steatosis among segments. A steatosis index of >0.2 had good positive and negative predictive value for the presence of significant steatosis (>15%) on biopsy. Our quantitative MRI protocol can predict the degree of hepatic steatosis when it is minimal to moderate, and may obviate the need for liver biopsy for the purpose of quantification of steatosis in living donors. Fat saturation added to the MRI protocol may further improve diagnostic accuracy. This technique may be applicable to the larger population with hepatic steatosis.

  6. Mesoporous composite nanoparticles for dual-modality ultrasound/magnetic resonance imaging and synergistic chemo-/thermotherapy against deep tumors

    Directory of Open Access Journals (Sweden)

    Zhang N

    2017-10-01

    Full Text Available Nan Zhang,1 Ronghui Wang,2 Junnian Hao,1 Yang Yang,1 Hongmi Zou,3 Zhigang Wang1 1Chongqing Key Laboratory of Ultrasound Molecular Imaging, Second Affiliated Hospital of Chongqing Medical University, Chongqing Medical University, Chongqing, 2Department of Ultrasound, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, 3Department of Ophthalmology, Second Affiliated Hospital of Chongqing Medical University, Chongqing, People’s Republic of China Abstract: High-intensity focused ultrasound (HIFU is a promising and noninvasive treatment for solid tumors, which has been explored for potential clinical applications. However, the clinical applications of HIFU for large and deep tumors such as hepatocellular carcinoma (HCC are severely limited by unsatisfactory imaging guidance, long therapeutic times, and damage to normal tissue around the tumor due to the high power applied. In this study, we developed doxorubicin/perfluorohexane-encapsulated hollow mesoporous Prussian blue nanoparticles (HMPBs-DOX/PFH as theranostic agents, which can effectively guide HIFU therapy and enhance its therapeutic effects in combination with chemotherapy, by decreasing the cavitation threshold. We investigated the effects of this agent on ultrasound and magnetic resonance imaging in vitro and in vivo. In addition, we showed a highly efficient HIFU therapeutic effect against HCC tumors, as well as controlled drug release, owing to the phase-transitional performance of the PFH. We therefore conclude that HMPB-DOX/PFH is a safe and efficient nanoplatform, which holds significant promise for cancer theranostics against deep tumors in clinical settings. Keywords: high-intensity focused ultrasound, HIFU, hollow mesoporous Prussian blue nanoplatforms, hepatocellular carcinoma, dual-modality imaging, synergistic chemo-/thermotherapy, theranostics

  7. Small-signal model for the series resonant converter

    Science.gov (United States)

    King, R. J.; Stuart, T. A.

    1985-01-01

    The results of a previous discrete-time model of the series resonant dc-dc converter are reviewed and from these a small signal dynamic model is derived. This model is valid for low frequencies and is based on the modulation of the diode conduction angle for control. The basic converter is modeled separately from its output filter to facilitate the use of these results for design purposes. Experimental results are presented.

  8. Direct Evidence for a Dual Process Model of Deductive Inference

    Science.gov (United States)

    Markovits, Henry; Brunet, Marie-Laurence; Thompson, Valerie; Brisson, Janie

    2013-01-01

    In 2 experiments, we tested a strong version of a dual process theory of conditional inference (cf. Verschueren et al., 2005a, 2005b) that assumes that most reasoners have 2 strategies available, the choice of which is determined by situational variables, cognitive capacity, and metacognitive control. The statistical strategy evaluates inferences…

  9. Resonance

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2014-01-01

    A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice.......A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice....

  10. Equivalent-circuit model for the thickness-shear mode resonator with a viscoelastic film near film resonance.

    Science.gov (United States)

    Martin, S J; Bandey, H L; Cernosek, R W; Hillman, A R; Brown, M J

    2000-01-01

    We derive a lumped-element, equivalent-circuit model for the thickness-shear mode (TSM) resonator with a viscoelastic film. This modified Butterworth-Van Dyke model includes in the motional branch a series LCR resonator, representing the quartz resonance, and a parallel LCR resonator, representing the film resonance. This model is valid in the vicinity of film resonance, which occurs when the acoustic phase shift across the film is an odd multiple of pi/2 rad. For low-loss films, this model accurately predicts the frequency changes and damping that arise at resonance and is a reasonable approximation away from resonance. Elements of the parallel LCR resonator are explicitly related to film properties and can be interpreted in terms of elastic energy storage and viscous power dissipation. The model leads to a simple graphical interpretation of the coupling between the quartz and film resonances and facilitates understanding of the resulting responses. These responses are compared with predictions from the transmission-line and Sauerbrey models.

  11. Modelling Strategies for Functional Magnetic Resonance Imaging

    DEFF Research Database (Denmark)

    Madsen, Kristoffer Hougaard

    2009-01-01

    and generalisations to higher order arrays are considered. Additionally, an application of the natural conjugate prior for supervised learning in the general linear model to efficiently incorporate prior information for supervised analysis is presented. Further extensions include methods to model nuisance effects...... in fMIR data thereby suppressing noise for both supervised and unsupervised analysis techniques....

  12. Electromagnetic Form Factors of Hadrons in Dual-Large Nc QCD

    International Nuclear Information System (INIS)

    Dominguez, C. A.

    2011-01-01

    In this talk, results are presented of determinations of electromagnetic form factors of hadrons (pion, proton, and Δ(1236)) in the framework of Dual-Large N c QCD (Dual-QCD ∞ ). This framework improves considerably tree-level VMD results by incorporating an infinite number of zero-width resonances, with masses and couplings fixed by the dual-resonance (Veneziano-type) model.

  13. Connection between Einstein equations, nonlinear sigma models, and self-dual Yang-Mills theory

    International Nuclear Information System (INIS)

    Sanchez, N.; Whiting, B.

    1986-01-01

    The authors analyze the connection between nonlinear sigma models self-dual Yang-Mills theory, and general relativity (self-dual and non-self-dual, with and without killing vectors), both at the level of the equations and at the level of the different type of solutions (solitons and calorons) of these theories. They give a manifestly gauge invariant formulation of the self-dual gravitational field analogous to that given by Yang for the self-dual Yang-Mills field. This formulation connects in a direct and explicit way the self-dual Yang-Mills and the general relativity equations. They give the ''R gauge'' parametrization of the self-dual gravitational field (which corresponds to modified Yang's-type and Ernst equations) and analyze the correspondence between their different types of solutions. No assumption about the existence of symmetries in the space-time is needed. For the general case (non-self-dual), they show that the Einstein equations contain an O nonlinear sigma model. This connection with the sigma model holds irrespective of the presence of symmetries in the space-time. They found a new class of solutions of Einstein equations depending on holomorphic and antiholomorphic functions and we relate some subclasses of these solutions to solutions of simpler nonlinear field equations that are well known in other branches of physics, like sigma models, SineGordon, and Liouville equations. They include gravitational plane wave solutions. They analyze the response of different accelerated quantum detector models, compare them to the case when the detectors are linterial in an ordinary Planckian gas at a given temperature, and discuss the anisotropy of the detected response for Rindler observers

  14. The impact of dual-source parallel radiofrequency transmission with patient-adaptive shimming on the cardiac magnetic resonance in children at 3.0 T.

    Science.gov (United States)

    Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin

    2017-06-01

    The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.

  15. Giant resonance of electrical multipole from droplet model

    International Nuclear Information System (INIS)

    Tauhata, L.

    1984-01-01

    The formalism of the electrical multipole resonance developed from the Droplet nuclear model is presented. It combines the approaches of Goldhaber-Teller (GT) and Steinwedel-Jensen (SJ) and it shows the relative contribution of Coulomb, superficial and neutron excess energies. It also discusses the calculation of half-width. The model evaluates correctly the resonance energies as a function of nuclear mass and allows, through the Mixture Index, the prediction of the complementary participation of modes SJ and GT in the giant nuclear resonance. Values of the mixture index, for each multipolarity, reproduce well the form factors obtained from experiments of charged particle inelastic scattering. The formalism presented for the calculation of the half-width gives a macroscopic description of the friction mechanism. The establishment of the macroscopic structure of the Dissipation Function is used as a reference in the comparison of microscopic calculations. (Author) [pt

  16. Physically based model for extracting dual permeability parameters using non-Newtonian fluids

    Science.gov (United States)

    Abou Najm, M. R.; Basset, C.; Stewart, R. D.; Hauswirth, S.

    2017-12-01

    Dual permeability models are effective for the assessment of flow and transport in structured soils with two dominant structures. The major challenge to those models remains in the ability to determine appropriate and unique parameters through affordable, simple, and non-destructive methods. This study investigates the use of water and a non-Newtonian fluid in saturated flow experiments to derive physically-based parameters required for improved flow predictions using dual permeability models. We assess the ability of these two fluids to accurately estimate the representative pore sizes in dual-domain soils, by determining the effective pore sizes of macropores and micropores. We developed two sub-models that solve for the effective macropore size assuming either cylindrical (e.g., biological pores) or planar (e.g., shrinkage cracks and fissures) pore geometries, with the micropores assumed to be represented by a single effective radius. Furthermore, the model solves for the percent contribution to flow (wi) corresponding to the representative macro and micro pores. A user-friendly solver was developed to numerically solve the system of equations, given that relevant non-Newtonian viscosity models lack forms conducive to analytical integration. The proposed dual-permeability model is a unique attempt to derive physically based parameters capable of measuring dual hydraulic conductivities, and therefore may be useful in reducing parameter uncertainty and improving hydrologic model predictions.

  17. Probabilistic Modeling of Seismic Risk Based Design for a Dual System Structure

    OpenAIRE

    Sidi, Indra Djati

    2017-01-01

    The dual system structure concept has gained popularity in the construction of high-rise buildings over the last decades. Meanwhile, earthquake engineering design provisions for buildings have moved from the uniform hazard concept to the uniform risk concept upon recognizing the uncertainties involved in the earthquake resistance of concrete structures. In this study, a probabilistic model for the evaluation of such risk is proposed for a dual system structure consisting of shear walls or cor...

  18. Modeling and simulation of a dual-junction CIGS solar cell using Silvaco ATLAS

    OpenAIRE

    Fotis, Konstantinos

    2012-01-01

    Approved for public release; distribution is unlimited. The potential of designing a dual-junction Copper Indium Gallium Selenide (CIGS) photovoltaic cell is investigated in this thesis. Research into implementing a dual-junction solar cell, using a CIGS bottom cell and different thin-film designs as a top cell, was conducted in order to increase the current record efficiency of 20.3% for a single CIGS cell. This was accomplished through modeling and simulation using Silvaco ATLASTM, an ad...

  19. Estimating dual deposit insurance premium rates and forecasting non-performing loans: Two new models

    OpenAIRE

    Yoshino, Naoyuki; Taghizadeh-Hesary, Farhad; Nili, Farhad

    2015-01-01

    Risky banks that endanger the stability of the financial system should pay higher deposit insurance premiums than healthy banks and other financial institutions that have shown good financial performance. It is necessary, therefore, to have at least a dual fair premium rate system. In this paper, we develop a model for calculating dual fair premium rates. Our definition of a fair premium rate in this paper is a rate that could cover the operational expenditures of the deposit insuring organiz...

  20. The dual-electrode DC arc furnace-modelling brush arc conditions

    OpenAIRE

    Reynolds, Q.G.

    2012-01-01

    The dual-electrode DC arc furnace, an alternative design using an anode and cathode electrode instead of a hearth anode, was studied at small scale using computational modelling methods. Particular attention was paid to the effect of two key design variables, the arc length and the electrode separation, on the furnace behaviour. It was found that reducing the arc length to brush arc conditions was a valid means of overcoming several of the limitations of the dual-electrode design, namely high...

  1. Dual-Recognition Förster Resonance Energy Transfer Based Platform for One-Step Sensitive Detection of Pathogenic Bacteria Using Fluorescent Vancomycin-Gold Nanoclusters and Aptamer-Gold Nanoparticles.

    Science.gov (United States)

    Yu, Mengqun; Wang, Hong; Fu, Fei; Li, Linyao; Li, Jing; Li, Gan; Song, Yang; Swihart, Mark T; Song, Erqun

    2017-04-04

    The effective monitoring, identification, and quantification of pathogenic bacteria is essential for addressing serious public health issues. In this study, we present a universal and facile one-step strategy for sensitive and selective detection of pathogenic bacteria using a dual-molecular affinity-based Förster (fluorescence) resonance energy transfer (FRET) platform based on the recognition of bacterial cell walls by antibiotic and aptamer molecules, respectively. As a proof of concept, Vancomycin (Van) and a nucleic acid aptamer were employed in a model dual-recognition scheme for detecting Staphylococcus aureus (Staph. aureus). Within 30 min, by using Van-functionalized gold nanoclusters and aptamer-modified gold nanoparticles as the energy donor and acceptor, respectively, the FRET signal shows a linear variation with the concentration of Staph. aureus in the range from 20 to 10 8 cfu/mL with a detection limit of 10 cfu/mL. Other nontarget bacteria showed negative results, demonstrating the good specificity of the approach. When employed to assay Staph. aureus in real samples, the dual-recognition FRET strategy showed recoveries from 99.00% to the 109.75% with relative standard derivations (RSDs) less than 4%. This establishes a universal detection platform for sensitive, specific, and simple pathogenic bacteria detection, which could have great impact in the fields of food/public safety monitoring and infectious disease diagnosis.

  2. Models of color confinement based on dual superconductors

    International Nuclear Information System (INIS)

    Ripka, Georges; Hosek, Jiri

    2003-01-01

    Recently, the relatively old speculation that the physical QCD vacuum might be a kind of dual superconductor, in which color-magnetic monopoles have condensed, seems to have received some 'experimental' confirmation in lattice calculations. The lattice calculations do not dictate, however, the form of the effective low-energy theory. And indeed, a rather wide panoply of possible effective theories has been proposed. The purpose of this talk is to review them in order to contrast their properties

  3. Modeling of dual cylinder wind-up extensional rheometers

    DEFF Research Database (Denmark)

    Yu, Kaijia; Marin, Jose; Jensen, Mette

    measurements are useful for polymer characterization. The Sentmanat extensional Rheometer[1] is an new testing platform for the study of polymers and elastomers in extensional flow. This technique employs a dual wind-up drum technique to perform an uni-axial extensional deformation during experiments......). *The title of this submission has been modified to remove the name of a commercial product or company to bring the title into compliance with SOR policy....

  4. Metamaterial Combining Electric- and Magnetic-Dipole-Based Configurations for Unique Dual-Band Signal Enhancement in Ultrahigh-Field Magnetic Resonance Imaging.

    Science.gov (United States)

    Schmidt, Rita; Webb, Andrew

    2017-10-11

    Magnetic resonance imaging and spectroscopy (MRI and MRS) are both widely used techniques in medical diagnostics and research. One of the major thrusts in recent years has been the introduction of ultrahigh-field magnets in order to boost the sensitivity. Several MRI studies have examined further potential improvements in sensitivity using metamaterials, focusing on single frequency applications. However, metamaterials have yet to reach a level that is practical for routine MRI use. In this work, we explore a new metamaterial implementation for MRI, a dual-nuclei resonant structure, which can be used for both proton and heteronuclear magnetic resonance. Our approach combines two configurations, one based on a set of electric dipoles for the low frequency band, and the second based on a set of magnetic dipoles for the high frequency band. We focus on the implementation of a dual-nuclei metamaterial for phosphorus and proton imaging and spectroscopy at an ultrahigh-field strength of 7 T. In vivo scans using this flexible and compact structure show that it locally enhances both the phosphorus and proton transmit and receive sensitivities.

  5. RECONSTRUCTION OF HUMAN LUNG MORPHOLOGY MODELS FROM MAGNETIC RESONANCE IMAGES

    Science.gov (United States)

    Reconstruction of Human Lung Morphology Models from Magnetic Resonance ImagesT. B. Martonen (Experimental Toxicology Division, U.S. EPA, Research Triangle Park, NC 27709) and K. K. Isaacs (School of Public Health, University of North Carolina, Chapel Hill, NC 27514)

  6. A non-static model for the Roper resonances

    International Nuclear Information System (INIS)

    Guichon, P.A.M.

    1985-07-01

    We solve the M.I.T. bag equations for Fermions in the limit of small fluctuations and quantize the solution. We get a non static bag model which provides a satisfactory interpretation of the Roper resonances if the time averaged radius of the cavitity is about 1 fm

  7. Modeling the full-bridge series-resonant power converter

    Science.gov (United States)

    King, R. J.; Stuart, T. A.

    1982-01-01

    A steady state model is derived for the full-bridge series-resonant power converter. Normalized parametric curves for various currents and voltages are then plotted versus the triggering angle of the switching devices. The calculations are compared with experimental measurements made on a 50 kHz converter and a discussion of certain operating problems is presented.

  8. In vivo magnetic resonance and fluorescence dual imaging of tumor sites by using dye-doped silica-coated iron oxide nanoparticles

    International Nuclear Information System (INIS)

    Jang, Haeyun; Lee, Chaedong; Nam, Gi-Eun; Quan, Bo; Choi, Hyuck Jae; Yoo, Jung Sun; Piao, Yuanzhe

    2016-01-01

    The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex ® with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.

  9. In vivo magnetic resonance and fluorescence dual imaging of tumor sites by using dye-doped silica-coated iron oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Jang, Haeyun; Lee, Chaedong [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Nam, Gi-Eun [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Quan, Bo [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Choi, Hyuck Jae [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Yoo, Jung Sun [Seoul National University, Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Smart Humanity Convergence Center (Korea, Republic of); Piao, Yuanzhe, E-mail: parkat9@snu.ac.kr [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of)

    2016-02-15

    The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex{sup ®} with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.

  10. A Dual-Process Model of the Alcohol-Behavior Link for Social Drinking

    Science.gov (United States)

    Moss, Antony C.; Albery, Ian P.

    2009-01-01

    A dual-process model of the alcohol-behavior link is presented, synthesizing 2 of the major social-cognitive approaches: expectancy and myopia theories. Substantial evidence has accrued to support both of these models, and recent neurocognitive models of the effects of alcohol on thought and behavior have provided evidence to support both as well.…

  11. Logical Reasoning versus Information Processing in the Dual-Strategy Model of Reasoning

    Science.gov (United States)

    Markovits, Henry; Brisson, Janie; de Chantal, Pier-Luc

    2017-01-01

    One of the major debates concerning the nature of inferential reasoning is between counterexample-based strategies such as mental model theory and statistical strategies underlying probabilistic models. The dual-strategy model, proposed by Verschueren, Schaeken, & d'Ydewalle (2005a, 2005b), which suggests that people might have access to both…

  12. The fusion rate in the transmission resonance model

    International Nuclear Information System (INIS)

    Jaendel, M.

    1992-01-01

    Resonant transmission of deuterons through a chain of target deuterons in a metal matrix has been suggested as an explanation for the cold fusion phenomena. In this paper the fusion rate in such transmission resonance models is estimated, and the basic physical constraints are discussed. The dominating contribution to the fusion yield is found to come from metastable states. The fusion rate is well described by the Wentzel-Kramer-Brillouin approximation and appears to be much too small to explain the experimental anomalies

  13. Parameter Identification for Nonlinear Circuit Models of Power BAW Resonator

    Directory of Open Access Journals (Sweden)

    CONSTANTINESCU, F.

    2011-02-01

    Full Text Available The large signal operation of the bulk acoustic wave (BAW resonators is characterized by the amplitude-frequency effect and the intermodulation effect. The measurement of these effects, together with that of the small signal frequency characteristic, are used in this paper for the parameter identification of the nonlinear circuit models developed previously by authors. As the resonator has been connected to the measurement bench by wire bonding, the parasitic elements of this connection have been taken into account, being estimated solving some electrical and magnetic field problems.

  14. Modelling Brain Tissue using Magnetic Resonance Imaging

    DEFF Research Database (Denmark)

    Dyrby, Tim Bjørn

    2008-01-01

    Diffusion MRI, or diffusion weighted imaging (DWI), is a technique that measures the restricted diffusion of water molecules within brain tissue. Different reconstruction methods quantify water-diffusion anisotropy in the intra- and extra-cellular spaces of the neural environment. Fibre tracking...... models then use the directions of greatest diffusion as estimates of white matter fibre orientation. Several fibre tracking algorithms have emerged in the last few years that provide reproducible visualizations of three-dimensional fibre bundles. One class of these algorithms is probabilistic...... the possibility of using high-field experimental MR scanners and long scanning times, thereby significantly improving the signal-to-noise ratio (SNR) and anatomical resolution. Moreover, many of the degrading effects observed in vivo, such as physiological noise, are no longer present. However, the post mortem...

  15. Induced dual EIT and EIA resonances with optical trapping phenomenon in near/far fields in the N-type four-level system

    Science.gov (United States)

    Osman, Kariman I.; Joshi, Amitabh

    2017-01-01

    The optical trapping phenomenon is investigated in the probe absorptive susceptibility spectra, during the interaction of four-level N-type atomic system with three transverse Gaussian fields, in a Doppler broadened medium. The system was studied under different temperature settings of 87Rb atomic vapor as well as different non-radiative decay rate. The system exhibits a combination of dual electromagnetically induced transparency with electromagnetically induced absorption (EIA) or transparency (EIT) resonances simultaneously in near/far field. Also, the optical trapping phenomenon is considerably affected by the non-radiative decay rate.

  16. Highly sensitive digital optical sensor with large measurement range based on the dual-microring resonator with waveguide-coupled feedback

    International Nuclear Information System (INIS)

    Xiang Xing-Ye; Wang Kui-Ru; Yuan Jin-Hui; Jin Bo-Yuan; Sang Xin-Zhu; Yu Chong-Xiu

    2014-01-01

    We propose a novel high-performance digital optical sensor based on the Mach—Zehnder interferential effect and the dual-microring resonators with the waveguide-coupled feedback. The simulation results show that the sensitivity of the sensor can be orders of magnitude higher than that of a conventional sensor, and high quality factor is not critical in it. Moreover, by optimizing the length of the feedback waveguide to be equal to the perimeter of the ring, the measurement range of the proposed sensor is twice as much as that of the conventional sensor in the weak coupling case

  17. A Dual Coding Theoretical Model of Decoding in Reading: Subsuming the LaBerge and Samuels Model

    Science.gov (United States)

    Sadoski, Mark; McTigue, Erin M.; Paivio, Allan

    2012-01-01

    In this article we present a detailed Dual Coding Theory (DCT) model of decoding. The DCT model reinterprets and subsumes The LaBerge and Samuels (1974) model of the reading process which has served well to account for decoding behaviors and the processes that underlie them. However, the LaBerge and Samuels model has had little to say about…

  18. Pricing Model for Dual Sales Channel with Promotion Effect Consideration

    Directory of Open Access Journals (Sweden)

    Chuiri Zhou

    2016-01-01

    Full Text Available We focus on the pricing strategy of a dual sales channel member when his/her online retailer faces an upcoming overloaded express delivery service due to the sales peak of online shopping, especially referring to the occurring affairs in China. We characterize the pricing problem of the dual selling channel system as a two-period game. When the price discount is only provided by the online seller, we find that the prices of the traditional channel and the online channel in the two periods are higher while the overloaded degree of express delivery is lower and the overloaded delivery services can decrease the profits of both channels. When the price discounts are provided by both traditional and online sellers, we find that the derived Nash price equilibrium of both channels includes five possible combinations of prices. Both traditional and online sellers will choose their price strategies, respectively, according to their cost advantages which are affected by the overloaded degree of express delivery.

  19. Resonances

    DEFF Research Database (Denmark)

    an impetus or drive to that account: change, innovation, rupture, or discontinuity. Resonances: Historical Essays on Continuity and Change explores the historiographical question of the modes of interrelation between these motifs in historical narratives. The essays in the collection attempt to realize...

  20. Beyond dual-process models: A categorisation of processes underlying intuitive judgement and decision making

    NARCIS (Netherlands)

    Glöckner, A.; Witteman, C.L.M.

    2010-01-01

    Intuitive-automatic processes are crucial for making judgements and decisions. The fascinating complexity of these processes has attracted many decision researchers, prompting them to start investigating intuition empirically and to develop numerous models. Dual-process models assume a clear

  1. The Dual-Factor Model of Mental Health: Further Study of the Determinants of Group Differences

    Science.gov (United States)

    Lyons, Michael D.; Huebner, E. Scott; Hills, Kimberly J.; Shinkareva, Svetlana V.

    2012-01-01

    Consistent with a positive psychology framework, this study examined the contributions of personality, environmental, and perceived social support variables in classifying adolescents using Greenspoon and Saklofske's Dual-Factor model of mental health. This model incorporates information about positive subjective well-being (SWB), along with…

  2. The dual pathway model of overeating. Replication and extension with actual food consumption

    NARCIS (Netherlands)

    Ouwens, M.A.; Strien, T. van; Leeuwe, J.F.J. van; Staak, C.P.F. van der

    2009-01-01

    van Strien et al. [van Strien, T., Engels, R. C. M. E., van Leeuwe, J., Snoek, H. M. (2005). The Stice model of overeating: tests in clinical and non-clinical samples. Appetite, 45, 205–213] extended the negative affect pathway of Stice's dual pathway model of overeating Stice [Stice, E. (1994).

  3. The dual pathway model of overeating. Replication and extension with actual food consumption

    NARCIS (Netherlands)

    Ouwens, Machteld A; van Strien, T; Leeuwe, J.F.J.; van der Staak, C P F

    van Strien et al. [van Strien, T., Engels, R. C. M. E., van Leeuwe, J., Snoek, H. M. (2005). The Stice model of overeating: tests in clinical and non-clinical samples. Appetite, 45, 205-213] extended the negative affect pathway of Stice's dual pathway model of overeating Stice [Stice, E. (1994).

  4. Dual-Extrusion 3D Printing of Anatomical Models for Education

    Science.gov (United States)

    Smith, Michelle L.; Jones, James F. X.

    2018-01-01

    Two material 3D printing is becoming increasingly popular, inexpensive and accessible. In this paper, freely available printable files and dual extrusion fused deposition modelling were combined to create a number of functional anatomical models. To represent muscle and bone FilaFlex[superscript 3D] flexible filament and polylactic acid (PLA)…

  5. A Dual-Stage Two-Phase Model of Selective Attention

    Science.gov (United States)

    Hubner, Ronald; Steinhauser, Marco; Lehle, Carola

    2010-01-01

    The dual-stage two-phase (DSTP) model is introduced as a formal and general model of selective attention that includes both an early and a late stage of stimulus selection. Whereas at the early stage information is selected by perceptual filters whose selectivity is relatively limited, at the late stage stimuli are selected more efficiently on a…

  6. Forward-backward correlations in pp interactions in a dual model

    International Nuclear Information System (INIS)

    Fialkowsky, K.; Kotanski, A.; Uniwersytet Jagiellonski, Krakow

    1982-01-01

    Forward-backward correlations in lepton and hadron induced processes are compared according to the dual model. It is indicated that the effect of the chain energy spread in hadron processes is important. After including this effect the model is shown to explain the forward-backward correlations in pp data assuming no dynamical correlations within a single chain. (orig.)

  7. Critical evaluation of analytical models for stochastic heating in dual-frequency capacitive discharges

    International Nuclear Information System (INIS)

    Sharma, S; Turner, M M

    2013-01-01

    Dual-frequency capacitive discharges are widespread in the semiconductor industry and are used, for example, in etching of semiconductor materials to manufacture microchips. In low-pressure dual radio-frequency capacitive discharges, stochastic heating is an important phenomenon. Recent theoretical work on this problem using several different approaches has produced results that are broadly in agreement insofar as scaling with the discharge parameters is concerned, but there remains some disagreement in detail concerning the absolute size of the effect for the case of dual-frequency capacitive discharges. In this work, we investigate the dependence of stochastic heating on various discharge parameters with the help of particle-in-cell (PIC) simulation. The dual-frequency analytical models are in fair agreement with PIC results for values of the low-frequency current density amplitude J lf (or dimensionless control parameter H lf ∼ 5) typical of many modern experiments. However, for higher values of J lf (or higher H lf ), new physical phenomena (like field reversal, reflection of ions, etc) appear and the simulation results deviate from existing dual-frequency analytical models. On the other hand, for lower J lf (or lower H lf ) again the simulation results deviate from analytical models. So this research work produces a relatively extensive set of simulation data that may be used to validate theories over a wide range of parameters. (paper)

  8. Dual-mode T_1 and T_2 magnetic resonance imaging contrast agent based on ultrasmall mixed gadolinium-dysprosium oxide nanoparticles: synthesis, characterization, and in vivo application

    International Nuclear Information System (INIS)

    Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong

    2015-01-01

    A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)

  9. New Higgs transitions between dual N=2 string models

    International Nuclear Information System (INIS)

    Berglund, P.; Katz, S.; Klemm, A.; Mayr, P.

    1997-01-01

    We describe a new kind of transition between topologically distinct N=2 type II Calabi-Yau vacua through points with enhanced non-abelian gauge symmetries together with fundamental charged matter hyper multiplets. We connect the appearance of matter to the local geometry of the singularity and discuss the relation between the instanton numbers of the Calabi-Yau manifolds taking part in the transition. In a dual heterotic string theory on K3 x T 2 the process corresponds to Higgsing a semi-classical gauge group or equivalently to a variation of the gauge bundle. In special cases the situation reduces to simple conifold transitions in the Coulomb phase of the non-abelian gauge symmetries. (orig.)

  10. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    Energy Technology Data Exchange (ETDEWEB)

    Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN, CH-1211 Geneva 23 (Switzerland); School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Fedorov, D. [Petersburg Nuclear Physics Institute, 188350 Gatchina (Russian Federation); Fedosseev, V.N.; Forster, L.; Marsh, B.A. [CERN, CH-1211 Geneva 23 (Switzerland); Rossel, R.E. [CERN, CH-1211 Geneva 23 (Switzerland); Institut für Physik, Johannes Gutenberg Universität, D-55099 Mainz (Germany); Faculty of Design, Computer Science and Media, Hochschule RheinMain, Wiesbaden (Germany); Rothe, S.; Veinhard, M. [CERN, CH-1211 Geneva 23 (Switzerland)

    2016-09-11

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  11. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    CERN Document Server

    Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

    2016-01-01

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  12. Conserved number fluctuations in a hadron resonance gas model

    International Nuclear Information System (INIS)

    Garg, P.; Mishra, D.K.; Netrakanti, P.K.; Mohanty, B.; Mohanty, A.K.; Singh, B.K.; Xu, N.

    2013-01-01

    Net-baryon, net-charge and net-strangeness number fluctuations in high energy heavy-ion collisions are discussed within the framework of a hadron resonance gas (HRG) model. Ratios of the conserved number susceptibilities calculated in HRG are being compared to the corresponding experimental measurements to extract information about the freeze-out condition and the phase structure of systems with strong interactions. We emphasize the importance of considering the actual experimental acceptances in terms of kinematics (pseudorapidity (η) and transverse momentum (p T )), the detected charge state, effect of collective motion of particles in the system and the resonance decay contributions before comparisons are made to the theoretical calculations. In this work, based on HRG model, we report that the net-baryon number fluctuations are least affected by experimental acceptances compared to the net-charge and net-strangeness number fluctuations

  13. The Droplet model of the Giant Fipole Resonance

    International Nuclear Information System (INIS)

    Myers, W.D.; Kodama, T.; El-Jaick, L.J.; Hilf, E.R.

    1976-10-01

    The nuclear Giant Dipole Resonance (GDR) energies are calculated using a macroscopic hydronamical model with two new features. The motion is treated as a combination of the usual Goldhaber-Teller (GT) and Steinwedel-Jensen (SJ) modes, and the restoring forces are all calculated using the Droplet Model. The A dependence of the resonance energies is well reproduced without any adjustable parameters, and the measured magnitude of the energies serves to fix the value of the effective mass m* used in the theory. The GDR is found to consist mainly of a GT-type motion with the SJ-mode becoming more important for heavy nuclei. The width P of the GDR is also estimated on the basis of an expression for one-body damping [pt

  14. The Dual Half-Edge—A Topological Primal/Dual Data Structure and Construction Operators for Modelling and Manipulating Cell Complexes

    Directory of Open Access Journals (Sweden)

    Pawel Boguslawski

    2016-02-01

    Full Text Available There is an increasing need for building models that permit interior navigation, e.g., for escape route analysis. This paper presents a non-manifold Computer-Aided Design (CAD data structure, the dual half-edge based on the Poincaré duality that expresses both the geometric representations of individual rooms and their topological relationships. Volumes and faces are expressed as vertices and edges respectively in the dual space, permitting a model just based on the storage of primal and dual vertices and edges. Attributes may be attached to all of these entities permitting, for example, shortest path queries between specified rooms, or to the exterior. Storage costs are shown to be comparable to other non-manifold models, and construction with local Euler-type operators is demonstrated with two large university buildings. This is intended to enhance current developments in 3D Geographic Information Systems for interior and exterior city modelling.

  15. Properties of quasi-elastic processes due to exchange of one dual pomeron

    International Nuclear Information System (INIS)

    Gedalin, Eh.V.; Gurvich, E.G.

    1975-01-01

    The asymptotic (at S tending to infinity) characteristics of four-particle amplitudes of diffraction scattering of resonance states in the dual-resonance model is considered in the lower order of the dual theory of perturbations. It is shown that for transverse transferred momentum K→0, at least for part of the spectrum of states of the dual resonance model - i.e. of the transverse states -, the scattering amplitudes are zero, except for the elastically scattered ones, which are all identical. (author)

  16. Smart Drug Delivery System-Inspired Enzyme-Linked Immunosorbent Assay Based on Fluorescence Resonance Energy Transfer and Allochroic Effect Induced Dual-Modal Colorimetric and Fluorescent Detection.

    Science.gov (United States)

    Miao, Luyang; Zhu, Chengzhou; Jiao, Lei; Li, He; Du, Dan; Lin, Yuehe; Wei, Qin

    2018-02-06

    Numerous analytical techniques have been undertaken for the detection of protein biomarkers because of their extensive and significant applications in clinical diagnosis, whereas there are few strategies to develop dual-readout immunosensors to achieve more accurate results. To the best of our knowledge, inspired by smart drug delivery system (DDS), a novel pH-responsive modified enzyme-linked immunosorbent assay (ELISA) was innovatively developed for the first time, realizing dual-modal colorimetric and fluorescent detection of cardiac troponin I (cTnI). Curcumin (CUR) was elaborately selected as a reporter molecule, which played the same role of drugs in DDS based on the following considerations: (1) CUR can be used as a kind of pH indicator by the inherited allochroic effect induced by basic pH value; (2) the fluorescence of CUR can be quenched by certain nanocarriers as the acceptor because of the occurrence of fluorescence resonance energy transfer (FRET), while recovered by the stimuli of basic pH value, which can produce "signal-on" fluorescence detection. Three-dimensional MoS 2 nanoflowers (3D-MoS 2 NFs) were employed in immobilizing CUR to constitute a nanoprobe for the determination of cTnI by virtue of good biocompatibility, high absorption capacity, and fluorescence quench efficiency toward CUR. The proposed DDS-inspired ELISA offered dual-modal colorimetric and fluorescent detection of cTnI, thereby meeting the reliable and precise analysis requirements. We believe that the developed dual-readout ELISA will create a new avenue and bring innovative inspirations for biological detections.

  17. Three-dimensional balanced steady state free precession myocardial perfusion cardiovascular magnetic resonance at 3T using dual-source parallel RF transmission: initial experience.

    Science.gov (United States)

    Jogiya, Roy; Schuster, Andreas; Zaman, Arshad; Motwani, Manish; Kouwenhoven, Marc; Nagel, Eike; Kozerke, Sebastian; Plein, Sven

    2014-11-28

    The purpose of this study was to establish the feasibility of three-dimensional (3D) balanced steady-state-free-precession (bSSFP) myocardial perfusion cardiovascular magnetic resonance (CMR) at 3T using local RF shimming with dual-source RF transmission, and to compare it with spoiled gradient echo (TGRE) acquisition. Dynamic contrast-enhanced 3D bSSFP perfusion imaging was performed on a 3T MRI scanner equipped with dual-source RF transmission technology. Images were reconstructed using k-space and time broad-use linear acquisition speed-up technique (k-t BLAST) and compartment based principle component analysis (k-t PCA). In phantoms and volunteers, local RF shimming with dual source RF transmission significantly improved B1 field homogeneity compared with single source transmission (P=0.01). 3D bSSFP showed improved signal-to-noise, contrast-to-noise and signal homogeneity compared with 3D TGRE (29.8 vs 26.9, P=0.045; 23.2 vs 21.6, P=0.049; 14.9% vs 12.4%, p=0.002, respectively). Image quality was similar between bSSFP and TGRE but there were more dark rim artefacts with bSSFP. k-t PCA reconstruction reduced artefacts for both sequences compared with k-t BLAST. In a subset of five patients, both methods correctly identified those with coronary artery disease. Three-dimensional bSSFP myocardial perfusion CMR using local RF shimming with dual source parallel RF transmission at 3T is feasible and improves signal characteristics compared with TGRE. Image artefact remains an important limitation of bSSFP imaging at 3T but can be reduced with k-t PCA.

  18. Modeling laser brightness from cross Porro prism resonators

    Science.gov (United States)

    Forbes, Andrew; Burger, Liesl; Litvin, Igor Anatolievich

    2006-08-01

    Laser brightness is a parameter often used to compare high power laser beam delivery from various sources, and incorporates both the power contained in the particular mode, as well as the propagation of that mode through the beam quality factor, M2. In this study a cross Porro prism resonator is considered; crossed Porro prism resonators have been known for some time, but until recently have not been modeled as a complete physical optics system that allows the modal output to be determined as a function of the rotation angle of the prisms. In this paper we consider the diffraction losses as a function of the prism rotation angle relative to one another, and combine this with the propagation of the specific modes to determine the laser output brightness as a function of the prism orientation.

  19. Statistical Modelling of Resonant Cross Section Structure in URR, Model of the Characteristic Function

    International Nuclear Information System (INIS)

    Koyumdjieva, N.

    2006-01-01

    A statistical model for the resonant cross section structure in the Unresolved Resonance Region has been developed in the framework of the R-matrix formalism in Reich Moore approach with effective accounting of the resonance parameters fluctuations. The model uses only the average resonance parameters and can be effectively applied for analyses of cross sections functional, averaged over many resonances. Those are cross section moments, transmission and self-indication functions measured through thick sample. In this statistical model the resonant cross sections structure is accepted to be periodic and the R-matrix is a function of ε=E/D with period 0≤ε≤N; R nc (ε)=π/2√(S n *S c )1/NΣ(i=1,N)(β in *β ic *ctg[π(ε i - = ε-iS i )/N]; Here S n ,S c ,S i is respectively neutron strength function, strength function for fission or inelastic channel and strength function for radiative capture, N is the number of resonances (ε i ,β i ) that obey the statistic of Porter-Thomas and Wigner's one. The simple case of this statistical model concerns the resonant cross section structure for non-fissile nuclei under the threshold for inelastic scattering - the model of the characteristic function with HARFOR program. In the above model some improvements of calculation of the phases and logarithmic derivatives of neutron channels have been done. In the parameterization we use the free parameter R l ∞ , which accounts the influence of long-distant resonances. The above scheme for statistical modelling of the resonant cross section structure has been applied for evaluation of experimental data for total, capture and inelastic cross sections for 232 Th in the URR (4-150) keV and also the transmission and self-indication functions in (4-175) keV. The set of evaluated average resonance parameters have been obtained. The evaluated average resonance parameters in the URR are consistent with those in the Resolved Resonance Region (CRP for Th-U cycle, Vienna, 2006

  20. Exchange mechanisms for single photo- and electroproduction using the dual fermion model

    International Nuclear Information System (INIS)

    Becker, L.; Weigt, G.

    1976-01-01

    Single pion real and virtual photoproduction data are compared with phenomenological dual fermion amplitudes, which were previously applied to quasi-two body vector and tensor meson production. The similar structures of the photon and the corresponding vector meson data (in the s-channel helicity system) such as spikes and dips, usually described by Regge pole/Regge cut interferences, are reproduced by the dual Born amplitudes. Predictions of the model for the differential cross sections, in particular their parts for natural and unnatural spin-parity t-channel exchanges as well as their mass dependence, and photon and target asymmetries are in reasonable agreement with the experimental data. (author)

  1. Rural-urban migration: policy simulations in a dual economy model of Bangladesh.

    Science.gov (United States)

    Ahmed, S

    1986-03-01

    The process of rural-urban migration in Bangladesh is analyzed using a dual economy model. The focus is on the period 1976-1985. The main purpose of the paper is to examine alternative policies designed to reduce the level of such migration without adversely affecting the country's economy.

  2. Description of inelastic nucleus-nucleus interactions at medium energy using dual parton model

    International Nuclear Information System (INIS)

    Polanski, A.; Shmakov, S.Yu.; Uzhinskij, V.V.

    1989-01-01

    It is shown that the dual parton model taking into account the processes of diffraction dissociation to the low mass states and finite energy corrections to the asymptotic Abramovski-Gribov-Kancheli cutting rules allows satisfactory description of existing experimental data on hadron-nucleus and nucleus-nucleus interactions at medium energy. (orig.)

  3. Acting in solidarity : Testing an extended dual pathway model of collective action by bystander group members

    NARCIS (Netherlands)

    Saab, Rim; Tausch, Nicole; Spears, Russell; Cheung, Wing-Yee

    We examined predictors of collective action among bystander group members in solidarity with a disadvantaged group by extending the dual pathway model of collective action, which proposes one efficacy-based and one emotion-based path to collective action (Van Zomeren, Spears, Fischer, & Leach,

  4. A Dual Process Motivational Model of Ambivalent Sexism and Gender Differences in Romantic Partner Preferences

    Science.gov (United States)

    Sibley, Chris G.; Overall, Nickola C.

    2011-01-01

    We tested a dual process motivational model of ambivalent sexism and gender differences in intimate partner preferences. Meta-analysis of 32 samples (16 with men, 16 with women; N = 5,459) indicated that Benevolent Sexism (BS) in women was associated with greater preferences for high-resource partners (r = 0.24), whereas Hostile Sexism (HS) in men…

  5. Personality and creativity : The dual pathway to creativity model and a research agenda

    NARCIS (Netherlands)

    Baas, Matthijs; Roskes, Marieke; Sligte, Daniel; Nijstad, Bernard A.; De Dreu, Carsten K W

    2013-01-01

    To better understand the relation between personality traits and creativity, we invoke the Dual-Pathway to Creativity model (DPCM) that identifies two pathways to creative outcomes: (1) flexible processing of information (cognitive flexibility) and (2) persistent probing, and systematically and

  6. Elaborations on the Socioegocentric and Dual-Level Connectionist Models of Group Interaction Processes

    Science.gov (United States)

    Hewes, Dean E.

    2009-01-01

    The purpose of the author's contribution to this colloquy was to spark conversation on the theoretical nature of communication processes and the evidentiary requirements for testing their relationship to group outcomes. Co-discussants have raised important issues concerning the philosophical basis of the socioegocentric model (SM) and dual-level…

  7. Protesters as "passionate economists" : A dynamic dual pathway model of approach coping with collective disadvantage

    NARCIS (Netherlands)

    van Zomeren, Martijn; Leach, Colin Wayne; Spears, Russell

    To explain the psychology behind individuals' motivation to participate in collective action against collective disadvantage (e.g., protest marches), the authors introduce a dynamic dual pathway model of approach coping that integrates many common explanations of collective action (i.e., group

  8. On a relation between massive Yang-Mills theories and dual string models

    International Nuclear Information System (INIS)

    Mickelsson, J.

    1983-01-01

    The relations between mass terms in Yang-Mills theories, projective representations of the group of gauge transformations, boundary conditions on vector potentials and Schwinger terms in local charge algebra commutation relations are discussed. The commutation relations (with Schwinger terms) are similar to the current algebra commutation relations of the SU(N) extended dual string model. (orig.)

  9. The dual pathway to creativity model: creative ideation as a function of flexibility and persistence

    NARCIS (Netherlands)

    Nijstad, B.A.; de Dreu, C.K.W.; Rietzschel, E.F.; Baas, M.

    2010-01-01

    The dual pathway to creativity model argues that creativity—the generation of original and appropriate ideas—is a function of cognitive flexibility and cognitive persistence, and that dispositional or situational variables may influence creativity either through their effects on flexibility, on

  10. The dual pathway to creativity model : Creative ideation as a function of flexibility and persistence

    NARCIS (Netherlands)

    Nijstad, B.A.; De Dreu, C.K.W.; Rietzschel, E.F.; Baas, M.

    2010-01-01

    The dual pathway to creativity model argues that creativity-the generation of original and appropriate ideas-is a function of cognitive flexibility and cognitive persistence, and that dispositional or situational variables may influence creativity either through their effects on flexibility, on

  11. An effective streamflow process model for optimal reservoir operation using stochastic dual dynamic programming

    OpenAIRE

    Raso , L.; Malaterre , P.O.; Bader , J.C.

    2017-01-01

    International audience; This article presents an innovative streamflow process model for use in reservoir operational rule design in stochastic dual dynamic programming (SDDP). Model features, which can be applied independently, are (1) a multiplicative process model for the forward phase and its linearized version for the backward phase; and (2) a nonuniform time-step length that is inversely proportional to seasonal variability. The advantages are (1) guaranteeing positive streamflow values...

  12. Dual lattice representations for O(N and CP(N−1 models with a chemical potential

    Directory of Open Access Journals (Sweden)

    Falk Bruckmann

    2015-10-01

    Full Text Available We derive dual representations for O(N and CP(N−1 models on the lattice. In terms of the dual variables the partition sums have only real and positive contributions also at finite chemical potential. Thus the complex action problem of the conventional formulation is overcome and using the dual variables Monte Carlo simulations are possible at arbitrary chemical potential.

  13. Rectifier Current Control for an LLC Resonant Converter Based on a Simplified Linearized Model

    OpenAIRE

    Zhijian Fang; Junhua Wang; Shanxu Duan; Liangle Xiao; Guozheng Hu; Qisheng Liu

    2018-01-01

    In this paper, a rectifier current control for an LLC resonant converter is proposed, based on a simplified, two-order, linearized model that adds a rectifier current feedback inner loop to improve dynamic performance. Compared to the traditional large-signal model with seven resonant states, this paper utilizes a rectifier current state to represent the characteristics of the resonant states, simplifying the LLC resonant model from seven orders to two orders. Then, the rectifier current feed...

  14. Phase-field modeling of corrosion kinetics under dual-oxidants

    Science.gov (United States)

    Wen, You-Hai; Chen, Long-Qing; Hawk, Jeffrey A.

    2012-04-01

    A phase-field model is proposed to simulate corrosion kinetics under a dual-oxidant atmosphere. It will be demonstrated that the model can be applied to simulate corrosion kinetics under oxidation, sulfidation and simultaneous oxidation/sulfidation processes. Phase-dependent diffusivities are incorporated in a natural manner and allow more realistic modeling as the diffusivities usually differ by many orders of magnitude in different phases. Simple free energy models are then used for testing the model while calibrated free energy models can be implemented for quantitative modeling.

  15. Perceiving pain in others: validation of a dual processing model.

    Science.gov (United States)

    McCrystal, Kalie N; Craig, Kenneth D; Versloot, Judith; Fashler, Samantha R; Jones, Daniel N

    2011-05-01

    Accurate perception of another person's painful distress would appear to be accomplished through sensitivity to both automatic (unintentional, reflexive) and controlled (intentional, purposive) behavioural expression. We examined whether observers would construe diverse behavioural cues as falling within these domains, consistent with cognitive neuroscience findings describing activation of both automatic and controlled neuroregulatory processes. Using online survey methodology, 308 research participants rated behavioural cues as "goal directed vs. non-goal directed," "conscious vs. unconscious," "uncontrolled vs. controlled," "fast vs. slow," "intentional (deliberate) vs. unintentional," "stimulus driven (obligatory) vs. self driven," and "requiring contemplation vs. not requiring contemplation." The behavioural cues were the 39 items provided by the PROMIS pain behaviour bank, constructed to be representative of the diverse possibilities for pain expression. Inter-item correlations among rating scales provided evidence of sufficient internal consistency justifying a single score on an automatic/controlled dimension (excluding the inconsistent fast vs. slow scale). An initial exploratory factor analysis on 151 participant data sets yielded factors consistent with "controlled" and "automatic" actions, as well as behaviours characterized as "ambiguous." A confirmatory factor analysis using the remaining 151 data sets replicated EFA findings, supporting theoretical predictions that observers would distinguish immediate, reflexive, and spontaneous reactions (primarily facial expression and paralinguistic features of speech) from purposeful and controlled expression (verbal behaviour, instrumental behaviour requiring ongoing, integrated responses). There are implicit dispositions to organize cues signaling pain in others into the well-defined categories predicted by dual process theory. Copyright © 2011 International Association for the Study of Pain. Published by

  16. DUAL STATE-PARAMETER UPDATING SCHEME ON A CONCEPTUAL HYDROLOGIC MODEL USING SEQUENTIAL MONTE CARLO FILTERS

    Science.gov (United States)

    Noh, Seong Jin; Tachikawa, Yasuto; Shiiba, Michiharu; Kim, Sunmin

    Applications of data assimilation techniques have been widely used to improve upon the predictability of hydrologic modeling. Among various data assimilation techniques, sequential Monte Carlo (SMC) filters, known as "particle filters" provide the capability to handle non-linear and non-Gaussian state-space models. This paper proposes a dual state-parameter updating scheme (DUS) based on SMC methods to estimate both state and parameter variables of a hydrologic model. We introduce a kernel smoothing method for the robust estimation of uncertain model parameters in the DUS. The applicability of the dual updating scheme is illustrated using the implementation of the storage function model on a middle-sized Japanese catchment. We also compare performance results of DUS combined with various SMC methods, such as SIR, ASIR and RPF.

  17. Vertically-Integrated Dual-Continuum Models for CO2 Injection in Fractured Aquifers

    Science.gov (United States)

    Tao, Y.; Guo, B.; Bandilla, K.; Celia, M. A.

    2017-12-01

    Injection of CO2 into a saline aquifer leads to a two-phase flow system, with supercritical CO2 and brine being the two fluid phases. Various modeling approaches, including fully three-dimensional (3D) models and vertical-equilibrium (VE) models, have been used to study the system. Almost all of that work has focused on unfractured formations. 3D models solve the governing equations in three dimensions and are applicable to generic geological formations. VE models assume rapid and complete buoyant segregation of the two fluid phases, resulting in vertical pressure equilibrium and allowing integration of the governing equations in the vertical dimension. This reduction in dimensionality makes VE models computationally more efficient, but the associated assumptions restrict the applicability of VE model to formations with moderate to high permeability. In this presentation, we extend the VE and 3D models for CO2 injection in fractured aquifers. This is done in the context of dual-continuum modeling, where the fractured formation is modeled as an overlap of two continuous domains, one representing the fractures and the other representing the rock matrix. Both domains are treated as porous media continua and can be modeled by either a VE or a 3D formulation. The transfer of fluid mass between rock matrix and fractures is represented by a mass transfer function connecting the two domains. We have developed a computational model that combines the VE and 3D models, where we use the VE model in the fractures, which typically have high permeability, and the 3D model in the less permeable rock matrix. A new mass transfer function is derived, which couples the VE and 3D models. The coupled VE-3D model can simulate CO2 injection and migration in fractured aquifers. Results from this model compare well with a full-3D model in which both the fractures and rock matrix are modeled with 3D models, with the hybrid VE-3D model having significantly reduced computational cost. In

  18. The effect of inclusion of inlets in dual drainage modelling

    Science.gov (United States)

    Chang, Tsang-Jung; Wang, Chia-Ho; Chen, Albert S.; Djordjević, Slobodan

    2018-04-01

    In coupled sewer and surface flood modelling approaches, the flow process in gullies is often ignored although the overland flow is drained to sewer network via inlets and gullies. Therefore, the flow entering inlets is transferred to the sewer network immediately, which may lead to a different flood estimation than the reality. In this paper, we compared two modelling approach with and without considering the flow processes in gullies in the coupled sewer and surface modelling. Three historical flood events were adopted for model calibration and validation. The results showed that the inclusion of flow process in gullies can further improve the accuracy of urban flood modelling.

  19. An integrated treatment model for dual diagnosis of psychosis and addiction.

    Science.gov (United States)

    Minkoff, K

    1989-10-01

    A model that integrates the treatment of patients with a dual diagnosis of psychosis and addiction has been developed on a general hospital psychiatric unit. The model emphasizes the parallels between the standard biopsychosocial illness-and-rehabilitation model for treatment of serious psychiatric disorders and the 12-step disease-and-recovery model of Alcoholics Anonymous for treatment of addiction. Dual-diagnosis patients are viewed as having two primary, chronic, biologic mental illnesses, each requiring specific treatment to stabilize acute symptoms and engage the patient in a recovery process. An integrated treatment program is described, as are the steps taken to alleviate psychiatric clinicians' concerns about patient involvement in AA and addiction clinicians' discomfort with patients' use of medication.

  20. Model of the transverse modes of stable and unstable porro–prism resonators using symmetry considerations

    CSIR Research Space (South Africa)

    Burger, L

    2007-01-01

    Full Text Available of this type of resonator. Further use of the model reveals the formation of more complex beam patterns, and the nature of these patterns is investigated. Also, the output of stable and unstable resonator modes is presented....

  1. Modelling of optoelectronic circuits based on resonant tunneling diodes

    Science.gov (United States)

    Rei, João. F. M.; Foot, James A.; Rodrigues, Gil C.; Figueiredo, José M. L.

    2017-08-01

    Resonant tunneling diodes (RTDs) are the fastest pure electronic semiconductor devices at room temperature. When integrated with optoelectronic devices they can give rise to new devices with novel functionalities due to their highly nonlinear properties and electrical gain, with potential applications in future ultra-wide-band communication systems (see e.g. EU H2020 iBROW Project). The recent coverage on these devices led to the need to have appropriated simulation tools. In this work, we present RTD based optoelectronic circuits simulation packages to provide circuit signal level analysis such as transient and frequency responses. We will present and discuss the models, and evaluate the simulation packages.

  2. Parton recombination model including resonance production. RL-78-040

    International Nuclear Information System (INIS)

    Roberts, R.G.; Hwa, R.C.; Matsuda, S.

    1978-05-01

    Possible effects of resonance production on the meson inclusive distribution in the fragmentation region are investigated in the framework of the parton recombination model. From a detailed study of the data on vector-meson production, a reliable ratio of the vector-to-pseudoscalar rates is determined. Then the influence of the decay of the vector mesons on the pseudoscalar spectrum is examined, and the effect found to be no more than 25% for x > 0.5. The normalization of the non-strange antiquark distributions are still higher than those in a quiescent proton. The agreement between the calculated results and data remain very good. 36 references

  3. Modelling of Resonantly Forced Density Waves in Dense Planetary Rings

    Science.gov (United States)

    Lehmann, M.; Schmidt, J.; Salo, H.

    2014-04-01

    Density wave theory, originally proposed to explain the spiral structure of galactic disks, has been applied to explain parts of the complex sub-structure in Saturn's rings, such as the wavetrains excited at the inner Lindblad resonances (ILR) of various satellites. The linear theory for the excitation and damping of density waves in Saturn's rings is fairly well developed (e.g. Goldreich & Tremaine [1979]; Shu [1984]). However, it fails to describe certain aspects of the observed waves. The non-applicability of the linear theory is already indicated by the "cusplike" shape of many of the observed wave profiles. This is a typical nonlinear feature which is also present in overstability wavetrains (Schmidt & Salo [2003]; Latter & Ogilvie [2010]). In particular, it turns out that the detailed damping mechanism, as well as the role of different nonlinear effects on the propagation of density waves remain intransparent. First attemps are being made to investigate the excitation and propagation of nonlinear density waves within a hydrodynamical formalism, which is also the natural formalism for describing linear density waves. A simple weakly nonlinear model, derived from a multiple-scale expansion of the hydrodynamic equations, is presented. This model describes the damping of "free" spiral density waves in a vertically integrated fluid disk with density dependent transport coefficients, where the effects of the hydrodynamic nonlinearities are included. The model predicts that density waves are linearly unstable in a ring region where the conditions for viscous overstability are met, which translates to a steep dependence of the shear viscosity with respect to the disk's surface density. The possibility that this dependence could lead to a growth of density waves with increasing distance from the resonance, was already mentioned in Goldreich & Tremaine [1978]. Sufficiently far away from the ILR, the surface density perturbation caused by the wave, is predicted to

  4. Parton recombination model including resonance production. RL-78-040

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, R. G.; Hwa, R. C.; Matsuda, S.

    1978-05-01

    Possible effects of resonance production on the meson inclusive distribution in the fragmentation region are investigated in the framework of the parton recombination model. From a detailed study of the data on vector-meson production, a reliable ratio of the vector-to-pseudoscalar rates is determined. Then the influence of the decay of the vector mesons on the pseudoscalar spectrum is examined, and the effect found to be no more than 25% for x > 0.5. The normalization of the non-strange antiquark distributions are still higher than those in a quiescent proton. The agreement between the calculated results and data remain very good. 36 references.

  5. Dual Education: The Win-Win Model of Collaboration between Universities and Industry

    Directory of Open Access Journals (Sweden)

    Monika Pogatsnik

    2018-05-01

    Full Text Available The purpose of this paper is to describe the new experiences of the dual training model in engineering education in Hungary. This new model has been introduced recently in the higher education and has become a focus of interest. This is a fa-vorable program for the students to experience the real industry environment pri-or to graduation and it is a good tool to motivate them to study harder. The dual education students study in the institutional academic period together with the regular full-time students at their higher education institute, and parallel to their academic education they participate in the practical training. It gives the students an opportunity to join a specific training program at an enterprise. Being involved in specific "operational" practical tasks and project-oriented work enhances inde-pendent work, learning soft skills and experiencing the culture of work. Our ob-jectives are to analyze the benefits of the dual training for all three parties: the stu-dent, the company and university. The study confirms earlier results from prior studies which show, for example, that students who choose the dual option achieve better program outcomes.

  6. Prediction of appendicular skeletal and fat mass in children: excellent concordance of dual-energy X-ray absorptiometry and magnetic resonance imaging.

    Science.gov (United States)

    Bridge, Pascale; Pocock, Nicholas A; Nguyen, Tuan; Munns, Craig; Cowell, Christopher T; Thompson, Martin W

    2009-09-01

    Body composition studies in children have great potential to help understand the aetiology and evolution of acute and chronic. diseases. To validate appendicular lean soft tissue mass (LSTM) and fat mass (FM) measured using dual energy X-ray absorptiometry (DXA), with magnetic resonance imaging (MRI) as the reference standard, in healthy peri-pubertal adolescents. Peri-pubertal Caucasian children (n = 74) aged 11-14 years were evaluated. DXA LSTM and FM of the mid third femur were measured and skeletal muscle mass (SM) and FM of the same region were measured on the same day by MRI. There was a strong correlation between MRI SM and DXA LSTM (r2 = 0.98, index of concordance [C] = 0.91). DXA estimation of LSTM exceeded MRI SM by a mean of 189 g, from 6-371 g (p LSTM measurement in children, confirming its potential in clinical and research roles in paediatric diseases affecting and related to body composition.

  7. Incorporation of flow injection analysis with dual-wavelength overlapping resonance Rayleigh scattering for rapid determination of malachite green and its metabolite in fish.

    Science.gov (United States)

    Zhu, Jinghui; Qin, Mingyou; Liu, Shaopu; Liu, Zhongfang; Yang, Jidong; Hu, Xiaoli

    2014-09-15

    A flow injection analysis (FIA) system combined with dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) has been established and validated for rapid determination of malachite green (MG) and its metabolite in fish samples. Under experimental condition, MG would react with Erythrosin (Ery) to form ion-association complexes, resulting in the occurrence of two RRS peaks and a dramatic enhancement of RRS intensity. The maximum RRS peaks were located at 286 nm and 337 nm. It is noted that the increments of both of these two peaks were proportional to the concentration of MG. The detection limit of DWO-RRS was 1.5 ng/mL, which was comparable to several reported methods. Moreover, the results of real sample analysis exhibited an acceptable recovery between 97.5% and 103.6%, indicating that the method had good reproducibility. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Multiple Model Adaptive Control Using Dual Youla-Kucera Factorisation

    DEFF Research Database (Denmark)

    Bendtsen, Jan Dimon; Trangbæk, Klaus

    2012-01-01

    We propose a multi-model adaptive control scheme for uncertain linear plants based on the concept of model unfalsification. The approach relies on examining the ability of a pre-computed set of plant-controller candidates and choosing the one that is best able to reproduce observed in- and output...

  9. Stochastic resonance in a generalized Von Foerster population growth model

    Energy Technology Data Exchange (ETDEWEB)

    Lumi, N.; Mankin, R. [Institute of Mathematics and Natural Sciences, Tallinn University, 25 Narva Road, 10120 Tallinn (Estonia)

    2014-11-12

    The stochastic dynamics of a population growth model, similar to the Von Foerster model for human population, is studied. The influence of fluctuating environment on the carrying capacity is modeled as a multiplicative dichotomous noise. It is established that an interplay between nonlinearity and environmental fluctuations can cause single unidirectional discontinuous transitions of the mean population size versus the noise amplitude, i.e., an increase of noise amplitude can induce a jump from a state with a moderate number of individuals to that with a very large number, while by decreasing the noise amplitude an opposite transition cannot be effected. An analytical expression of the mean escape time for such transitions is found. Particularly, it is shown that the mean transition time exhibits a strong minimum at intermediate values of noise correlation time, i.e., the phenomenon of stochastic resonance occurs. Applications of the results in ecology are also discussed.

  10. Self-dual form of Ruijsenaars–Schneider models and ILW equation with discrete Laplacian

    Directory of Open Access Journals (Sweden)

    A. Zabrodin

    2018-02-01

    Full Text Available We discuss a self-dual form or the Bäcklund transformations for the continuous (in time variable glN Ruijsenaars–Schneider model. It is based on the first order equations in N+M complex variables which include N positions of particles and M dual variables. The latter satisfy equations of motion of the glM Ruijsenaars–Schneider model. In the elliptic case it holds M=N while for the rational and trigonometric models M is not necessarily equal to N. Our consideration is similar to the previously obtained results for the Calogero–Moser models which are recovered in the non-relativistic limit. We also show that the self-dual description of the Ruijsenaars–Schneider models can be derived from complexified intermediate long wave equation with discrete Laplacian by means of the simple pole ansatz likewise the Calogero–Moser models arise from ordinary intermediate long wave and Benjamin–Ono equations.

  11. Theoretical Model of Professional Competence Development in Dual-Specialty Students (On the Example of the "History, Religious Studies" Specialty)

    Science.gov (United States)

    Karimova, A. E.; Amanova, A. S.; Sadykova, A. M.; Kuzembaev, N. E.; Makisheva, A. T.; Kurmangazina, G. Zh.; Sakenov, Janat

    2016-01-01

    The article explores the significant problem of developing a theoretical model of professional competence development in dual-specialty students (on the example of the "History, Religious studies" specialty). In order to validate the specifics of the professional competence development in dual-specialty students (on the example of the…

  12. Multicolor Upconversion Nanoprobes Based on a Dual Luminescence Resonance Energy Transfer Assay for Simultaneous Detection and Bioimaging of [Ca2+ ]i and pHi in Living Cells.

    Science.gov (United States)

    Song, Xinyue; Yue, Zihong; Zhang, Jiayu; Jiang, Yanxialei; Wang, Zonghua; Zhang, Shusheng

    2018-04-25

    Intracellular [Ca 2+ ] i and pH i have a close relationship, and their abnormal levels can result in cell dysfunction and accompanying diseases. Thus, simultaneous determination of [Ca 2+ ] i and pH i can more accurately investigate complex biological processes in an integrated platform. Herein, multicolor upconversion nanoparticles (UCNPs) were prepared with the advantages of no spectral overlapping, single NIR excitation wavelengths, and greater tissue penetration depth. The upconversion nanoprobes were easily prepared by the attachment of two fluorescent dyes, Fluo-4 and SNARF-4F. Based on the dual luminescence resonance energy transfer (LRET) process, the blue and green fluorescence of the UCNPs were specially quenched and selectively recovered after the detachment and/or absorbance change of the attached fluorescent dyes, enabling dual detection. Importantly, the developed nanoprobe could successfully be applied for the detection of [Ca 2+ ] i and pH i change in adenosine triphosphate (ATP) and ethylene glycol tetraacetic acid (EGTA) stimulation in living cells. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Cy5.5 conjugated MnO nanoparticles for magnetic resonance/near-infrared fluorescence dual-modal imaging of brain gliomas.

    Science.gov (United States)

    Chen, Ning; Shao, Chen; Li, Shuai; Wang, Zihao; Qu, Yanming; Gu, Wei; Yu, Chunjiang; Ye, Ling

    2015-11-01

    The fusion of molecular and anatomical modalities facilitates more reliable and accurate detection of tumors. Herein, we prepared the PEG-Cy5.5 conjugated MnO nanoparticles (MnO-PEG-Cy5.5 NPs) with magnetic resonance (MR) and near-infrared fluorescence (NIRF) imaging modalities. The applicability of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe for the detection of brain gliomas was investigated. In vivo MR contrast enhancement of the MnO-PEG-Cy5.5 nanoprobe in the tumor region was demonstrated. Meanwhile, whole-body NIRF imaging of glioma bearing nude mouse exhibited distinct tumor localization upon injection of MnO-PEG-Cy5.5 NPs. Moreover, ex vivo CLSM imaging of the brain slice hosting glioma indicated the preferential accumulation of MnO-PEG-Cy5.5 NPs in the glioma region. Our results therefore demonstrated the potential of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe in improving the diagnostic efficacy by simultaneously providing anatomical information from deep inside the body and more sensitive information at the cellular level. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. 1,3-Bis(2-chloroethyl)-1-nitrosourea-loaded bovine serum albumin nanoparticles with dual magnetic resonance-fluorescence imaging for tracking of chemotherapeutic agents.

    Science.gov (United States)

    Wei, Kuo-Chen; Lin, Feng-Wei; Huang, Chiung-Yin; Ma, Chen-Chi M; Chen, Ju-Yu; Feng, Li-Ying; Yang, Hung-Wei

    To date, knowing how to identify the location of chemotherapeutic agents in the human body after injection is still a challenge. Therefore, it is urgent to develop a drug delivery system with molecular imaging tracking ability to accurately understand the distribution, location, and concentration of a drug in living organisms. In this study, we developed bovine serum albumin (BSA)-based nanoparticles (NPs) with dual magnetic resonance (MR) and fluorescence imaging modalities (fluorescein isothiocyanate [FITC]-BSA-Gd/1,3-bis(2-chloroethyl)-1-nitrosourea [BCNU] NPs) to deliver BCNU for inhibition of brain tumor cells (MBR 261-2). These BSA-based NPs are water dispersible, stable, and biocompatible as confirmed by XTT cell viability assay. In vitro phantoms and in vivo MR and fluorescence imaging experiments show that the developed FITC-BSA-Gd/BCNU NPs enable dual MR and fluorescence imaging for monitoring cellular uptake and distribution in tumors. The T1 relaxivity (R1) of FITC-BSA-Gd/BCNU NPs was 3.25 mM(-1) s(-1), which was similar to that of the commercial T1 contrast agent (R1 =3.36 mM(-1) s(-1)). The results indicate that this multifunctional drug delivery system has potential bioimaging tracking of chemotherapeutic agents ability in vitro and in vivo for cancer therapy.

  15. In Vivo Dual-Modality Fluorescence and Magnetic Resonance Imaging-Guided Lymph Node Mapping with Good Biocompatibility Manganese Oxide Nanoparticles

    Directory of Open Access Journals (Sweden)

    Yonghua Zhan

    2017-12-01

    Full Text Available Multifunctional manganese oxide nanoparticles (NPs with impressive enhanced T1 contrast ability show great promise in biomedical diagnosis. Herein, we developed a dual-modality imaging agent system based on polyethylene glycol (PEG-coated manganese oxide NPs conjugated with organic dye (Cy7.5, which functions as a fluorescence imaging (FI agent as well as a magnetic resonance imaging (MRI imaging agent. The formed Mn3O4@PEG-Cy7.5 NPs with the size of ~10 nm exhibit good colloidal stability in different physiological media. Serial FI and MRI studies that non-invasively assessed the bio-distribution pattern and the feasibility for in vivo dual-modality imaging-guided lymph node mapping have been investigated. In addition, histological and biochemical analyses exhibited low toxicity even at a dose of 20 mg/kg in vivo. Since Mn3O4@PEG-Cy7.5 NPs exhibited desirable properties as imaging agents and good biocompatibility, this work offers a robust, safe, and accurate diagnostic platform based on manganese oxide NPs for tumor metastasis diagnosis.

  16. Interacting hadron resonance gas model in the K -matrix formalism

    Science.gov (United States)

    Dash, Ashutosh; Samanta, Subhasis; Mohanty, Bedangadas

    2018-05-01

    An extension of hadron resonance gas (HRG) model is constructed to include interactions using relativistic virial expansion of partition function. The noninteracting part of the expansion contains all the stable baryons and mesons and the interacting part contains all the higher mass resonances which decay into two stable hadrons. The virial coefficients are related to the phase shifts which are calculated using K -matrix formalism in the present work. We have calculated various thermodynamics quantities like pressure, energy density, and entropy density of the system. A comparison of thermodynamic quantities with noninteracting HRG model, calculated using the same number of hadrons, shows that the results of the above formalism are larger. A good agreement between equation of state calculated in K -matrix formalism and lattice QCD simulations is observed. Specifically, the lattice QCD calculated interaction measure is well described in our formalism. We have also calculated second-order fluctuations and correlations of conserved charges in K -matrix formalism. We observe a good agreement of second-order fluctuations and baryon-strangeness correlation with lattice data below the crossover temperature.

  17. Self-dual configurations in Abelian Higgs models with k-generalized gauge field dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Casana, R.; Cavalcante, A. [Departamento de Física, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil); Hora, E. da [Departamento de Física, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil); Coordenadoria Interdisciplinar de Ciência e Tecnologia, Universidade Federal do Maranhão,65080-805, São Luís, Maranhão (Brazil)

    2016-12-14

    We have shown the existence of self-dual solutions in new Maxwell-Higgs scenarios where the gauge field possesses a k-generalized dynamic, i.e., the kinetic term of gauge field is a highly nonlinear function of F{sub μν}F{sup μν}. We have implemented our proposal by means of a k-generalized model displaying the spontaneous symmetry breaking phenomenon. We implement consistently the Bogomol’nyi-Prasad-Sommerfield formalism providing highly nonlinear self-dual equations whose solutions are electrically neutral possessing total energy proportional to the magnetic flux. Among the infinite set of possible configurations, we have found families of k-generalized models whose self-dual equations have a form mathematically similar to the ones arising in the Maxwell-Higgs or Chern-Simons-Higgs models. Furthermore, we have verified that our proposal also supports infinite twinlike models with |ϕ|{sup 4}-potential or |ϕ|{sup 6}-potential. With the aim to show explicitly that the BPS equations are able to provide well-behaved configurations, we have considered a test model in order to study axially symmetric vortices. By depending of the self-dual potential, we have shown that the k-generalized model is able to produce solutions that for long distances have a exponential decay (as Abrikosov-Nielsen-Olesen vortices) or have a power-law decay (characterizing delocalized vortices). In all cases, we observe that the generalization modifies the vortex core size, the magnetic field amplitude and the bosonic masses but the total energy remains proportional to the quantized magnetic flux.

  18. One dimensional modeling of a diesel-CNG dual fuel engine

    Science.gov (United States)

    Azman, Putera Adam; Fawzi, Mas; Ismail, Muammar Mukhsin; Osman, Shahrul Azmir

    2017-04-01

    Some of the previous studies have shown that the use of compressed natural gas (CNG) in diesel engines potentially produce engine performance improvement and exhaust gas emission reduction, especially nitrogen oxides, unburned hydrocarbons, and carbon dioxide. On the other hand, there are other researchers who claimed that the use of CNG increases exhaust gas emissions, particularly nitrogen oxides. In this study, a one-dimensional model of a diesel-CNG dual fuel engine was made based on a 4-cylinder 2.5L common rail direct injection diesel engine. The software used is GT-Power, and it was used to analyze the engine performance and exhaust gas emissions of several diesel-CNG dual fuel blend ratios, i.e. 100:0, 90:10, 80:20, 70:30, 60:40 and 50:50. The effect of 100%, 75%, 50% engine loads on the exhaust gas emissions were also studied. The result shows that all diesel-CNG fuel blends produces higher brake torque and brake power at engine speed of 2000-3000 rpm compared with 100% diesel. The 50:50 diesel-CNG blend produces the highest brake torque and brake power, but also has the highest brake specific fuel consumption. As a higher percentage of CNG added to the dual fuel blend, unburned hydrocarbons and carbon monoxide emission increased while carbon dioxide emission decreased. The nitrogen oxides emission concentration is generally unaffected by any change of the dual fuel ratio.

  19. Dual states estimation of a subsurface flow-transport coupled model using ensemble Kalman filtering

    KAUST Repository

    El Gharamti, Mohamad

    2013-10-01

    Modeling the spread of subsurface contaminants requires coupling a groundwater flow model with a contaminant transport model. Such coupling may provide accurate estimates of future subsurface hydrologic states if essential flow and contaminant data are assimilated in the model. Assuming perfect flow, an ensemble Kalman filter (EnKF) can be used for direct data assimilation into the transport model. This is, however, a crude assumption as flow models can be subject to many sources of uncertainty. If the flow is not accurately simulated, contaminant predictions will likely be inaccurate even after successive Kalman updates of the contaminant model with the data. The problem is better handled when both flow and contaminant states are concurrently estimated using the traditional joint state augmentation approach. In this paper, we introduce a dual estimation strategy for data assimilation into a one-way coupled system by treating the flow and the contaminant models separately while intertwining a pair of distinct EnKFs, one for each model. The presented strategy only deals with the estimation of state variables but it can also be used for state and parameter estimation problems. This EnKF-based dual state-state estimation procedure presents a number of novel features: (i) it allows for simultaneous estimation of both flow and contaminant states in parallel; (ii) it provides a time consistent sequential updating scheme between the two models (first flow, then transport); (iii) it simplifies the implementation of the filtering system; and (iv) it yields more stable and accurate solutions than does the standard joint approach. We conducted synthetic numerical experiments based on various time stepping and observation strategies to evaluate the dual EnKF approach and compare its performance with the joint state augmentation approach. Experimental results show that on average, the dual strategy could reduce the estimation error of the coupled states by 15% compared with the

  20. Assessment of CO2 Storage Potential in Naturally Fractured Reservoirs With Dual-Porosity Models

    Science.gov (United States)

    March, Rafael; Doster, Florian; Geiger, Sebastian

    2018-03-01

    Naturally Fractured Reservoirs (NFR's) have received little attention as potential CO2 storage sites. Two main facts deter from storage projects in fractured reservoirs: (1) CO2 tends to be nonwetting in target formations and capillary forces will keep CO2 in the fractures, which typically have low pore volume; and (2) the high conductivity of the fractures may lead to increased spatial spreading of the CO2 plume. Numerical simulations are a powerful tool to understand the physics behind brine-CO2 flow in NFR's. Dual-porosity models are typically used to simulate multiphase flow in fractured formations. However, existing dual-porosity models are based on crude approximations of the matrix-fracture fluid transfer processes and often fail to capture the dynamics of fluid exchange accurately. Therefore, more accurate transfer functions are needed in order to evaluate the CO2 transfer to the matrix. This work presents an assessment of CO2 storage potential in NFR's using dual-porosity models. We investigate the impact of a system of fractures on storage in a saline aquifer, by analyzing the time scales of brine drainage by CO2 in the matrix blocks and the maximum CO2 that can be stored in the rock matrix. A new model to estimate drainage time scales is developed and used in a transfer function for dual-porosity simulations. We then analyze how injection rates should be limited in order to avoid early spill of CO2 (lost control of the plume) on a conceptual anticline model. Numerical simulations on the anticline show that naturally fractured reservoirs may be used to store CO2.

  1. Photoproduction within the two-component Dual Parton Model: amplitudes and cross sections

    International Nuclear Information System (INIS)

    Engel, R.; Siegen Univ.

    1995-01-01

    In the framework of the Dual Parton Model an approximation scheme to describe high energy photoproduction processes is presented. Based on the distinction between direct, resolved soft, and resolved hard interaction processes we construct effective impact parameter amplitudes. In order to treat low mass diffraction within the eikonal formalism in a consistent way a phenomenological ansatz is proposed. The free parameters of the model are determined by fits to high energy hadro- and photoproduction cross sections. We calculate the partial photoproduction cross sections and discuss predictions of the model at HERA energies. Using hadro- and photoproduction data together, the uncertainties of the model predictions are strongly reduced. (orig.)

  2. Cross sections and multiparticle production at supercollider energies in the dual parton model

    International Nuclear Information System (INIS)

    Ranft, J.

    1993-01-01

    The dual parton model (DPM) describes soft and semihard multiparticle production and treats diffractive processes for the first time in a consistent way. The model is formulated in the form of a Monte-Carlo event generator, DTUJET for hadron-hadron collisions at collider energies. The uncertainties in the model predictions in the TeV energy range due to the unknown parton structure functions at x≤0.02 is explored. The behaviour of the model studied in the forward fragmentation region, which is especially relevant for the interaction of Cosmic Rays

  3. Terahertz plasmon-induced transparency based on asymmetric dual-disk resonators coupled to a semiconductor InSb waveguide and its biosensor application

    Science.gov (United States)

    Shahamat, Yadollah; Vahedi, Mohammad

    2017-06-01

    An ultracompact double eight-shaped plasmonic structure for the realization of plasmon-induced transparency (PIT) in the terahertz (THz) region has been studied. The device consists of a semiconductor-insulator-semiconductor bus waveguide coupled to the dual-disk resonators. Indium antimonide is employed to excite SPP in the THz region. The transmission characteristics of the proposed device are simulated numerically by the finite-difference time-domain method. In addition, a theoretical analysis based on the coupled-mode theory for transmission features is presented and compared with the numerical results. Results are in good agreement. Also, the dependence of PIT frequency characteristics on the radius of the outer disk is discussed in detail. In addition, by removing one of the outer disk resonators, double-PIT peaks can be observed in the transmission spectrum, and the physical mechanism of the appeared peaks is investigated. Finally, an application of the proposed structure for distinguishing different states of DNA molecules is discussed. Results show that the maximum sensitivity with 654 GHz/RIU-1 could be obtained for a single PIT structure. The frequency shifts equal to 37 and 99 GHz could be observed for the denatured and the hybridized DNA states, respectively.

  4. A Dual Hesitant Fuzzy Multigranulation Rough Set over Two-Universe Model for Medical Diagnoses

    Science.gov (United States)

    Zhang, Chao; Li, Deyu; Yan, Yan

    2015-01-01

    In medical science, disease diagnosis is one of the difficult tasks for medical experts who are confronted with challenges in dealing with a lot of uncertain medical information. And different medical experts might express their own thought about the medical knowledge base which slightly differs from other medical experts. Thus, to solve the problems of uncertain data analysis and group decision making in disease diagnoses, we propose a new rough set model called dual hesitant fuzzy multigranulation rough set over two universes by combining the dual hesitant fuzzy set and multigranulation rough set theories. In the framework of our study, both the definition and some basic properties of the proposed model are presented. Finally, we give a general approach which is applied to a decision making problem in disease diagnoses, and the effectiveness of the approach is demonstrated by a numerical example. PMID:26858772

  5. Dual process interaction model of HIV-risk behaviors among drug offenders.

    Science.gov (United States)

    Ames, Susan L; Grenard, Jerry L; Stacy, Alan W

    2013-03-01

    This study evaluated dual process interaction models of HIV-risk behavior among drug offenders. A dual process approach suggests that decisions to engage in appetitive behaviors result from a dynamic interplay between a relatively automatic associative system and an executive control system. One synergistic type of interplay suggests that executive functions may dampen or block effects of spontaneously activated associations. Consistent with this model, latent variable interaction analyses revealed that drug offenders scoring higher in affective decision making were relatively protected from predictive effects of spontaneous sex associations promoting risky sex. Among drug offenders with lower levels of affective decision making ability, spontaneous sexually-related associations more strongly predicted risky sex (lack of condom use and greater number of sex partners). These findings help elucidate associative and control process effects on appetitive behaviors and are important for explaining why some individuals engage in risky sex, while others are relatively protected.

  6. Mothers Coping With Bereavement in the 2008 China Earthquake: A Dual Process Model Analysis.

    Science.gov (United States)

    Chen, Lin; Fu, Fang; Sha, Wei; Chan, Cecilia L W; Chow, Amy Y M

    2017-01-01

    The purpose of this study is to explore the grief experiences of mothers after they lost their children in the 2008 China earthquake. Informed by the Dual Process Model, this study conducted in-depth interviews to explore how six bereaved mothers coped with such grief over a 2-year period. Right after the earthquake, these mothers suffered from intensive grief. They primarily coped with loss-oriented stressors. As time passed, these mothers began to focus on restoration-oriented stressors to face changes in life. This coping trajectory was a dynamic and integral process, which bereaved mothers oscillated between loss- and restoration-oriented stressors. This study offers insight in extending the existing empirical evidence of the Dual Process Model.

  7. Simulation and experimental validation of the dynamical model of a dual-rotor vibrotactor

    Science.gov (United States)

    Miklós, Á.; Szabó, Z.

    2015-01-01

    In this work, a novel design for small vibrotactors called the Dual Excenter is presented, which makes it possible to produce vibrations with independently adjustable frequency and amplitude. This feature has been realized using two coaxially aligned eccentric rotors, which are driven by DC motors independently. The prototype of the device has been built, where mechanical components are integrated on a frame with two optical sensors for the measurement of angular velocity and phase angle. The system is equipped with a digital controller. Simulations confirm the results of analytical investigations and they allow us to model the sampling method of the signals of the angular velocity and the phase angle between the rotors. Furthermore, we model the discrete behavior of the controller, which is a PI controller for the angular velocities and a PID controller for the phase angle. Finally, simulation results are compared to experimental ones, which show that the Dual Excenter concept is feasible.

  8. THE LOW FREQUENCY OF DUAL ACTIVE GALACTIC NUCLEI VERSUS THE HIGH MERGER RATE OF GALAXIES: A PHENOMENOLOGICAL MODEL

    International Nuclear Information System (INIS)

    Yu Qingjuan; Lu Youjun; Mohayaee, Roya; Colin, Jacques

    2011-01-01

    Dual active galactic nuclei (AGNs) are natural byproducts of hierarchical mergers of galaxies in the ΛCDM cosmogony. Recent observations have shown that only a small fraction (∼0.1%-2.5%) of AGNs at redshift z ∼< 0.3 are dual with kpc-scale separations, which is rather low compared to the high merger rate of galaxies. Here we construct a phenomenological model to estimate the number density of dual AGNs and its evolution according to the observationally estimated major merger rates of galaxies and various scaling relations on the properties of galaxies and their central massive black holes. We show that our model reproduces the observed frequency and separation distribution of dual AGNs provided that significant nuclear activities are triggered only in gas-rich progenitor galaxies with central massive black holes and only when the nuclei of these galaxies are roughly within the half-light radii of their companion galaxies. Under these constraints, the observed low dual AGN frequency is consistent with the relatively high merger rate of galaxies and supports the hypothesis that major mergers lead to AGN/QSO activities. We also predict that the number of kpc-scale dual AGNs decreases with increasing redshift and only about 0.02%-0.06% of AGNs are dual AGNs with double-peaked narrow line features at redshifts of z ∼ 0.5-1.2. Future observations of high-redshift dual AGNs would provide a solid test for this prediction.

  9. Design, Fabrication, and Modeling of a Novel Dual-Axis Control Input PZT Gyroscope.

    Science.gov (United States)

    Chang, Cheng-Yang; Chen, Tsung-Lin

    2017-10-31

    Conventional gyroscopes are equipped with a single-axis control input, limiting their performance. Although researchers have proposed control algorithms with dual-axis control inputs to improve gyroscope performance, most have verified the control algorithms through numerical simulations because they lacked practical devices with dual-axis control inputs. The aim of this study was to design a piezoelectric gyroscope equipped with a dual-axis control input so that researchers may experimentally verify those control algorithms in future. Designing a piezoelectric gyroscope with a dual-axis control input is more difficult than designing a conventional gyroscope because the control input must be effective over a broad frequency range to compensate for imperfections, and the multiple mode shapes in flexural deformations complicate the relation between flexural deformation and the proof mass position. This study solved these problems by using a lead zirconate titanate (PZT) material, introducing additional electrodes for shielding, developing an optimal electrode pattern, and performing calibrations of undesired couplings. The results indicated that the fabricated device could be operated at 5.5±1 kHz to perform dual-axis actuations and position measurements. The calibration of the fabricated device was completed by system identifications of a new dynamic model including gyroscopic motions, electromechanical coupling, mechanical coupling, electrostatic coupling, and capacitive output impedance. Finally, without the assistance of control algorithms, the "open loop sensitivity" of the fabricated gyroscope was 1.82 μV/deg/s with a nonlinearity of 9.5% full-scale output. This sensitivity is comparable with those of other PZT gyroscopes with single-axis control inputs.

  10. Design, Fabrication, and Modeling of a Novel Dual-Axis Control Input PZT Gyroscope

    Directory of Open Access Journals (Sweden)

    Cheng-Yang Chang

    2017-10-01

    Full Text Available Conventional gyroscopes are equipped with a single-axis control input, limiting their performance. Although researchers have proposed control algorithms with dual-axis control inputs to improve gyroscope performance, most have verified the control algorithms through numerical simulations because they lacked practical devices with dual-axis control inputs. The aim of this study was to design a piezoelectric gyroscope equipped with a dual-axis control input so that researchers may experimentally verify those control algorithms in future. Designing a piezoelectric gyroscope with a dual-axis control input is more difficult than designing a conventional gyroscope because the control input must be effective over a broad frequency range to compensate for imperfections, and the multiple mode shapes in flexural deformations complicate the relation between flexural deformation and the proof mass position. This study solved these problems by using a lead zirconate titanate (PZT material, introducing additional electrodes for shielding, developing an optimal electrode pattern, and performing calibrations of undesired couplings. The results indicated that the fabricated device could be operated at 5.5±1 kHz to perform dual-axis actuations and position measurements. The calibration of the fabricated device was completed by system identifications of a new dynamic model including gyroscopic motions, electromechanical coupling, mechanical coupling, electrostatic coupling, and capacitive output impedance. Finally, without the assistance of control algorithms, the “open loop sensitivity” of the fabricated gyroscope was 1.82 μV/deg/s with a nonlinearity of 9.5% full-scale output. This sensitivity is comparable with those of other PZT gyroscopes with single-axis control inputs.

  11. Cooperative Rendezvous and Docking for Underwater Robots Using Model Predictive Control and Dual Decomposition

    DEFF Research Database (Denmark)

    Nielsen, Mikkel Cornelius; Johansen, Tor Arne; Blanke, Mogens

    2018-01-01

    This paper considers the problem of rendezvous and docking with visual constraints in the context of underwater robots with camera-based navigation. The objective is the convergence of the vehicles to a common point while maintaining visual contact. The proposed solution includes the design of a ...... of a distributed model predictive controller based on dual decomposition, which allows for optimization in a decentralized fashion. The proposed distributed controller enables rendezvous and docking between vehicles while maintaining visual contact....

  12. Analyses of Spring Barley Evapotranspiration Rates Based on Gradient Measurements and Dual Crop Coefficient Model

    Czech Academy of Sciences Publication Activity Database

    Pozníková, Gabriela; Fischer, Milan; Pohanková, Eva; Trnka, Miroslav

    2014-01-01

    Roč. 62, č. 5 (2014), s. 1079-1086 ISSN 1211-8516 R&D Projects: GA MŠk LH12037; GA MŠk(CZ) EE2.3.20.0248 Institutional support: RVO:67179843 Keywords : evapotranspiration * dual crop coefficient model * Bowen ratio/energy balance method * transpiration * soil evaporation * spring barley Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7)

  13. On the algebraic structure of self-dual gauge fields and sigma models

    International Nuclear Information System (INIS)

    Bais, F.A.; Sasaki, R.

    1983-01-01

    An extensive and detailed analysis of self-dual gauge fields, in particular with axial symmetry, is presented, culminating in a purely algebraic procedure to generate solutions. The method which is particularly suited for the construction of multimonopole solutions for a theory with arbitrary G, is also applicable to a wide class of non-linear sigma models. The relevant symmetries as well as the associated linear problems which underly the exact solubility of the problem, are constructed and discussed in detail. (orig.)

  14. RESONANCE

    Indian Academy of Sciences (India)

    To the extent that genes influence our behaviour it may well be that our ... other by a coefficient of genetic relatedness r of 0.75 but a female. Figure 1. ... cal and empirical work. ... rather famous one is called PSR, for paternally transmitted sex ... Life cycle of ... Genic balance sex determination (GBSD): According to this model ...

  15. Determination of effective resonance energies for the (n,γ) reactions of 152Sm and 165Ho by using dual monitors

    International Nuclear Information System (INIS)

    Budak, M.G.; Karadag, M.; Yuecel, H.

    2010-01-01

    The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r

  16. Reliable Dual Tensor Model Estimation in Single and Crossing Fibers Based on Jeffreys Prior

    Science.gov (United States)

    Yang, Jianfei; Poot, Dirk H. J.; Caan, Matthan W. A.; Su, Tanja; Majoie, Charles B. L. M.; van Vliet, Lucas J.; Vos, Frans M.

    2016-01-01

    Purpose This paper presents and studies a framework for reliable modeling of diffusion MRI using a data-acquisition adaptive prior. Methods Automated relevance determination estimates the mean of the posterior distribution of a rank-2 dual tensor model exploiting Jeffreys prior (JARD). This data-acquisition prior is based on the Fisher information matrix and enables the assessment whether two tensors are mandatory to describe the data. The method is compared to Maximum Likelihood Estimation (MLE) of the dual tensor model and to FSL’s ball-and-stick approach. Results Monte Carlo experiments demonstrated that JARD’s volume fractions correlated well with the ground truth for single and crossing fiber configurations. In single fiber configurations JARD automatically reduced the volume fraction of one compartment to (almost) zero. The variance in fractional anisotropy (FA) of the main tensor component was thereby reduced compared to MLE. JARD and MLE gave a comparable outcome in data simulating crossing fibers. On brain data, JARD yielded a smaller spread in FA along the corpus callosum compared to MLE. Tract-based spatial statistics demonstrated a higher sensitivity in detecting age-related white matter atrophy using JARD compared to both MLE and the ball-and-stick approach. Conclusions The proposed framework offers accurate and precise estimation of diffusion properties in single and dual fiber regions. PMID:27760166

  17. Modeling the dual pacemaker system of the tau mutant hamster.

    Science.gov (United States)

    Oda, G A; Menaker, M; Friesen, W O

    2000-06-01

    Circadian pacemakers in many animals are compound. In rodents, a two-oscillator model of the pacemaker composed of an evening (E) and a morning (M) oscillator has been proposed based on the phenomenon of "splitting" and bimodal activity peaks. The authors describe computer simulations of the pacemaker in tau mutant hamsters viewed as a system of mutually coupled E and M oscillators. These mutant animals exhibit normal type 1 PRCs when released into DD but make a transition to a type 0 PRC when held for many weeks in DD. The two-oscillator model describes particularly well some recent behavioral experiments on these hamsters. The authors sought to determine the relationships between oscillator amplitude, period, PRC, and activity duration through computer simulations. Two complementary approaches proved useful for analyzing weakly coupled oscillator systems. The authors adopted a "distinct oscillators" view when considering the component E and M oscillators and a "system" view when considering the system as a whole. For strongly coupled systems, only the system view is appropriate. The simulations lead the authors to two primary conjectures: (1) the total amplitude of the pacemaker system in tau mutant hamsters is less than in the wild-type animals, and (2) the coupling between the unit E and M oscillators is weakened during continuous exposure of hamsters to DD. As coupling strength decreases, activity duration (alpha) increases due to a greater phase difference between E and M. At the same time, the total amplitude of the system decreases, causing an increase in observable PRC amplitudes. Reduced coupling also increases the relative autonomy of the unit oscillators. The relatively autonomous phase shifts of E and M oscillators can account for both immediate compression and expansion of activity bands in tau mutant and wild-type hamsters subjected to light pulses.

  18. Modelling of the dual frequency capacitive sheath in the intermediate pressure range

    International Nuclear Information System (INIS)

    Boyle, P C; Robiche, J; Turner, M M

    2004-01-01

    The nonlinearity of the plasma sheath in dual frequency capacitively coupled reactors is investigated for frequencies well above the ion plasma frequency. This work focuses on the behaviour of the voltage and the sheath width with respect to the driving current source and the collisionality regime. For typical plasma processing applications, the gas pressure ranges from a few milliTorrs to hundreds of milliTorrs, and the ion dynamics span different collisional regimes. To describe these different ion dynamics, we have used a collisionless model and a variable mobility model. The sheath widths and the voltages obtained from these two models have then been compared

  19. Motivation and justification: a dual-process model of culture in action.

    Science.gov (United States)

    Vaisey, Stephen

    2009-05-01

    This article presents a new model of culture in action. Although most sociologists who study culture emphasize its role in post hoc sense making, sociologists of religion and social psychologists tend to focus on the role beliefs play in motivation. The dual-process model integrates justificatory and motivational approaches by distinguishing between "discursive" and "practical" modes of culture and cognition. The author uses panel data from the National Study of Youth and Religion to illustrate the model's usefulness. Consistent with its predictions, he finds that though respondents cannot articulate clear principles of moral judgment, their choice from a list of moral-cultural scripts strongly predicts later behavior.

  20. Dual-process models of health-related behaviour and cognition: a review of theory.

    Science.gov (United States)

    Houlihan, S

    2018-03-01

    The aim of this review was to synthesise a spectrum of theories incorporating dual-process models of health-related behaviour. Review of theory, adapted loosely from Cochrane-style systematic review methodology. Inclusion criteria were specified to identify all relevant dual-process models that explain decision-making in the context of decisions made about human health. Data analysis took the form of iterative template analysis (adapted from the conceptual synthesis framework used in other reviews of theory), and in this way theories were synthesised on the basis of shared theoretical constructs and causal pathways. Analysis and synthesis proceeded in turn, instead of moving uni-directionally from analysis of individual theories to synthesis of multiple theories. Namely, the reviewer considered and reconsidered individual theories and theoretical components in generating the narrative synthesis' main findings. Drawing on systematic review methodology, 11 electronic databases were searched for relevant dual-process theories. After de-duplication, 12,198 records remained. Screening of title and abstract led to the exclusion of 12,036 records, after which 162 full-text records were assessed. Of those, 21 records were included in the review. Moving back and forth between analysis of individual theories and the synthesis of theories grouped on the basis of theme or focus yielded additional insights into the orientation of a theory to an individual. Theories could be grouped in part on their treatment of an individual as an irrational actor, as social actor, as actor in a physical environment or as a self-regulated actor. Synthesising identified theories into a general dual-process model of health-related behaviour indicated that such behaviour is the result of both propositional and unconscious reasoning driven by an individual's response to internal cues (such as heuristics, attitude and affect), physical cues (social and physical environmental stimuli) as well as

  1. Religion, fertility and genes: a dual inheritance model

    Science.gov (United States)

    Rowthorn, Robert

    2011-01-01

    Religious people nowadays have more children on average than their secular counterparts. This paper uses a simple model to explore the evolutionary implications of this difference. It assumes that fertility is determined entirely by culture, whereas subjective predisposition towards religion is influenced by genetic endowment. People who carry a certain ‘religiosity’ gene are more likely than average to become or remain religious. The paper considers the effect of religious defections and exogamy on the religious and genetic composition of society. Defections reduce the ultimate share of the population with religious allegiance and slow down the spread of the religiosity gene. However, provided the fertility differential persists, and people with a religious allegiance mate mainly with people like themselves, the religiosity gene will eventually predominate despite a high rate of defection. This is an example of ‘cultural hitch-hiking’, whereby a gene spreads because it is able to hitch a ride with a high-fitness cultural practice. The theoretical arguments are supported by numerical simulations. PMID:21227968

  2. Religion, fertility and genes: a dual inheritance model.

    Science.gov (United States)

    Rowthorn, Robert

    2011-08-22

    Religious people nowadays have more children on average than their secular counterparts. This paper uses a simple model to explore the evolutionary implications of this difference. It assumes that fertility is determined entirely by culture, whereas subjective predisposition towards religion is influenced by genetic endowment. People who carry a certain 'religiosity' gene are more likely than average to become or remain religious. The paper considers the effect of religious defections and exogamy on the religious and genetic composition of society. Defections reduce the ultimate share of the population with religious allegiance and slow down the spread of the religiosity gene. However, provided the fertility differential persists, and people with a religious allegiance mate mainly with people like themselves, the religiosity gene will eventually predominate despite a high rate of defection. This is an example of 'cultural hitch-hiking', whereby a gene spreads because it is able to hitch a ride with a high-fitness cultural practice. The theoretical arguments are supported by numerical simulations.

  3. The inherent complexity in nonlinear business cycle model in resonance

    International Nuclear Information System (INIS)

    Ma Junhai; Sun Tao; Liu Lixia

    2008-01-01

    Based on Abraham C.-L. Chian's research, we applied nonlinear dynamic system theory to study the first-order and second-order approximate solutions to one category of the nonlinear business cycle model in resonance condition. We have also analyzed the relation between amplitude and phase of second-order approximate solutions as well as the relation between outer excitements' amplitude, frequency approximate solutions, and system bifurcation parameters. Then we studied the system quasi-periodical solutions, annulus periodical solutions and the path leading to system bifurcation and chaotic state with different parameter combinations. Finally, we conducted some numerical simulations for various complicated circumstances. Therefore this research will lay solid foundation for detecting the complexity of business cycles and systems in the future

  4. Polyakov loop and the hadron resonance gas model.

    Science.gov (United States)

    Megías, E; Arriola, E Ruiz; Salcedo, L L

    2012-10-12

    The Polyakov loop has been used repeatedly as an order parameter in the deconfinement phase transition in QCD. We argue that, in the confined phase, its expectation value can be represented in terms of hadronic states, similarly to the hadron resonance gas model for the pressure. Specifically, L(T)≈1/2[∑(α)g(α)e(-Δ(α)/T), where g(α) are the degeneracies and Δ(α) are the masses of hadrons with exactly one heavy quark (the mass of the heavy quark itself being subtracted). We show that this approximate sum rule gives a fair description of available lattice data with N(f)=2+1 for temperatures in the range 150 MeVmodels. For temperatures below 150 MeV different lattice results disagree. One set of data can be described if exotic hadrons are present in the QCD spectrum while other sets do not require such states.

  5. Numerical model of electron cyclotron resonance ion source

    Directory of Open Access Journals (Sweden)

    V. Mironov

    2015-12-01

    Full Text Available Important features of the electron cyclotron resonance ion source (ECRIS operation are accurately reproduced with a numerical code. The code uses the particle-in-cell technique to model the dynamics of ions in ECRIS plasma. It is shown that a gas dynamical ion confinement mechanism is sufficient to provide the ion production rates in ECRIS close to the experimentally observed values. Extracted ion currents are calculated and compared to the experiment for a few sources. Changes in the simulated extracted ion currents are obtained with varying the gas flow into the source chamber and the microwave power. Empirical scaling laws for ECRIS design are studied and the underlying physical effects are discussed.

  6. The gauge properties of the dual model pomeron-reggeon vertex their derivation and their consequences

    CERN Document Server

    Brink, L; Scherk, J

    1973-01-01

    Study of the non-planar orientable single dual loop diagrams in 26 space-time dimensions has revealed an infinite positive-definite spectrum of 'pomeron' intermediate states which couple to reggeons via a bilinear pomeron-reggeon vertex operator. General algebraic techniques are developed to derive the behaviour of this vertex with respect to the Visasoro gauge operators. A reflection and transmission behaviour is found, reminiscent of the behaviour of a wave incident at the interface between two different media (in this case reggeonic and pomeronic). These gauge properties are such as to guarantee the desired 'good properties', namely completeness of the transverse reggeon states when coupled between physical reggeon states on one side, and on the other side, either physical pomeron states or else physical reggeon states created via an intermediate pomeron. This is yet another example of the amazing and gratifying self-consistency of the dual model with respect to duality, transversality and unitarity. (13 r...

  7. Dual contrast enhanced magnetic resonance imaging of the liver with superparamagnetic iron oxide followed by gadolinium for lesion detection and characterization

    International Nuclear Information System (INIS)

    Kubaska, Samantha; Sahani, Dushyant V.; Saini, Sanjay; Hahn, Peter F.; Halpern, Elkan

    2001-01-01

    AIM: Iron oxide contrast agents are useful for lesion detection, and extracellular gadolinium chelates are advocated for lesion characterization. We undertook a study to determine if dual contrast enhanced liver imaging with sequential use of ferumoxides particles and gadolinium (Gd)-DTPA can be performed in the same imaging protocol. MATERIALS AND METHODS: Sixteen patients underwent dual contrast magnetic resonance imaging (MRI) of the liver for evaluation of known/suspected focal lesions which included, metastases (n = 5), hepatocellular carcinoma (HCC;n = 3), cholangiocharcinoma(n = 1) and focal nodular hyperplasia (FNH;n = 3). Pre- and post-iron oxide T1-weighted gradient recalled echo (GRE) and T2-weighted fast spin echo (FSE) sequences were obtained, followed by post-Gd-DTPA (0.1 mmol/kg) multi-phase dynamic T1-weighted out-of-phase GRE imaging. Images were analysed in a blinded fashion by three experts using a three-point scoring system for lesion conspicuity on pre- and post-iron oxide T1 images as well as for reader's confidence in characterizing liver lesions on post Gd-DTPA T1 images. RESULTS: No statistically significant difference in lesion conspicuity was observed on pre- and post-iron oxide T1-GRE images in this small study cohort. The presence of iron oxide did not appreciably diminish image quality of post-gadolinium sequences and did not prevent characterization of liver lesions. CONCLUSION: Our results suggest that characterization of focal liver lesion with Gd-enhanced liver MRI is still possible following iron oxide enhanced imaging. Kubaska, S. et al. (2001)

  8. Matter-neutrino resonance in a multiangle neutrino bulb model

    Science.gov (United States)

    Vlasenko, Alexey; McLaughlin, G. C.

    2018-04-01

    Simulations of neutrino flavor evolution in compact merger environments have shown that neutrino flavor, and hence nucleosynthesis, can be strongly affected by the presence of matter-neutrino resonances (MNRs), where there is a cancelation between the matter and the neutrino potential. Simulations performed thus far follow flavor evolution along a single neutrino trajectory, but self-consistency requires all trajectories to be treated simultaneously, and it has not been known whether MNR phenomena would still occur in multiangle models. In this paper, we present the first fully multi-angle calculations of MNR. We find that familiar MNR phenomena, where neutrinos transform to a greater extent than anti-neutrinos and a feedback mechanism maintains the cancellation between the matter and neutrino potential, still occurs for a subset of angular bins, although the flavor transformation is not as efficient as in the single-angle case. In addition, we find other types of flavor transformation that are not seen in single-angle simulations. These flavor transformation phenomena appear to be robust and are present for a wide range of model parameters, as long as an MNR is present. Although computational constraints currently limit us to models with spherical symmetry, our results suggest that the presence of an MNR generally leads to large-scale neutrino flavor evolution in multiangle systems.

  9. Immediate survival focus: synthesizing life history theory and dual process models to explain substance use.

    Science.gov (United States)

    Richardson, George B; Hardesty, Patrick

    2012-01-01

    Researchers have recently applied evolutionary life history theory to the understanding of behaviors often conceived of as prosocial or antisocial. In addition, researchers have applied cognitive science to the understanding of substance use and used dual process models, where explicit cognitive processes are modeled as relatively distinct from implicit cognitive processes, to explain and predict substance use behaviors. In this paper we synthesized these two theoretical perspectives to produce an adaptive and cognitive framework for explaining substance use. We contend that this framework provides new insights into the nature of substance use that may be valuable for both clinicians and researchers.

  10. Immediate Survival Focus: Synthesizing Life History Theory and Dual Process Models to Explain Substance Use

    Directory of Open Access Journals (Sweden)

    George B. Richardson

    2012-10-01

    Full Text Available Researchers have recently applied evolutionary life history theory to the understanding of behaviors often conceived of as prosocial or antisocial. In addition, researchers have applied cognitive science to the understanding of substance use and used dual process models, where explicit cognitive processes are modeled as relatively distinct from implicit cognitive processes, to explain and predict substance use behaviors. In this paper we synthesized these two theoretical perspectives to produce an adaptive and cognitive framework for explaining substance use. We contend that this framework provides new insights into the nature of substance use that may be valuable for both clinicians and researchers.

  11. The Dual Rounding Model: Forging Therapeutic Alliances 
in Oncology and Palliative Care.

    Science.gov (United States)

    Baxley, Carey E

    2016-04-01

    Inpatients with solid tumors at Duke University Hospital in Durham, NC, are cared for in a dynamic integrated care model that incorporates medical oncology and palliative care. This has profound implications for patients, their loved ones, medical and surgical staff, and oncology nurses. As a nurse with less than three years of experience, my participation in a setting that uses the Dual Rounding Model has accelerated my professional and personal development. During a typical shift, I am an oncology nurse, a palliative care nurse, and a hospice nurse.
.

  12. Establishment and analysis of coupled dynamic model for dual-mass silicon micro-gyroscope

    Science.gov (United States)

    Wang, Zhanghui; Qiu, Anping; Shi, Qin; Zhang, Taoyuan

    2017-12-01

    This paper presents a coupled dynamic model for a dual-mass silicon micro-gyroscope (DMSG). It can quantitatively analyze the influence of left-right stiffness difference on the natural frequencies, modal matrix and modal coupling coefficient of the DMSG. The analytic results are verified by using the finite element method (FEM) simulation. The model shows that with the left-right stiffness difference of 1%, the modal coupling coefficient is 12% in the driving direction and 31% in the sensing direction. It also shows that in order to achieve good separation, the stiffness of base beam should be small enough in both the driving and sensing direction.

  13. Application of Resonant Converter in Ozone Generator Model

    Directory of Open Access Journals (Sweden)

    Mochammad Facta

    2008-04-01

    Full Text Available Ozone is one of the favorable oxidant to use in home appliance and industry as disinfectant for food processing, food storage, odor abatement, groundwater remediation, and drinking water purification. The common and previous technical method for generating ozone uses a high voltage and low frequency. This kind of method has disadvantage of energy efficiency, size and weight. This paper proposed the use power electronics in the inverter resonant circuit to produce alternating current with high frequency. The basic RLC resonance circuit is used for early study to determine resonance frequency for inverter. As the result, the ozone chamber terminal voltage had been achieved for initiation by using resonance frequency.

  14. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  15. Doorway-resonance model for pion-nucleon D- and F-wave scattering

    International Nuclear Information System (INIS)

    Ernst, D.J.; Parnell, G.E.; Assad, C.; Texas A and M Univ., College Station, TX

    1990-01-01

    A model for the resonant pion-nucleon D- and F-waves is developed which assumes that the pion-plus-nucleon couples to a resonance and that the resonance can serve as a doorway to the inelastic channels. With the use of simple form factors, the model is capable of reproducing the pion-nucleon phase shifts up to an energy of T π =1.4 GeV if the coupling of the elastic channel to the inelastic channels is taken from data as input into the model. A value for the mass of the resonance that would result in the absence of the coupling to decay channels is extracted from the data utilizing the model. This is the mass that is most easily modeled by bag models. For the non-resonant D- and F-wave channels a separable potential model is used. This model, like the resonance model, is developed utilizing the invariant amplitude which is free of kinematic singularities and uses invariant norms and phase spaces. The model is also applied to the S-wave channels. A relation between the resonance model and the Chew-Low model is discovered and used to derive an extended Chew-Low model which is applied to the P 13 , P 31 and P 33 channels. Implications of the model for understanding the range of the pion-nucleon interaction and the dynamic structure of the interaction are presented. (orig.)

  16. Dual Youla parameterization

    DEFF Research Database (Denmark)

    Niemann, Hans Henrik

    2003-01-01

    A different aspect of using the parameterisation of all systems stabilised by a given controller, i.e. the dual Youla parameterisation, is considered. The relation between system change and the dual Youla parameter is derived in explicit form. A number of standard uncertain model descriptions...... are considered and the relation with the dual Youla parameter given. Some applications of the dual Youla parameterisation are considered in connection with the design of controllers and model/performance validation....

  17. Qualification of MHD effects in dual-coolant DEMO blanket and approaches to their modelling

    International Nuclear Information System (INIS)

    Mas de les Valls, E.; Batet, L.; Medina, V. de; Fradera, J.; Sedano, L.A.

    2011-01-01

    Design refinements of vertical insulated banana-shaped liquid metal channels are being considered as a progress of conceptual design of dual-coolant liquid metal blankets (DEMO specifications). Among them: (a) optimised channel geometry and (b) improvements on flow channel inserts. Progress of channel conceptual design is conducted in parallel with underlying physics of MHD models in diverse aspects: (1) MHD models, (2) MHD turbulence, (3) LM buoyancy effects, (4) three-dimensional flows, and (5) LM/FCI/wall electrical and thermal coupling; in order to progress on common liquid metal flow characterisation, pressure drop and three-dimensional flows. The analyses are assumed as extension of those previous carried out for the DCLL blankets for new design refinements. At the present stage of the conceptual design progress, a preliminary thermofluid MHD study is of crucial interest for further design improvements and future detailed modelling. The paper overviews the ongoing modelling studies, making model refinements explicit, and anticipates some modelling results.

  18. A three-dimensional model for calculating the micro disk laser resonant-modes

    International Nuclear Information System (INIS)

    Sabetjoo, H.; Bahrampor, A.; Farrahi-Moghaddam, R.

    2006-01-01

    In this article, a semi-analytical model for theoretical analysis of micro disk lasers is presented. Using this model, the necessary conditions for the existence of loss less and low-loss modes of micro-resonators are obtained. The resonance frequency of the resonant modes and also the attenuation of low-loss modes are calculated. By comparing the results with results of finite difference method, their validity is certified.

  19. Design and analysis of dual-resonant filters in visible and infra-red region based on polymer LPWG

    Science.gov (United States)

    Sharma, Mukesh; Kushwaha, Aniruddha Singh; Pal, Suchandan

    2013-01-01

    Long-period waveguide gratings (LPWGs), by using a SU-8 polymer-based channel waveguide along with NOA61 optical epoxy coated upper- and lower-cladding, are designed and theoretical analyzed. Grating period of ~ 68μm is considered with optimized grating tooth-heights, so that the transmission spectra of the gratings show strong rejection bands both at visible (450 - 460 nm) and infrared (1530 - 1540 nm) wavelength regions. Phase-matching graphs are studied in order to observe the change in resonance wavelength of the grating with the variation of waveguide parameters. LPWG-based band pass filter are also designed and analyzed by considering the same set of polymer materials. Further, temperature sensitivity of these LPWGs is analyzed theoretically. These types of waveguide gratingbased filters can widely be used for visible and infrared wavelength sensing applications.

  20. Self-consistent modeling of electron cyclotron resonance ion sources

    International Nuclear Information System (INIS)

    Girard, A.; Hitz, D.; Melin, G.; Serebrennikov, K.; Lecot, C.

    2004-01-01

    In order to predict the performances of electron cyclotron resonance ion source (ECRIS), it is necessary to perfectly model the different parts of these sources: (i) magnetic configuration; (ii) plasma characteristics; (iii) extraction system. The magnetic configuration is easily calculated via commercial codes; different codes also simulate the ion extraction, either in two dimension, or even in three dimension (to take into account the shape of the plasma at the extraction influenced by the hexapole). However the characteristics of the plasma are not always mastered. This article describes the self-consistent modeling of ECRIS: we have developed a code which takes into account the most important construction parameters: the size of the plasma (length, diameter), the mirror ratio and axial magnetic profile, whether a biased probe is installed or not. These input parameters are used to feed a self-consistent code, which calculates the characteristics of the plasma: electron density and energy, charge state distribution, plasma potential. The code is briefly described, and some of its most interesting results are presented. Comparisons are made between the calculations and the results obtained experimentally

  1. Self-consistent modeling of electron cyclotron resonance ion sources

    Science.gov (United States)

    Girard, A.; Hitz, D.; Melin, G.; Serebrennikov, K.; Lécot, C.

    2004-05-01

    In order to predict the performances of electron cyclotron resonance ion source (ECRIS), it is necessary to perfectly model the different parts of these sources: (i) magnetic configuration; (ii) plasma characteristics; (iii) extraction system. The magnetic configuration is easily calculated via commercial codes; different codes also simulate the ion extraction, either in two dimension, or even in three dimension (to take into account the shape of the plasma at the extraction influenced by the hexapole). However the characteristics of the plasma are not always mastered. This article describes the self-consistent modeling of ECRIS: we have developed a code which takes into account the most important construction parameters: the size of the plasma (length, diameter), the mirror ratio and axial magnetic profile, whether a biased probe is installed or not. These input parameters are used to feed a self-consistent code, which calculates the characteristics of the plasma: electron density and energy, charge state distribution, plasma potential. The code is briefly described, and some of its most interesting results are presented. Comparisons are made between the calculations and the results obtained experimentally.

  2. Model independent approach to studies of the confining dual Abrikosov vortex in SU(2) lattice gauge theory

    International Nuclear Information System (INIS)

    Haymaker, Richard W.; Matsuki, Takayuki

    2007-01-01

    We address the problem of determining the type I, type II or borderline dual superconductor behavior in maximal Abelian gauge SU(2) through the study of the dual Abrikosov vortex. We find that significant electric currents in the simulation data call into question the use of the dual Ginzburg-Landau Higgs model in interpreting the data. Further, two definitions of the penetration depth parameter take two different values. The splitting of this parameter into two is intricately connected to the existence of electric currents. It is important in our approach that we employ definitions of flux and electric and magnetic currents that respect Maxwell equations exactly for lattice averages independent of lattice spacings. Applied to specific Wilson loop sizes, our conclusions differ from those that use the dual GLH model

  3. Do dual-route models accurately predict reading and spelling performance in individuals with acquired alexia and agraphia?

    Science.gov (United States)

    Rapcsak, Steven Z; Henry, Maya L; Teague, Sommer L; Carnahan, Susan D; Beeson, Pélagie M

    2007-06-18

    Coltheart and co-workers [Castles, A., Bates, T. C., & Coltheart, M. (2006). John Marshall and the developmental dyslexias. Aphasiology, 20, 871-892; Coltheart, M., Rastle, K., Perry, C., Langdon, R., & Ziegler, J. (2001). DRC: A dual route cascaded model of visual word recognition and reading aloud. Psychological Review, 108, 204-256] have demonstrated that an equation derived from dual-route theory accurately predicts reading performance in young normal readers and in children with reading impairment due to developmental dyslexia or stroke. In this paper, we present evidence that the dual-route equation and a related multiple regression model also accurately predict both reading and spelling performance in adult neurological patients with acquired alexia and agraphia. These findings provide empirical support for dual-route theories of written language processing.

  4. Modelling and measurement of wear particle flow in a dual oil filter system for condition monitoring

    DEFF Research Database (Denmark)

    Henneberg, Morten; Eriksen, René Lynge; Fich, Jens

    2016-01-01

    . The quantity of wear particles in gear oil is analysed with respect to system running conditions. It is shown that the model fits the data in terms of startup “particle burst” phenomenon, quasi-stationary conditions during operation, and clean-up filtration when placed out of operation. In order to establish...... boundary condition for particle burst phenomenon, the release of wear particles from a pleated mesh filter is measured in a test rig and included in the model. The findings show that a dual filter model, with startup phenomenon included, can describe trends in the wear particle flow observed in the gear...... particle generation is made possible by model parameter estimation and identification of an unintended lack of filter change. The model may also be used to optimise system and filtration performance, and to enable continuous condition monitoring....

  5. Systematic assignment of Feshbach resonances via an asymptotic bound state model

    NARCIS (Netherlands)

    Goosen, M.; Kokkelmans, SJ.J.M.F.

    2008-01-01

    We present an Asymptotic Bound state Model (ABM), which is useful to predict Feshbach resonances. The model utilizes asymptotic properties of the interaction potentials to represent coupled molecular wavefunctions. The bound states of this system give rise to Feshbach resonances, localized at the

  6. Analytical model for double split ring resonators with arbitrary ring width

    DEFF Research Database (Denmark)

    Zhurbenko, Vitaliy; Jensen, Thomas; Krozer, Viktor

    2008-01-01

    For the first time, the analytical model for a double split ring resonator with unequal width rings is developed. The proposed models for the resonators with equal and unequal widths are based on an impedance matrix representation and provide the prediction of performance in a wide frequency range...

  7. Do Dual-Route Models Accurately Predict Reading and Spelling Performance in Individuals with Acquired Alexia and Agraphia?

    OpenAIRE

    Rapcsak, Steven Z.; Henry, Maya L.; Teague, Sommer L.; Carnahan, Susan D.; Beeson, Pélagie M.

    2007-01-01

    Coltheart and colleagues (Coltheart, Rastle, Perry, Langdon, & Ziegler, 2001; Castles, Bates, & Coltheart, 2006) have demonstrated that an equation derived from dual-route theory accurately predicts reading performance in young normal readers and in children with reading impairment due to developmental dyslexia or stroke. In this paper we present evidence that the dual-route equation and a related multiple regression model also accurately predict both reading and spelling performance in adult...

  8. The Influence of Magnetic Resonance Imaging Findings of Degenerative Disease on Dual-Energy X-ray Absorptiometry Measurements in Middle-Aged Men

    International Nuclear Information System (INIS)

    Donescu, O.S.; Battie, M.C.; Videman, T.

    2007-01-01

    Purpose: To examine degenerative features based on magnetic resonance imaging (MRI) measurements at the lumbar spine in relation to dual-energy X-ray absorptiometry (DXA), and to investigate whether bone mineral density (BMD) is reflected in the substitution of bone trabecular structure by fat at the vertebral body level indicated by MRI T1 relaxation time, endplate concavity, and hypertrophic (osteophytes and endplate sclerosis) MRI findings. Material and Methods: The sample for this cross-sectional study was composed of 102 subjects, 35-70 years old, from a population-based cohort. Data collection included DXA in the anterior-posterior projection at the L1-L4 vertebrae and right femoral neck, and MRI of the lumbar spine in the midsagittal plane. Results: Age, vertebral signal intensity, osteophytes, and endplate concavity collectively explained 20% of the variance in spine BMD. Conclusion: The study findings suggest that degenerative findings based on MRI measurements at the lumbar spine have an influence on bone assessment using DXA. Therefore, an overall bone assessment such as DXA might not offer an accurate measure of BMD

  9. Extending roGFP Emission via Förster-Type Resonance Energy Transfer Relay Enables Simultaneous Dual Compartment Ratiometric Redox Imaging in Live Cells.

    Science.gov (United States)

    Norcross, Stevie; Trull, Keelan J; Snaider, Jordan; Doan, Sara; Tat, Kiet; Huang, Libai; Tantama, Mathew

    2017-11-22

    Reactive oxygen species (ROS) mediate both intercellular and intraorganellar signaling, and ROS propagate oxidative stress between cellular compartments such as mitochondria and the cytosol. Each cellular compartment contains its own sources of ROS as well as antioxidant mechanisms, which contribute to dynamic fluctuations in ROS levels that occur during signaling, metabolism, and stress. However, the coupling of redox dynamics between cellular compartments has not been well studied because of the lack of available sensors to simultaneously measure more than one subcellular compartment in the same cell. Currently, the redox-sensitive green fluorescent protein, roGFP, has been used extensively to study compartment-specific redox dynamics because it provides a quantitative ratiometric readout and it is amenable to subcellular targeting as a genetically encoded sensor. Here, we report a new family of genetically encoded fluorescent protein sensors that extend the fluorescence emission of roGFP via Förster-type resonance energy transfer to an acceptor red fluorescent protein for dual-color live-cell microscopy. We characterize the redox and optical properties of the sensor proteins, and we demonstrate that they can be used to simultaneously measure cytosolic and mitochondrial ROS in living cells. Furthermore, we use these sensors to reveal cell-to-cell heterogeneity in redox coupling between the cytosol and mitochondria when neuroblastoma cells are exposed to reductive and metabolic stresses.

  10. Detection and quantification of creep strain using process compensated resonance testing (PCRT) sorting modules trained with modeled resonance spectra

    Science.gov (United States)

    Heffernan, Julieanne; Biedermann, Eric; Mayes, Alexander; Livings, Richard; Jauriqui, Leanne; Goodlet, Brent; Aldrin, John C.; Mazdiyasni, Siamack

    2018-04-01

    Process Compensated Resonant Testing (PCRT) is a full-body nondestructive testing (NDT) method that measures the resonance frequencies of a part and correlates them to the part's material and/or damage state. PCRT testing is used in the automotive, aerospace, and power generation industries via automated PASS/FAIL inspections to distinguish parts with nominal process variation from those with the defect(s) of interest. Traditional PCRT tests are created through the statistical analysis of populations of "good" and "bad" parts. However, gathering a statistically significant number of parts can be costly and time-consuming, and the availability of defective parts may be limited. This work uses virtual databases of good and bad parts to create two targeted PCRT inspections for single crystal (SX) nickel-based superalloy turbine blades. Using finite element (FE) models, populations were modeled to include variations in geometric dimensions, material properties, crystallographic orientation, and creep damage. Model results were verified by comparing the frequency variation in the modeled populations with the measured frequency variations of several physical blade populations. Additionally, creep modeling results were verified through the experimental evaluation of coupon geometries. A virtual database of resonance spectra was created from the model data. The virtual database was used to create PCRT inspections to detect crystallographic defects and creep strain. Quantification of creep strain values using the PCRT inspection results was also demonstrated.

  11. A versatile and modular quasi optics-based 200 GHz dual dynamic nuclear polarization and electron paramagnetic resonance instrument

    Science.gov (United States)

    Siaw, Ting Ann; Leavesley, Alisa; Lund, Alicia; Kaminker, Ilia; Han, Songi

    2016-03-01

    Solid-state dynamic nuclear polarization (DNP) at higher magnetic fields (>3 T) and cryogenic temperatures (∼2-90 K) has gained enormous interest and seen major technological advances as an NMR signal enhancing technique. Still, the current state of the art DNP operation is not at a state at which sample and freezing conditions can be rationally chosen and the DNP performance predicted a priori, but relies on purely empirical approaches. An important step towards rational optimization of DNP conditions is to have access to DNP instrumental capabilities to diagnose DNP performance and elucidate DNP mechanisms. The desired diagnoses include the measurement of the "DNP power curve", i.e. the microwave (MW) power dependence of DNP enhancement, the "DNP spectrum", i.e. the MW frequency dependence of DNP enhancement, the electron paramagnetic resonance (EPR) spectrum, and the saturation and spectral diffusion properties of the EPR spectrum upon prolonged MW irradiation typical of continuous wave (CW) DNP, as well as various electron and nuclear spin relaxation parameters. Even basic measurements of these DNP parameters require versatile instrumentation at high magnetic fields not commercially available to date. In this article, we describe the detailed design of such a DNP instrument, powered by a solid-state MW source that is tunable between 193 and 201 GHz and outputs up to 140 mW of MW power. The quality and pathway of the transmitted and reflected MWs is controlled by a quasi-optics (QO) bridge and a corrugated waveguide, where the latter couples the MW from an open-space QO bridge to the sample located inside the superconducting magnet and vice versa. Crucially, the versatility of the solid-state MW source enables the automated acquisition of frequency swept DNP spectra, DNP power curves, the diagnosis of MW power and transmission, and frequency swept continuous wave (CW) and pulsed EPR experiments. The flexibility of the DNP instrument centered around the QO MW

  12. A versatile and modular quasi optics-based 200GHz dual dynamic nuclear polarization and electron paramagnetic resonance instrument.

    Science.gov (United States)

    Siaw, Ting Ann; Leavesley, Alisa; Lund, Alicia; Kaminker, Ilia; Han, Songi

    2016-03-01

    Solid-state dynamic nuclear polarization (DNP) at higher magnetic fields (>3T) and cryogenic temperatures (∼ 2-90K) has gained enormous interest and seen major technological advances as an NMR signal enhancing technique. Still, the current state of the art DNP operation is not at a state at which sample and freezing conditions can be rationally chosen and the DNP performance predicted a priori, but relies on purely empirical approaches. An important step towards rational optimization of DNP conditions is to have access to DNP instrumental capabilities to diagnose DNP performance and elucidate DNP mechanisms. The desired diagnoses include the measurement of the "DNP power curve", i.e. the microwave (MW) power dependence of DNP enhancement, the "DNP spectrum", i.e. the MW frequency dependence of DNP enhancement, the electron paramagnetic resonance (EPR) spectrum, and the saturation and spectral diffusion properties of the EPR spectrum upon prolonged MW irradiation typical of continuous wave (CW) DNP, as well as various electron and nuclear spin relaxation parameters. Even basic measurements of these DNP parameters require versatile instrumentation at high magnetic fields not commercially available to date. In this article, we describe the detailed design of such a DNP instrument, powered by a solid-state MW source that is tunable between 193 and 201 GHz and outputs up to 140 mW of MW power. The quality and pathway of the transmitted and reflected MWs is controlled by a quasi-optics (QO) bridge and a corrugated waveguide, where the latter couples the MW from an open-space QO bridge to the sample located inside the superconducting magnet and vice versa. Crucially, the versatility of the solid-state MW source enables the automated acquisition of frequency swept DNP spectra, DNP power curves, the diagnosis of MW power and transmission, and frequency swept continuous wave (CW) and pulsed EPR experiments. The flexibility of the DNP instrument centered around the QO MW

  13. Toward A Dual-Learning Systems Model of Speech Category Learning

    Directory of Open Access Journals (Sweden)

    Bharath eChandrasekaran

    2014-07-01

    Full Text Available More than two decades of work in vision posits the existence of dual-learning systems of category learning. The reflective system uses working memory to develop and test rules for classifying in an explicit fashion, while the reflexive system operates by implicitly associating perception with actions that lead to reinforcement. Dual-learning systems models hypothesize that in learning natural categories, learners initially use the reflective system and, with practice, transfer control to the reflexive system. The role of reflective and reflexive systems in auditory category learning and more specifically in speech category learning has not been systematically examined. In this article we describe a neurobiologically-constrained dual-learning systems theoretical framework that is currently being developed in speech category learning and review recent applications of this framework. Using behavioral and computational modeling approaches, we provide evidence that speech category learning is predominantly mediated by the reflexive learning system. In one application, we explore the effects of normal aging on non-speech and speech category learning. We find an age related deficit in reflective-optimal but not reflexive-optimal auditory category learning. Prominently, we find a large age-related deficit in speech learning. The computational modeling suggests that older adults are less likely to transition from simple, reflective, uni-dimensional rules to more complex, reflexive, multi-dimensional rules. In a second application we summarize a recent study examining auditory category learning in individuals with elevated depressive symptoms. We find a deficit in reflective-optimal and an enhancement in reflexive-optimal auditory category learning. Interestingly, individuals with elevated depressive symptoms also show an advantage in learning speech categories. We end with a brief summary and description of a number of future directions.

  14. Dual hit lipopolysaccharide & oleic acid combination induced rat model of acute lung injury/acute respiratory distress syndrome

    Directory of Open Access Journals (Sweden)

    T N Hagawane

    2016-01-01

    Results: It was noted that the respiratory rate, and tumour necrosis factor-α (TNF-α levels were significantly higher at 4 h in the dual hit group as compared to LPS, OA and control groups. Interleukin-6 (IL-6 levels were significantly higher in the dual hit group as compared to LPS at 8 and 24 h, OA at 8 h and control (at all time intervals group. IL-1β levels were significantly higher in LPS and dual hit groups at all time intervals, but not in OA and control groups. The injury induced in dual hit group was earlier and more sustained as compared to LPS and OA alone. Interpretation & conclusions: The lung pathology and changes in respiration functions produced by the dual hit model were closer to the diagnostic criteria of ALI/ARDS in terms of clinical manifestations and pulmonary injury and the injury persisted longer as compared to LPS and OA single hit model. Therefore, the ARDS model produced by the dual hit method was closer to the diagnostic criteria of ARDS in terms of clinical manifestations and pulmonary injury.

  15. Dual AAV Gene Therapy for Duchenne Muscular Dystrophy with a 7-kb Mini-Dystrophin Gene in the Canine Model.

    Science.gov (United States)

    Kodippili, Kasun; Hakim, Chady H; Pan, Xiufang; Yang, Hsiao T; Yue, Yongping; Zhang, Yadong; Shin, Jin-Hong; Yang, N Nora; Duan, Dongsheng

    2018-03-01

    Dual adeno-associated virus (AAV) technology was developed in 2000 to double the packaging capacity of the AAV vector. The proof of principle has been demonstrated in various mouse models. Yet, pivotal evidence is lacking in large animal models of human diseases. Here we report expression of a 7-kb canine ΔH2-R15 mini-dystrophin gene using a pair of dual AAV vectors in the canine model of Duchenne muscular dystrophy (DMD). The ΔH2-R15 minigene is by far the most potent synthetic dystrophin gene engineered for DMD gene therapy. We packaged minigene dual vectors in Y731F tyrosine-modified AAV-9 and delivered to the extensor carpi ulnaris muscle of a 12-month-old affected dog at the dose of 2 × 10 13 viral genome particles/vector/muscle. Widespread mini-dystrophin expression was observed 2 months after gene transfer. The missing dystrophin-associated glycoprotein complex was restored. Treatment also reduced muscle degeneration and fibrosis and improved myofiber size distribution. Importantly, dual AAV therapy greatly protected the muscle from eccentric contraction-induced force loss. Our data provide the first clear evidence that dual AAV therapy can be translated to a diseased large mammal. Further development of dual AAV technology may lead to effective therapies for DMD and many other diseases in human patients.

  16. A one-dimensional model of resonances with a delta barrier and mass jump

    International Nuclear Information System (INIS)

    Alvarez, J.J.; Gadella, M.; Heras, F.J.H.; Nieto, L.M.

    2009-01-01

    In this Letter, we present a one-dimensional model that includes a hard core at the origin, a Dirac delta barrier at a point in the positive semiaxis and a mass jump at the same point. We study the effect of this mass jump in the behavior of the resonances of the model. We obtain an infinite number of resonances for this situation, showing that for the case of a mass jump the imaginary part of the resonance poles tend to a fixed value depending on the quotient of masses, and demonstrate that none of these resonances is degenerated.

  17. High energy charge exchange np and antipp scattering using the dual fermion model

    International Nuclear Information System (INIS)

    Weigt, G.

    1976-01-01

    The five independent helicity amplitudes Phisub(i)(s, t) calculated by Mandelstam from the Neveu-Schwarz-Ramond model for fermion-antifermion scattering are used in the Regge limit for a phenomenological description of high energy np and antipp charge exchange scattering. A forward spike which widens with increasing energy as well as an energy dependence changing from lower to higher energy data are reproduced by these non-evasive dual Born amplitudes using π, A 2 and rho Regge pole t-channel exchanges. (author)

  18. Dual parton model and the process π + n → pω

    International Nuclear Information System (INIS)

    Bandyopad, P.

    1975-01-01

    The differential cross section for the process π + n→pω has been determined on the basis of the dynamical dual model of hadrons. It is shown that the theoretical prediction is in excellent agreement with the experimental results. Also, it can nicely explain the fact that there is no dip in the differential cross section. Moreover, it is shown that the large value of the density matrix element σsub(oo) in the Gottfried-Jackson frame, as observed in experiments, can be interpreted in a nice way. (author)

  19. Modeling update for the Thirty Meter Telescope laser guide star dual-conjugate adaptive optics system

    Science.gov (United States)

    Gilles, Luc; Wang, Lianqi; Ellerbroek, Brent

    2010-07-01

    This paper describes the modeling efforts undertaken in the past couple of years to derive wavefront error (WFE) performance estimates for the Narrow Field Infrared Adaptive Optics System (NFIRAOS), which is the facility laser guide star (LGS) dual-conjugate adaptive optics (AO) system for the Thirty Meter Telescope (TMT). The estimates describe the expected performance of NFIRAOS as a function of seeing on Mauna Kea, zenith angle, and galactic latitude (GL). They have been developed through a combination of integrated AO simulations, side analyses, allocations, lab and lidar experiments.

  20. Resonant electronic transport through a triple quantum-dot with Λ-type level structure under dual radiation fields

    International Nuclear Information System (INIS)

    Guan, Chun; Xing, Yunhui; Zhang, Chao; Ma, Zhongshui

    2014-01-01

    Due to quantum interference, light can transmit through dense atomic media, a phenomenon known as electromagnetically induced transparency (EIT). We propose that EIT is not limited to light transmission and there is an electronic analog where resonant transparency in charge transport in an opaque structure can be induced by electromagnetic radiation. A triple-quantum-dots system with Λ-type level structure is generally opaque due to the level in the center dot being significantly higher and therefore hopping from the left dot to the center dot is almost forbidden. We demonstrate that an electromagnetically induced electron transparency (EIET) in charge of transport can indeed occur in the Λ-type system. The direct evidence of EIET is that an electron can travel from the left dot to the right dot, while the center dot apparently becomes invisible. We analyze EIET and the related shot noise in both the zero and strong Coulomb blockade regimes. It is found that the EIET (position, height, and symmetry) can be tuned by several controllable parameters of the radiation fields, such as the Rabi frequencies and detuning frequencies. The result offers a transparency/opaque tuning technique in charge transport using interfering radiation fields

  1. Magnetic resonance spectroscopy of traumatic brain in SD rats model

    International Nuclear Information System (INIS)

    Li Ke; Li Yangbin; Li Zhiming; Huang Yong; Li Bin; Lu Guangming

    2009-01-01

    Objective: To assess the value and prospect of magnetic resonance spectroscopy (MRS) in early diagnosis of traumatic brain with traumatic brain model in SD rats. Methods: Traumatic brain modal was established in 40 male SD rats utilizing a weigh-drop device, and MRS was performed before trauma and 4,8,24 and 48 hours after trauma. The ratio of N-acetylaspartate/creatine (NAA/Ct) and choline/creatine (Cho/Cr) were calculated and compared with pathological findings respectively. Results: Axonal changes were confirmed in microscopic study 4 hours after injury. The ratio of NAA/Ct decreased distinctly at 4 hours after trauma, followed by a steadily recover at 8 hours, and no significant change from 24h to 48h. There was no significant change in the ratio of Cho/Cr before and after trauma. Conclusion: MRS can be used to monitor the metabolic changes of brain non-invasively. MRS could play a positive role in early diagnosis, prognosis and follow-up of traumatic brain. (authors)

  2. Model for decays of boson resonances with arbitrary spins

    International Nuclear Information System (INIS)

    Grigoryan, A.A.; Ivanov, N.Ya.

    1985-01-01

    A formula for the width of resonance with spin J decay into hadrons with arbitrary spins is derived. This width is expressed via S-channel helicity residues of Regge trajectory α J where the resonance J lies. Using the quark-gluon picture predictions for the coupling of quarks with Regge trajectories and SU(6)-classification of hadrons this formula is applied to calculate the widths of decays of resonances, which lie on the vector and tensor trajectories, into pseudoscalar and vector, two vectors and NN-bar-pair

  3. A dual-factor model of mental health: toward a more comprehensive understanding of youth functioning.

    Science.gov (United States)

    Antaramian, Susan P; Scott Huebner, E; Hills, Kimberly J; Valois, Robert F

    2010-10-01

    Traditional mental health models focus on psychological problems and distress; accordingly, health is viewed as the absence of illness or disability. In contrast, a dual-factor model of mental health incorporates both indicators of positive subjective well-being (SWB) and measures of psychopathological symptoms to comprehensively determine an individual's psychological adjustment. This study used such a dual-factor model to measure the mental health status of young adolescents. A total of 764 middle school students were classified into one of four distinct groups based on having high or low psychopathology and high or low SWB. Furthermore, group differences in student engagement, academic achievement, and environmental support for learning were investigated. Results demonstrated the existence of a traditionally neglected group of adolescents (low SWB and low psychopathology) who are nonetheless at risk for academic and behavior problems in school and who performed no better than the most troubled group of adolescents. Overall, both the presence of positive well-being and the absence of symptoms were necessary for ensuring the most advantageous school performance. These results highlight the importance of incorporating positive indicators of well-being along with traditional negative factors in more fully understanding relationships between individuals' mental health and educational outcomes. © 2010 American Orthopsychiatric Association.

  4. Dual energy CT at the synchrotron: A piglet model for neurovascular research

    International Nuclear Information System (INIS)

    Schueltke, Elisabeth; Kelly, Michael E.; Nemoz, Christian; Fiedler, Stefan; Ogieglo, Lissa; Crawford, Paul; Paterson, Jessica; Beavis, Cole; Esteve, Francois; Brochard, Thierry; Renier, Michel; Requardt, Herwig; Dallery, Dominique; Le Duc, Geraldine; Meguro, Kotoo

    2011-01-01

    Background: Although the quality of imaging techniques available for neurovascular angiography in the hospital environment has significantly improved over the last decades, the equipment used for clinical work is not always suited for neurovascular research in animal models. We have previously investigated the suitability of synchrotron-based K-edge digital subtraction angiography (KEDSA) after intravenous injection of iodinated contrast agent for neurovascular angiography in radiography mode in both rabbit and pig models. We now have used the KEDSA technique for the acquisition of three-dimensional images and dual energy CT. Materials and methods: All experiments were conducted at the biomedical beamline ID 17 of the European Synchrotron Radiation Facility (ESRF). A solid state germanium (Ge) detector was used for the acquisition of image pairs at 33.0 and 33.3 keV. Three-dimensional images were reconstructed from an image series containing 60 single images taken throughout a full rotation of 360 o . CT images were reconstructed from two half-acquisitions with 720 projections each. Results: The small detector field of view was a limiting factor in our experiments. Nevertheless, we were able to show that dual energy CT using the KEDSA technique available at ID 17 is suitable for neurovascular research in animal models.

  5. Dual energy CT at the synchrotron: a piglet model for neurovascular research.

    Science.gov (United States)

    Schültke, Elisabeth; Kelly, Michael E; Nemoz, Christian; Fiedler, Stefan; Ogieglo, Lissa; Crawford, Paul; Paterson, Jessica; Beavis, Cole; Esteve, Francois; Brochard, Thierry; Renier, Michel; Requardt, Herwig; Dallery, Dominique; Le Duc, Geraldine; Meguro, Kotoo

    2011-08-01

    Although the quality of imaging techniques available for neurovascular angiography in the hospital environment has significantly improved over the last decades, the equipment used for clinical work is not always suited for neurovascular research in animal models. We have previously investigated the suitability of synchrotron-based K-edge digital subtraction angiography (KEDSA) after intravenous injection of iodinated contrast agent for neurovascular angiography in radiography mode in both rabbit and pig models. We now have used the KEDSA technique for the acquisition of three-dimensional images and dual energy CT. All experiments were conducted at the biomedical beamline ID 17 of the European Synchrotron Radiation Facility (ESRF). A solid state germanium (Ge) detector was used for the acquisition of image pairs at 33.0 and 33.3 keV. Three-dimensional images were reconstructed from an image series containing 60 single images taken throughout a full rotation of 360°. CT images were reconstructed from two half-acquisitions with 720 projections each. The small detector field of view was a limiting factor in our experiments. Nevertheless, we were able to show that dual energy CT using the KEDSA technique available at ID 17 is suitable for neurovascular research in animal models. Copyright © 2010. Published by Elsevier Ireland Ltd.

  6. A passive dual-circulator based transmit/receive switch for use with reflection resonators in pulse EPR

    Science.gov (United States)

    Subramanian, V. S.; Epel, Boris; Mailer, Colin; Halpern, Howard J.

    2009-01-01

    In order to protect the low noise amplifier (LNA) in the receive arm of a pulsed 250 MHz EPR bridge, it is necessary to install as much isolation as possible between the power exciting the spin system and the LNA when high power is present in the receive arm of the bridge, while allowing the voltage induced by the magnetization in the spin sample to be passed undistorted and undiminished to the LNA once power is reduced below the level that can cause a LNA damage. We discuss a combination of techniques to accomplish this involving the power-routing circulator in the bridge, a second circulator acting as an isolator with passive shunt PIN diodes immediately following the second circulator. The low resistance of the forward biased PIN diode passively generates an impedance mismatch at the second circulator output port during the high power excitation pulse and resonator ring down. The mismatch reflects the high power to the remaining port of the second circulator, dumping it into a system impedance matched load. Only when the power diminishes below the diode conduction threshold will the resistance of the PIN diode rise to a value much higher than the system impedance. This brings the device into conduction mode. We find that the present design passively limits the output power to 14 dBm independent of the input power. For high input power levels the isolation may exceed 60 dB. This level of isolation is sufficient to fully protect the LNA of pulse EPR bridge. PMID:20052312

  7. Thermodynamic modeling of LPG combustion in dual-fuel engines; Modelisation thermodynamique de la combustion du GPL dans les moteurs dual-fuel

    Energy Technology Data Exchange (ETDEWEB)

    Bilcan, A.; Le Corre, O.; Tazerout, M. [Ecole des Mines de Nantes, 44 (France); Ramesh, A. [Indian Institute of Technology Madras (India)

    2002-07-01

    Dual-fuel engines are modified diesel engines burning simultaneously two fuels inside the cylinder: a gaseous one, called the primary fuel and a liquid one, called the pilot fuel. The thermal efficiency of the dual-fuel engine and of the diesel engine are comparable; the level of emissions is lower compared to the diesel one. This article presents a new procedure for the combustion modeling in a LPG-diesel dual-fuel engine. The procedures deals with the ignition delay period and with the rate of heat release inside the cylinder. This procedure is validated using experimental data issued front a collaboration with the Indian Institute of Technology from Madras, India. The used engine is a single-cylinder one, air-cooled. The pilot fuel is direct injected inside the cylinder The engine was run at constant load and with different diesel substitutions, i.e. for different air to fuel ratios of the primary fuel-air mixture. The general error of the procedure is below 10%. (authors)

  8. Analysis and Modeling of Integrated Magnetics for LLC resonant Converters

    DEFF Research Database (Denmark)

    Li, Mingxiao; Ouyang, Ziwei; Zhao, Bin

    2017-01-01

    Shunt-inserted transformers are widely used toobtain high leakage inductance. This paper investigates thismethod in depth to make it applicable to integrate resonantinductor for the LLC resonant converters. The analysis andmodel of magnetizing inductance and leakage inductance forshunt...... transformers can provide a significantdifference. The way to obtain the desirable magnetizing andleakage inductance value for LLC resonant converters issimplified by the creation of air gaps together with a magneticshunt. The calculation and relation are validated by finiteelement analysis (FEA) simulations...

  9. Two-Mode Resonator and Contact Model for Standing Wave Piezomotor

    DEFF Research Database (Denmark)

    Andersen, B.; Blanke, Mogens; Helbo, J.

    2001-01-01

    The paper presents a model for a standing wave piezoelectric motor with a two bending mode resonator. The resonator is modelled using Hamilton's principle and the Rayleigh-Ritz method. The contact is modelled using the Lagrange Multiplier method under the assumption of slip and it is showed how...... to solve the set of differential-algebraic equations. Detailed simulations show resonance frequencies as function of the piezoelement's position, tip trajectories and contact forces. The paper demonstrates that contact stiffness and stick should be included in such model to obtain physically realistic...

  10. Charge transport model in nanodielectric composites based on quantum tunneling mechanism and dual-level traps

    Energy Technology Data Exchange (ETDEWEB)

    Li, Guochang; Chen, George, E-mail: gc@ecs.soton.ac.uk, E-mail: sli@mail.xjtu.edu.cn [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China); School of Electronic and Computer Science, University of Southampton, Southampton SO17 1BJ (United Kingdom); Li, Shengtao, E-mail: gc@ecs.soton.ac.uk, E-mail: sli@mail.xjtu.edu.cn [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China)

    2016-08-08

    Charge transport properties in nanodielectrics present different tendencies for different loading concentrations. The exact mechanisms that are responsible for charge transport in nanodielectrics are not detailed, especially for high loading concentration. A charge transport model in nanodielectrics has been proposed based on quantum tunneling mechanism and dual-level traps. In the model, the thermally assisted hopping (TAH) process for the shallow traps and the tunnelling process for the deep traps are considered. For different loading concentrations, the dominant charge transport mechanisms are different. The quantum tunneling mechanism plays a major role in determining the charge conduction in nanodielectrics with high loading concentrations. While for low loading concentrations, the thermal hopping mechanism will dominate the charge conduction process. The model can explain the observed conductivity property in nanodielectrics with different loading concentrations.

  11. Clinical cognition and diagnostic error: applications of a dual process model of reasoning.

    Science.gov (United States)

    Croskerry, Pat

    2009-09-01

    Both systemic and individual factors contribute to missed or delayed diagnoses. Among the multiple factors that impact clinical performance of the individual, the caliber of cognition is perhaps the most relevant and deserves our attention and understanding. In the last few decades, cognitive psychologists have gained substantial insights into the processes that underlie cognition, and a new, universal model of reasoning and decision making has emerged, Dual Process Theory. The theory has immediate application to medical decision making and provides an overall schema for understanding the variety of theoretical approaches that have been taken in the past. The model has important practical applications for decision making across the multiple domains of healthcare, and may be used as a template for teaching decision theory, as well as a platform for future research. Importantly, specific operating characteristics of the model explain how diagnostic failure occurs.

  12. Dual-model automatic detection of nerve-fibres in corneal confocal microscopy images.

    Science.gov (United States)

    Dabbah, M A; Graham, J; Petropoulos, I; Tavakoli, M; Malik, R A

    2010-01-01

    Corneal Confocal Microscopy (CCM) imaging is a non-invasive surrogate of detecting, quantifying and monitoring diabetic peripheral neuropathy. This paper presents an automated method for detecting nerve-fibres from CCM images using a dual-model detection algorithm and compares the performance to well-established texture and feature detection methods. The algorithm comprises two separate models, one for the background and another for the foreground (nerve-fibres), which work interactively. Our evaluation shows significant improvement (p approximately 0) in both error rate and signal-to-noise ratio of this model over the competitor methods. The automatic method is also evaluated in comparison with manual ground truth analysis in assessing diabetic neuropathy on the basis of nerve-fibre length, and shows a strong correlation (r = 0.92). Both analyses significantly separate diabetic patients from control subjects (p approximately 0).

  13. Joint Pricing and Purchasing Decisions for the Dual-Channel Newsvendor Model with Partial Information

    Directory of Open Access Journals (Sweden)

    Jixiang Zhou

    2014-01-01

    Full Text Available We investigate a joint pricing and purchasing problem for the dual-channel newsvendor model with the assumption that only the mean and variance of the demand are known. The newsvendor in our model simultaneously distributes a single product through traditional retail and Internet. A robust optimization approach that maximizes the worst-case profit is adapted under the aforementioned conditions to model demand uncertainty and linear clearing functions that characterize the relationship between demand and prices. We obtain a close-form expression for the robust optimal policy. Illustrative simulations and numerical experiments show the effects of several parameters on the optimal policy and on newsvendor performance. Finally, we determine that the gap between newsvendor performance under demand certainty and uncertainty is minimal, which shows that the robust approach can significantly improve performance.

  14. Complexity analysis of dual-channel game model with different managers' business objectives

    Science.gov (United States)

    Li, Ting; Ma, Junhai

    2015-01-01

    This paper considers dual-channel game model with bounded rationality, using the theory of bifurcations of dynamical system. The business objectives of retailers are assumed to be different, which is closer to reality than previous studies. We study the local stable region of Nash equilibrium point and find that business objectives can expand the stable region and play an important role in price strategy. One interesting finding is that a fiercer competition tends to stabilize the Nash equilibrium. Simulation shows the complex behavior of two dimensional dynamic system, we find period doubling bifurcation and chaos phenomenon. We measure performances of the model in different period by using the index of average profit. The results show that unstable behavior in economic system is often an unfavorable outcome. So this paper discusses the application of adaptive adjustment mechanism when the model exhibits chaotic behavior and then allows the retailers to eliminate the negative effects.

  15. Data Analytics Based Dual-Optimized Adaptive Model Predictive Control for the Power Plant Boiler

    Directory of Open Access Journals (Sweden)

    Zhenhao Tang

    2017-01-01

    Full Text Available To control the furnace temperature of a power plant boiler precisely, a dual-optimized adaptive model predictive control (DoAMPC method is designed based on the data analytics. In the proposed DoAMPC, an accurate predictive model is constructed adaptively by the hybrid algorithm of the least squares support vector machine and differential evolution method. Then, an optimization problem is constructed based on the predictive model and many constraint conditions. To control the boiler furnace temperature, the differential evolution method is utilized to decide the control variables by solving the optimization problem. The proposed method can adapt to the time-varying situation by updating the sample data. The experimental results based on practical data illustrate that the DoAMPC can control the boiler furnace temperature with errors of less than 1.5% which can meet the requirements of the real production process.

  16. Ligand-based modeling of Akt3 lead to potent dual Akt1/Akt3 inhibitor.

    Science.gov (United States)

    Al-Sha'er, Mahmoud A; Taha, Mutasem O

    2018-02-13

    Akt1 and Akt3 are important serine/threonine-specific protein kinases involved in G2 phase required by cancer cells to maintain cell cycle and to prevent cell death. Accordingly, inhibitors of these kinases should have potent anti-cancer properties. This prompted us to use pharmacophore/QSAR modeling to identify optimal binding models and physicochemical descriptors that explain bioactivity variation within a set of 74 diverse Akt3 inhibitors. Two successful orthogonal pharmacophores were identified and further validated using receiver operating characteristic (ROC) curve analyses. The pharmacophoric models and associated QSAR equation were applied to screen the national cancer institute (NCI) list of compounds for new Akt3 inhibitors. Six hits showed significant experimental anti-Akt3 IC 50 values, out of which one compound exhibited dual low micromolar anti-Akt1 and anti-Akt3 inhibitory profiles. Copyright © 2018 Elsevier Inc. All rights reserved.

  17. 2-Deoxy-D-Glucose Modified Magnetic Nanoparticles with Dual Functional Properties: Nanothermotherapy and Magnetic Resonance Imaging.

    Science.gov (United States)

    Zhao, Lingyun; Zheng, Yajing; Yan, Hao; Xie, WenSheng; Sun, Xiaodan; Li, Ning; Tang, Jintian

    2016-03-01

    Superparamagnetic iron oxide nanoparticles (SPIONs) with appropriate surface chemistry have attracted wild attention in medical and biological application because of their current and potential usefulness such as magnetic resonance imaging (MRI) contrast enhancement, magnetic mediated hyperthermia (MMH), immunoassay, and in drug delivery, etc. In this study, we investigated the MRI contrast agents and MMH mediators properties of the novel 2-deoxy-D-glucose (2-DG) modified SPIONs. As a non-metabolizable glucose analogue, 2-DG can block glycolysis and inhibits protein glycosylation. Moreover, SPIONs coated with 2-DG molecules can be particularly attractive to resource-hungry cancer cells, therefore to realize the targeting strategy for the SPIONs. SPIONs with amino silane as the capping agent for amino-group surface modification were synthesized by the chemical co-precipitation method with modification. Glutaraldehyde was further applied as an activation agent through which 2-DG was conjugated to the amino-coated SPIONs. Physicochemical characterizations of the 2-DG-SPIONs, such as surface morphology, surface charge and magnetic properties were investigated by Transmission Electron Microscopy (TEM), ζ-Potential and Vibrating Sample Magnetometer (VSM), etc. Magnetic inductive heating characteristics of the 2-DG-SPIONs were analyzed by exposing the SPIONs suspension (magnetic fluid) under alternative magnetic field (AMF). U-251 human glioma cells with expression of glucose transport proteins type 1 and 3 (GLUT1 and GLUT 3), and L929 murine fibroblast cell as negative control, were employed to study the effect of 2-DG modification on the cell uptake for SPIONs. TEM images for ultra-thin sections as well as ICP-MS were applied to evaluate the SPIONs internalization within the cells. In vitro MRI was performed after cells were co-incubated with SPIONs and the T2 relaxation time was measured and compared. The results demonstrate that 2-DG-SPIONs were supermagnetic and in

  18. Environmental Light and Its Relationship with Electromagnetic Resonances of Biomolecular Interactions, as Predicted by the Resonant Recognition Model

    Directory of Open Access Journals (Sweden)

    Irena Cosic

    2016-06-01

    Full Text Available The meaning and influence of light to biomolecular interactions, and consequently to health, has been analyzed using the Resonant Recognition Model (RRM. The RRM proposes that biological processes/interactions are based on electromagnetic resonances between interacting biomolecules at specific electromagnetic frequencies within the infra-red, visible and ultra-violet frequency ranges, where each interaction can be identified by the certain frequency critical for resonant activation of specific biological activities of proteins and DNA. We found that: (1 the various biological interactions could be grouped according to their resonant frequency into super families of these functions, enabling simpler analyses of these interactions and consequently analyses of influence of electromagnetic frequencies to health; (2 the RRM spectrum of all analyzed biological functions/interactions is the same as the spectrum of the sun light on the Earth, which is in accordance with fact that life is sustained by the sun light; (3 the water is transparent to RRM frequencies, enabling proteins and DNA to interact without loss of energy; (4 the spectrum of some artificial sources of light, as opposed to the sun light, do not cover the whole RRM spectrum, causing concerns for disturbance to some biological functions and consequently we speculate that it can influence health.

  19. Acting in solidarity: Testing an extended dual pathway model of collective action by bystander group members.

    Science.gov (United States)

    Saab, Rim; Tausch, Nicole; Spears, Russell; Cheung, Wing-Yee

    2015-09-01

    We examined predictors of collective action among bystander group members in solidarity with a disadvantaged group by extending the dual pathway model of collective action, which proposes one efficacy-based and one emotion-based path to collective action (Van Zomeren, Spears, Fischer, & Leach, 2004). Based on two proposed functions of social identity performance (Klein, Spears, & Reicher, 2007), we distinguished between the efficacy of collective action at consolidating the identity of a protest movement and its efficacy at achieving social change (political efficacy). We expected identity consolidation efficacy to positively predict collective action tendencies directly and indirectly via political efficacy. We also expected collective action tendencies to be positively predicted by moral outrage and by sympathy in response to disadvantaged outgroup's suffering. These hypotheses were supported in two surveys examining intentions to protest for Palestine in Britain (Study 1), and intentions to attend the June 4th vigil in Hong Kong to commemorate the Tiananmen massacre among a sample of Hong Kong citizens (Study 2). The contributions of these findings to research on the dual pathway model of collective action and the different functions of collective action are discussed. © 2014 The British Psychological Society.

  20. Global Model for Asymmetric, Diode-Type Dual Frequency Capacitive Discharge

    Science.gov (United States)

    Kim, Jisoo; Lieberman, M. A.; Lichtenberg, A. J.

    2003-10-01

    Dual frequency capacitive reactors can have desirable properties for dielectric etch: low cost, robust uniformity over large areas, and control of dissociation. In the ideal case, the high frequency power controls the plasma density (ion flux) and the low frequency voltage controls the ion bombarding energy. Typical operating conditions are: discharge radius 15-30 cm, length 1-3 cm, pressure 30-200 mTorr, high frequency 27.1-160 MHz, low frequency 2-13.6 MHz, and powers of 500-3000 W for both high and low frequencies. The decoupling of the high and low frequencies is an important feature of dual frequency capacitive discharges. In this work, we describe a global (volume-averaged) model having different top and bottom plate areas that incorporates particle balance, and ohmic and stochastic heating for high and low frequencies. The model is used to obtain the decoupling of high and low frequencies and to investigate limitations to ideal decoupling. Support provided by Lam Research, NSF Grant ECS-0139956, California industries, and UC-SMART Contract SM99-10051.

  1. Optimum filter selection for Dual Energy X-ray Applications through Analytical Modeling

    International Nuclear Information System (INIS)

    Koukou, V; Martini, N; Sotiropoulou, P; Nikiforidis, G; Michail, C; Kalyvas, N; Kandarakis, I; Fountos, G

    2015-01-01

    In this simulation study, an analytical model was used in order to determine the optimal acquisition parameters for a dual energy breast imaging system. The modeled detector system, consisted of a 33.91mg/cm 2 Gd 2 O 2 S:Tb scintillator screen, placed in direct contact with a high resolution CMOS sensor. Tungsten anode X-ray spectra, filtered with various filter materials and filter thicknesses were examined for both the low- and high-energy beams, resulting in 3375 combinations. The selection of these filters was based on their K absorption edge (K-edge filtering). The calcification signal-to-noise ratio (SNR tc ) and the mean glandular dose (MGD) were calculated. The total mean glandular dose was constrained to be within acceptable levels. Optimization was based on the maximization of the SNR tc /MGD ratio. The results showed that the optimum spectral combination was 40kVp with added beam filtration of 100 μm Ag and 70kVp Cu filtered spectrum of 1000 μm for the low- and high-energy, respectively. The minimum detectable calcification size was 150 μm. Simulations demonstrate that this dual energy X-ray technique could enhance breast calcification detection. (paper)

  2. An analytical model for cumulative infiltration into a dual-permeability media

    Science.gov (United States)

    Peyrard, Xavier; Lassabatere, Laurent; Angulo-Jaramillo, Rafael; Simunek, Jiri

    2010-05-01

    Modeling of water infiltration into the vadose zone is important for better understanding of movement of water-transported contaminants. There is a great need to take into account the soil heterogeneity and, in particular, the presence of macropores or cracks that could generate preferential flow. Several mathematical models have been proposed to describe unsaturated flow through heterogeneous soils. The dual-permeability model assumes that flow is governed by Richards equation in both porous regions (matrix and fractures). Water can be exchanged between the two regions following a first-order rate law. A previous study showed that the influence of the hydraulic conductivity of the matrix/macropore interface had a little influence on cumulative infiltration at the soil surface. As a result, one could consider the surface infiltration for a specific case of no water exchange between the fracture and matrix regions (a case of zero interfacial hydraulic conductivity). In such a case, water infiltration can be considered to be the sum of the cumulative infiltrations into the matrix and the fractures. On the basis of analytical models for each sub domain (matrix and fractures), an analytical model is proposed for the entire dual-porosity system. A sensitivity analysis is performed to characterize the influence of several factors, such as the saturated hydraulic conductivity ratio, the water pressure scale parameter ratio, and the saturated volumetric water content scale ratio, on the total cumulative infiltration. Such an analysis greatly helps in quantifying the impact of macroporosity and fractures on water infiltration, which can be of great interest for hydrological models.

  3. A statistical model for combustion resonance from a DI diesel engine with applications

    Science.gov (United States)

    Bodisco, Timothy; Low Choy, Samantha; Masri, Assaad; Brown, Richard J.

    2015-08-01

    Introduced in this paper is a Bayesian model for isolating the resonant frequency from combustion chamber resonance. The model shown in this paper focused on characterising the initial rise in the resonant frequency to investigate the rise of in-cylinder bulk temperature associated with combustion. By resolving the model parameters, it is possible to determine: the start of pre-mixed combustion, the start of diffusion combustion, the initial resonant frequency, the resonant frequency as a function of crank angle, the in-cylinder bulk temperature as a function of crank angle and the trapped mass as a function of crank angle. The Bayesian method allows for individual cycles to be examined without cycle-averaging-allowing inter-cycle variability studies. Results are shown for a turbo-charged, common-rail compression ignition engine run at 2000 rpm and full load.

  4. Numerical analysis of the resonance mechanism of the lumped parameter system model for acoustic mine detection

    International Nuclear Information System (INIS)

    Wang Chi; Zhou Yu-Qiu; Shen Gao-Wei; Wu Wen-Wen; Ding Wei

    2013-01-01

    The method of numerical analysis is employed to study the resonance mechanism of the lumped parameter system model for acoustic mine detection. Based on the basic principle of the acoustic resonance technique for mine detection and the characteristics of low-frequency acoustics, the ''soil-mine'' system could be equivalent to a damping ''mass-spring'' resonance model with a lumped parameter analysis method. The dynamic simulation software, Adams, is adopted to analyze the lumped parameter system model numerically. The simulated resonance frequency and anti-resonance frequency are 151 Hz and 512 Hz respectively, basically in agreement with the published resonance frequency of 155 Hz and anti-resonance frequency of 513 Hz, which were measured in the experiment. Therefore, the technique of numerical simulation is validated to have the potential for analyzing the acoustic mine detection model quantitatively. The influences of the soil and mine parameters on the resonance characteristics of the soil—mine system could be investigated by changing the parameter setup in a flexible manner. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

  5. The computer simulation of the resonant network for the B-factory model power supply

    International Nuclear Information System (INIS)

    Zhou, W.; Endo, K.

    1993-07-01

    A high repetition model power supply and the resonant magnet network are simulated with the computer in order to check and improve the design of the power supply for the B-factory booster. We put our key point on a transient behavior of the power supply and the resonant magnet network. The results of the simulation are given. (author)

  6. A Dual Regime Reactive Transport Model for Simulation of High Level Waste Tank Closure Scenarios - 13375

    International Nuclear Information System (INIS)

    Sarkar, Sohini; Kosson, David S.; Brown, Kevin; Garrabrants, Andrew C.; Meeussen, Hans; Van der Sloot, Hans

    2013-01-01

    A numerical simulation framework is presented in this paper for estimating evolution of pH and release of major species from grout within high-level waste tanks after closure. This model was developed as part of the Cementitious Barriers Partnership. The reactive transport model consists of two parts - (1) transport of species, and (2) chemical reactions. The closure grout can be assumed to have varying extents of cracking and composition for performance assessment purposes. The partially or completely degraded grouted tank is idealized as a dual regime system comprising of a mobile region having solid materials with cracks and macro-pores, and an immobile/stagnant region having solid matrix with micropores. The transport profiles of the species are calculated by incorporating advection of species through the mobile region, diffusion of species through the immobile/stagnant region, and exchange of species between the mobile and immobile regions. A geochemical speciation code in conjunction with the pH dependent test data for a grout material is used to obtain a mineral set that best describes the trends in the test data of the major species. The dual regime reactive transport model predictions are compared with the release data from an up-flow column percolation test. The coupled model is then used to assess effects of crack state of the structure, rate and composition of the infiltrating water on the pH evolution at the grout-waste interface. The coupled reactive transport model developed in this work can be used as part of the performance assessment process for evaluating potential risks from leaching of a cracked tank containing elements of human health and environmental concern. (authors)

  7. A Dual Regime Reactive Transport Model for Simulation of High Level Waste Tank Closure Scenarios - 13375

    Energy Technology Data Exchange (ETDEWEB)

    Sarkar, Sohini; Kosson, David S.; Brown, Kevin; Garrabrants, Andrew C. [Consortium for Risk Assessment with Stakeholder Participation - CRESP, Vanderbilt University, Nashville, TN (United States); Meeussen, Hans [Consortium for Risk Assessment with Stakeholder Participation - CRESP, Nuclear Research and Consultancy Group, Petten (Netherlands); Van der Sloot, Hans [Consortium for Risk Assessment with Stakeholder Participation - CRESP, Hans Van der Sloot Consultancy (Netherlands)

    2013-07-01

    A numerical simulation framework is presented in this paper for estimating evolution of pH and release of major species from grout within high-level waste tanks after closure. This model was developed as part of the Cementitious Barriers Partnership. The reactive transport model consists of two parts - (1) transport of species, and (2) chemical reactions. The closure grout can be assumed to have varying extents of cracking and composition for performance assessment purposes. The partially or completely degraded grouted tank is idealized as a dual regime system comprising of a mobile region having solid materials with cracks and macro-pores, and an immobile/stagnant region having solid matrix with micropores. The transport profiles of the species are calculated by incorporating advection of species through the mobile region, diffusion of species through the immobile/stagnant region, and exchange of species between the mobile and immobile regions. A geochemical speciation code in conjunction with the pH dependent test data for a grout material is used to obtain a mineral set that best describes the trends in the test data of the major species. The dual regime reactive transport model predictions are compared with the release data from an up-flow column percolation test. The coupled model is then used to assess effects of crack state of the structure, rate and composition of the infiltrating water on the pH evolution at the grout-waste interface. The coupled reactive transport model developed in this work can be used as part of the performance assessment process for evaluating potential risks from leaching of a cracked tank containing elements of human health and environmental concern. (authors)

  8. New normative standards of conditional reasoning and the dual-source model.

    Science.gov (United States)

    Singmann, Henrik; Klauer, Karl Christoph; Over, David

    2014-01-01

    There has been a major shift in research on human reasoning toward Bayesian and probabilistic approaches, which has been called a new paradigm. The new paradigm sees most everyday and scientific reasoning as taking place in a context of uncertainty, and inference is from uncertain beliefs and not from arbitrary assumptions. In this manuscript we present an empirical test of normative standards in the new paradigm using a novel probabilized conditional reasoning task. Our results indicated that for everyday conditional with at least a weak causal connection between antecedent and consequent only the conditional probability of the consequent given antecedent contributes unique variance to predicting the probability of conditional, but not the probability of the conjunction, nor the probability of the material conditional. Regarding normative accounts of reasoning, we found significant evidence that participants' responses were confidence preserving (i.e., p-valid in the sense of Adams, 1998) for MP inferences, but not for MT inferences. Additionally, only for MP inferences and to a lesser degree for DA inferences did the rate of responses inside the coherence intervals defined by mental probability logic (Pfeifer and Kleiter, 2005, 2010) exceed chance levels. In contrast to the normative accounts, the dual-source model (Klauer et al., 2010) is a descriptive model. It posits that participants integrate their background knowledge (i.e., the type of information primary to the normative approaches) and their subjective probability that a conclusion is seen as warranted based on its logical form. Model fits showed that the dual-source model, which employed participants' responses to a deductive task with abstract contents to estimate the form-based component, provided as good an account of the data as a model that solely used data from the probabilized conditional reasoning task.

  9. New Normative Standards of Conditional Reasoning and the Dual-Source Model

    Directory of Open Access Journals (Sweden)

    Henrik eSingmann

    2014-04-01

    Full Text Available There has been a major shift in research on human reasoning towards Bayesian and probabilistic approaches, which has been called a new paradigm. The new paradigm sees most everyday and scientific reasoning as taking place in a context of uncertainty, and inference is from uncertain beliefs and not from arbitrary assumptions. In this manuscript we present an empirical test of normative standards in the new paradigm using a novel probabilized conditional reasoning task. Our results indicated that for everyday conditional with at least a weak causal connection between antecedent and consequent only the conditional probability of the consequent given antecedent contributes unique variance to predicting the probability of conditional, but not the probability of the conjunction, nor the probability of the material conditional. Regarding normative accounts of reasoning, we found significant evidence that participants' responses were confidence preserving (i.e., p-valid in the sense of Adams, 1998 for MP inferences, but not for MT inferences. Additionally, only for MP inferences and to a lesser degree for DA inferences did the rate of responses inside the coherence intervals defined by mental probability logic (Pfeifer & Kleiter, 2005, 2010 exceed chance levels. In contrast to the normative accounts, the dual-source model (Klauer, Beller, & Hütter, 2010 is a descriptive model. It posits that participants integrate their background knowledge (i.e., the type of information primary to the normative approaches and their subjective probability that a conclusion is seen as warranted based on its logical form. Model fits showed that the dual-source model, which employed participants' responses to a deductive task with abstract contents to estimate the form-based component, provided as good an account of the data as a model that solely used data from the probabilized conditional reasoning task.

  10. Inverse modeling of multicomponent reactive transport through single and dual porosity media

    Science.gov (United States)

    Samper, Javier; Zheng, Liange; Fernández, Ana María; Montenegro, Luis

    2008-06-01

    Compacted bentonite is foreseen as buffer material for high-level radioactive waste in deep geological repositories because it provides hydraulic isolation, chemical stability, and radionuclide sorption. A wide range of laboratory tests were performed within the framework of FEBEX ( Full-scale Engineered Barrier EXperiment) project to characterize buffer properties and develop numerical models for FEBEX bentonite. Here we present inverse single and dual-continuum multicomponent reactive transport models of a long-term permeation test performed on a 2.5 cm long sample of FEBEX bentonite. Initial saline bentonite porewater was flushed with 5.5 pore volumes of fresh granitic water. Water flux and chemical composition of effluent waters were monitored during almost 4 years. The model accounts for solute advection and diffusion and geochemical reactions such as aqueous complexation, acid-base, cation exchange, protonation/deprotonation by surface complexation and dissolution/precipitation of calcite, chalcedony and gypsum. All of these processes are assumed at local equilibrium. Similar to previous studies of bentonite porewater chemistry on batch systems which attest the relevance of protonation/deprotonation on buffering pH, our results confirm that protonation/deprotonation is a key process in maintaining a stable pH under dynamic transport conditions. Breakthrough curves of reactive species are more sensitive to initial porewater concentration than to effective diffusion coefficient. Optimum estimates of initial porewater chemistry of saturated compacted FEBEX bentonite are obtained by solving the inverse problem of multicomponent reactive transport. While the single-continuum model reproduces the trends of measured data for most chemical species, it fails to match properly the long tails of most breakthrough curves. Such limitation is overcome by resorting to a dual-continuum reactive transport model.

  11. Detecting Intracranial Hemorrhage Using Automatic Tube Current Modulation With Advanced Modeled Iterative Reconstruction in Unenhanced Head Single- and Dual-Energy Dual-Source CT.

    Science.gov (United States)

    Scholtz, Jan-Erik; Wichmann, Julian L; Bennett, Dennis W; Leithner, Doris; Bauer, Ralf W; Vogl, Thomas J; Bodelle, Boris

    2017-05-01

    The purpose of our study was to determine diagnostic accuracy, image quality, and radiation dose of low-dose single- and dual-energy unenhanced third-generation dual-source head CT for detection of intracranial hemorrhage (ICH). A total of 123 patients with suspected ICH were examined using a dual-source 192-MDCT scanner. Standard-dose 120-kVp single-energy CT (SECT; n = 36) and 80-kVp and 150-kVp dual-energy CT (DECT; n = 30) images were compared with low-dose SECT (n = 32) and DECT (n = 25) images obtained using automated tube current modulation (ATCM). Advanced modeled iterative reconstruction (ADMIRE) was used for all protocols. Detection of ICH was performed by three readers who were blinded to the image acquisition parameters of each image series. Image quality was assessed both quantitatively and qualitatively. Interobserver agreement was calculated using the Fleiss kappa. Radiation dose was measured as dose-length product (DLP). Detection of ICH was excellent (sensitivity, 94.9-100%; specificity, 94.7-100%) in all protocols (p = 1.00) with perfect interobserver agreement (0.83-0.96). Qualitative ratings showed significantly better ratings for both standard-dose protocols regarding gray matter-to-white matter contrast (p ≤ 0.014), whereas highest gray matter-to-white matter contrast-to-noise ratio was observed with low-dose DECT images (p ≥ 0.057). The lowest posterior fossa artifact index was measured for standard-dose DECT, which showed significantly lower values compared with low-dose protocols (p ≤ 0.034). Delineation of ventricular margins and sharpness of subarachnoidal spaces were rated excellent in all protocols (p ≥ 0.096). Low-dose techniques lowered radiation dose by 26% for SECT images (DLP, 575.0 ± 72.3 mGy · cm vs 771.5 ± 146.8 mGy · cm; p dual-source CT while allowing significant radiation dose reduction.

  12. Gastrin-releasing peptide receptor-targeted gadolinium oxide-based multifunctional nanoparticles for dual magnetic resonance/fluorescent molecular imaging of prostate cancer

    Directory of Open Access Journals (Sweden)

    Cui DT

    2017-09-01

    Full Text Available Danting Cui,1 Xiaodan Lu,1 Chenggong Yan,1 Xiang Liu,1 Meirong Hou,1 Qi Xia,2 Yikai Xu,1 Ruiyuan Liu2,3 1Department of Medical Imaging Center, Nanfang Hospital, Southern Medical University, Guangzhou, People’s Republic of China; 2School of Pharmaceutical Sciences, Southern Medical University, Guangzhou, People’s Republic of China; 3School of Biomedical Engineering, Southern Medical University, Guangzhou, People’s Republic of China Abstract: Bombesin (BBN, an analog of gastrin-releasing peptide (GRP, specifically binds to GRP receptors, which are overexpressed in human prostate cancer (PC. Here, we synthesized a BBN-modified gadolinium oxide (Gd2O3 nanoprobe containing fluorescein (Gd2O3-5(6-carboxyfluorescein [FI]-polyethylene glycol [PEG]-BBN for targeted magnetic resonance (MR/optical dual-modality imaging of PC. The Gd2O3-FI-PEG-BBN nanoparticles exhibited a relatively uniform particle size with an average diameter of 52.3 nm and spherical morphology as depicted by transmission electron microscopy. The longitudinal relaxivity (r1 of Gd2O3-FI-PEG-BBN (r1 =4.23 mM–1s–1 is comparable to that of clinically used Magnevist (Gd-DTPA. Fluorescence microscopy and in vitro cellular MRI demonstrated GRP receptor-specific and enhanced cellular uptake of the Gd2O3-FI-PEG-BBN in PC-3 tumor cells. Moreover, Gd2O3-FI-PEG-BBN showed more remarkable contrast enhancement than the corresponding nontargeted Gd2O3-FI-PEG according to in vivo MRI and fluorescent imaging. Tumor immunohistochemical analysis further demonstrated improved accumulation of the targeted nanoprobe in tumors. BBN-conjugated Gd2O3 may be a promising nanoplatform for simultaneous GRP receptor-targeted molecular cancer diagnosis and antitumor drug delivery in future clinical applications. Keywords: magnetic resonance imaging, gadolinium oxide, bombesin, gastrin-releasing peptide receptor, molecular imaging

  13. Dual Career Faculty Appointments: A Successful Model from ADVANCE-Nebraska

    Science.gov (United States)

    Holmes, M.; Advance-Nebraska Evaluation Team

    2011-12-01

    votes the candidate up or down. The third component provides a variety of faculty positions, including part-time tenure-track, post-doctoral, research professor, and professor of practice positions. Professors of practice are primarily teaching positions with three to five-year renewable contracts. The fourth component, funding, is aided by the NSF ADVANCE cooperative agreement providing one-fourth of the partner's salary for up to three years of the partner's appointment. This gives enough time for the administration to find permanent funding through faculty retirements, departures, or new funding streams. At UNL, department chairs have been exemplary in promoting the necessary cooperative spirit for the program to succeed. This model can be replicated at other institutions. Dual career couples are here to stay, and institutions that see them as great opportunities will win the lottery for the best talent available.

  14. Study of the interplay between magnetic shear and resonances using Hamiltonian models for the magnetic field lines

    Science.gov (United States)

    Firpo, M.-C.; Constantinescu, D.

    2011-03-01

    The issue of magnetic confinement in magnetic fusion devices is addressed within a purely magnetic approach. Using some Hamiltonian models for the magnetic field lines, the dual impact of low magnetic shear is shown in a unified way. Away from resonances, it induces a drastic enhancement of magnetic confinement that favors robust internal transport barriers (ITBs) and stochastic transport reduction. When low shear occurs for values of the winding of the magnetic field lines close to low-order rationals, the amplitude thresholds of the resonant modes that break internal transport barriers by allowing a radial stochastic transport of the magnetic field lines may be quite low. The approach can be applied to assess the robustness versus magnetic perturbations of general (almost) integrable magnetic steady states, including nonaxisymmetric ones such as the important single-helicity steady states. This analysis puts a constraint on the tolerable mode amplitudes compatible with ITBs and may be proposed as a possible explanation of diverse experimental and numerical signatures of their collapses.

  15. Activation and Binding in Verbal Working Memory: A Dual-Process Model for the Recognition of Nonwords

    Science.gov (United States)

    Oberauer, Klauss; Lange, Elke B.

    2009-01-01

    The article presents a mathematical model of short-term recognition based on dual-process models and the three-component theory of working memory [Oberauer, K. (2002). Access to information in working memory: Exploring the focus of attention. "Journal of Experimental Psychology: Learning, Memory, and Cognition, 28", 411-421]. Familiarity arises…

  16. A Riccati Based Homogeneous and Self-Dual Interior-Point Method for Linear Economic Model Predictive Control

    DEFF Research Database (Denmark)

    Sokoler, Leo Emil; Frison, Gianluca; Edlund, Kristian

    2013-01-01

    In this paper, we develop an efficient interior-point method (IPM) for the linear programs arising in economic model predictive control of linear systems. The novelty of our algorithm is that it combines a homogeneous and self-dual model, and a specialized Riccati iteration procedure. We test...

  17. A Simplified Micromechanical Modeling Approach to Predict the Tensile Flow Curve Behavior of Dual-Phase Steels

    Science.gov (United States)

    Nanda, Tarun; Kumar, B. Ravi; Singh, Vishal

    2017-11-01

    Micromechanical modeling is used to predict material's tensile flow curve behavior based on microstructural characteristics. This research develops a simplified micromechanical modeling approach for predicting flow curve behavior of dual-phase steels. The existing literature reports on two broad approaches for determining tensile flow curve of these steels. The modeling approach developed in this work attempts to overcome specific limitations of the existing two approaches. This approach combines dislocation-based strain-hardening method with rule of mixtures. In the first step of modeling, `dislocation-based strain-hardening method' was employed to predict tensile behavior of individual phases of ferrite and martensite. In the second step, the individual flow curves were combined using `rule of mixtures,' to obtain the composite dual-phase flow behavior. To check accuracy of proposed model, four distinct dual-phase microstructures comprising of different ferrite grain size, martensite fraction, and carbon content in martensite were processed by annealing experiments. The true stress-strain curves for various microstructures were predicted with the newly developed micromechanical model. The results of micromechanical model matched closely with those of actual tensile tests. Thus, this micromechanical modeling approach can be used to predict and optimize the tensile flow behavior of dual-phase steels.

  18. A multi-timescale estimator for battery state of charge and capacity dual estimation based on an online identified model

    International Nuclear Information System (INIS)

    Wei, Zhongbao; Zhao, Jiyun; Ji, Dongxu; Tseng, King Jet

    2017-01-01

    Highlights: •SOC and capacity are dually estimated with online adapted battery model. •Model identification and state dual estimate are fully decoupled. •Multiple timescales are used to improve estimation accuracy and stability. •The proposed method is verified with lab-scale experiments. •The proposed method is applicable to different battery chemistries. -- Abstract: Reliable online estimation of state of charge (SOC) and capacity is critically important for the battery management system (BMS). This paper presents a multi-timescale method for dual estimation of SOC and capacity with an online identified battery model. The model parameter estimator and the dual estimator are fully decoupled and executed with different timescales to improve the model accuracy and stability. Specifically, the model parameters are online adapted with the vector-type recursive least squares (VRLS) to address the different variation rates of them. Based on the online adapted battery model, the Kalman filter (KF)-based SOC estimator and RLS-based capacity estimator are formulated and integrated in the form of dual estimation. Experimental results suggest that the proposed method estimates the model parameters, SOC, and capacity in real time with fast convergence and high accuracy. Experiments on both lithium-ion battery and vanadium redox flow battery (VRB) verify the generality of the proposed method on multiple battery chemistries. The proposed method is also compared with other existing methods on the computational cost to reveal its superiority for practical application.

  19. Using Micromechanical Resonators to Measure Rheological Properties and Alcohol Content of Model Solutions and Commercial Beverages

    Directory of Open Access Journals (Sweden)

    Bart W. Hoogenboom

    2012-05-01

    Full Text Available Micromechanic resonators provide a small-volume and potentially high-throughput method to determine rheological properties of fluids. Here we explore the accuracy in measuring mass density and viscosity of ethanol-water and glycerol-water model solutions, using a simple and easily implemented model to deduce the hydrodynamic effects on resonating cantilevers of various length-to-width aspect ratios. We next show that these measurements can be extended to determine the alcohol percentage of both model solutions and commercial beverages such as beer, wine and liquor. This demonstrates how micromechanical resonators can be used for quality control of every-day drinks.

  20. A stochastic inventory management model for a dual sourcing supply chain with disruptions

    Science.gov (United States)

    Iakovou, Eleftherios; Vlachos, Dimitrios; Xanthopoulos, Anastasios

    2010-03-01

    As companies continue to globalise their operations and outsource significant portion of their value chain activities, they often end up relying heavily on order replenishments from distant suppliers. The explosion in long-distance sourcing is exposing supply chains and shareholder value at ever increasing operational and disruption risks. It is well established, both in academia and in real-world business environments, that resource flexibility is an effective method for hedging against supply chain disruption risks. In this contextual framework, we propose a single period stochastic inventory decision-making model that could be employed for capturing the trade-off between inventory policies and disruption risks for an unreliable dual sourcing supply network for both the capacitated and uncapacitated cases. Through the developed model, we obtain some important managerial insights and evaluate the merit of contingency strategies in managing uncertain supply chains.

  1. Strangeness production in hadronic and nuclear collisions in the dual parton model

    International Nuclear Information System (INIS)

    Capella, A.; Tran Thanh Van, J.; Ranft, J.

    1993-01-01

    Λ, antiΛ and K s 0 production is studied in a Monte Carlo Dual Parton model for hadron-hadron, hadron-nucleus and nucleus-nucleus collisions with a SU(3) symmetric sea for chain formation (chain ends) but strangeness suppression in the chain fragmentation. Additionally, (qq)-(antiqantiq) production from the sea was introduced into the chain formation process with the same probability as for the q → qq branching within the chain decay process. This together with the popcorn mechanism of diquark fragmentation result in a new central component of hyperon production, which was not present in previous versions of the model. With these assumptions rapidity distributions and multiplicity ratios for strange particles in hadron-hadron, hadron-nucleus and nucleus-nucleus collisions are compared to a comprehensive collection of experimental data. 5 figs., 2 tabs., 15 refs

  2. Three-Dimensional Electromagnetic Mixing Models for Dual-Phase Steel Microstructures

    Directory of Open Access Journals (Sweden)

    Weibin Zhou

    2018-03-01

    Full Text Available Linking the ferrite fraction in a dual-phase (DP steel microstructure and its electromagnetic properties is critical in the effort to develop on-line measurement techniques for phase transformation using electromagnetic (EM sensors. This paper developed a seamlessly integrated method for generating 3D microstructures and evaluating their equivalent permeability values. Both the generation of 3D microstructures and evaluation of equivalent permeability have been achieved through custom modelling packages developed by the authors. Voronoi modelling based on the random close packing of spheres (RCPS-VM was used to precisely control the ferrite fraction in DP steel microstructure, and an equivalent uniform field method for 3D finite element simulation was developed for efficient analysis.

  3. Research on the Complexity of Dual-Channel Supply Chain Model in Competitive Retailing Service Market

    Science.gov (United States)

    Ma, Junhai; Li, Ting; Ren, Wenbo

    2017-06-01

    This paper examines the optimal decisions of dual-channel game model considering the inputs of retailing service. We analyze how adjustment speed of service inputs affect the system complexity and market performance, and explore the stability of the equilibrium points by parameter basin diagrams. And chaos control is realized by variable feedback method. The numerical simulation shows that complex behavior would trigger the system to become unstable, such as double period bifurcation and chaos. We measure the performances of the model in different periods by analyzing the variation of average profit index. The theoretical results show that the percentage share of the demand and cross-service coefficients have important influence on the stability of the system and its feasible basin of attraction.

  4. A dual-motive model of scapegoating: displacing blame to reduce guilt or increase control.

    Science.gov (United States)

    Rothschild, Zachary K; Landau, Mark J; Sullivan, Daniel; Keefer, Lucas A

    2012-06-01

    The authors present a model that specifies 2 psychological motives underlying scapegoating, defined as attributing inordinate blame for a negative outcome to a target individual or group, (a) maintaining perceived personal moral value by minimizing feelings of guilt over one's responsibility for a negative outcome and (b) maintaining perceived personal control by obtaining a clear explanation for a negative outcome that otherwise seems inexplicable. Three studies supported hypotheses derived from this dual-motive model. Framing a negative outcome (environmental destruction or climate change) as caused by one's own harmful actions (value threat) or unknown sources (control threat) both increased scapegoating, and these effects occurred indirectly through feelings of guilt and perceived personal control, respectively (Study 1), and were differentially moderated by affirmations of moral value and personal control (Study 2). Also, scapegoating in response to value threat versus control threat produced divergent, theoretically specified effects on self-perceptions and behavioral intentions (Study 3). 2012 APA, all rights reserved

  5. Quantification of trunk and android lean mass using dual energy x-ray absorptiometry compared to magnetic resonance imaging after spinal cord injury.

    Science.gov (United States)

    Rankin, Kathleen C; O'Brien, Laura C; Gorgey, Ashraf S

    2018-02-20

    To determine whether dual energy x-ray absorptiometry (DXA) compared to magnetic resonance imaging (MRI) may accurately quantify trunk lean mass (LM) after chronic spinal cord injury (SCI) and to investigate the relationships between trunk LM, visceral adiposity, trunk fat mass and basal metabolic rate (BMR). Cross-sectional design and correlational analysis. Research setting in a medical center. Twenty-two men with motor complete paraplegia (n = 14; T4-T11) and tetraplegia (n = 8; C5-C7) were recruited as part of a clinical trial. Not applicable. Trunk and android LM were measured using DXA. The volume of six trunk muscle groups were then measured using MRI to quantify trunk LM-MRI. Subcutaneous and visceral adipose tissue (VAT) cross-sectional areas were also measured using MRI. After overnight fast, BMR was evaluated using indirect calorimetry. Trunk LM-DXA (24 ± 3.3 kg) and android LM-DXA (3.6 ± 0.7 kg) overestimated (P android LM-DXA + 0.126; r 2 =0.26, SEE= 0.21 kg, P = 0.018. Percentage trunk LM-MRI was inversely related to VAT (r=-0.79, P android LM-DXA overestimated trunk LM-MRI. Percentage trunk LM-MRI, but not LM-DXA, was inversely related to trunk central adiposity. The findings highlight the importance of exercising trunk LM to attenuate cardio-metabolic disorders after SCI.

  6. Comparison of dual-energy X-ray absorptiometry and magnetic resonance imaging-measured adipose tissue depots in HIV-infected and control subjects.

    Science.gov (United States)

    Scherzer, Rebecca; Shen, Wei; Bacchetti, Peter; Kotler, Donald; Lewis, Cora E; Shlipak, Michael G; Punyanitya, Mark; Heymsfield, Steven B; Grunfeld, Carl

    2008-10-01

    Studies in persons without HIV infection have compared adipose tissue measured by dual-energy X-ray absorptiometry (DXA) and magnetic resonance imaging (MRI), but no such study has been conducted in HIV-infected (HIV+) subjects, who have a high prevalence of regional fat loss. We compared DXA- with MRI-measured trunk, leg, arm, and total fat in HIV+ and control subjects. A cross-sectional analysis was conducted in 877 HIV+ subjects and 260 control subjects in FRAM (Study of Fat Redistribution and Metabolic Change in HIV Infection), stratified by sex and HIV status. Univariate associations of DXA with MRI were strongest for total and trunk fat (r > or = 0.92) and slightly weaker for leg (r > or = 0.87) and arm (r > or = 0.71) fat. The average estimated limb fat was substantially greater for DXA than for MRI for HIV+ and control men and women (all P < 0.0001). Less of a difference was observed in trunk fat measured by DXA and MRI, but the difference was still statistically significant (P < 0.0001). Bland-Altman plots showed increasing differences and variability. Greater average limb fat in control and HIV+ subjects (both P < 0.0001) was associated with greater differences between DXA and MRI measurements. Because the control subjects had more limb fat than did the HIV+ subjects, greater amounts of fat were measured by DXA than by MRI when control subjects were compared with HIV+ subjects. More HIV+ subjects had leg fat in the bottom decile of the control subjects by DXA than by MRI (P < 0.0001). Although DXA- and MRI-measured adipose tissue depots correlate strongly in HIV+ and control subjects, differences increase as average fat increases, particularly for limb fat. DXA may estimate a higher prevalence of peripheral lipoatrophy than does MRI in HIV+ subjects.

  7. Enzyme kinetics, inhibitors, mutagenesis and electron paramagnetic resonance analysis of dual-affinity nitrate reductase in unicellular N(2)-fixing cyanobacterium Cyanothece sp. PCC 8801.

    Science.gov (United States)

    Wang, Tung-Hei; Chen, Yung-Han; Huang, Jine-Yung; Liu, Kang-Cheng; Ke, Shyue-Chu; Chu, Hsiu-An

    2011-11-01

    The assimilatory nitrate reductase (NarB) of N(2)-fixing cyanobacterium Cyanothece sp. PCC 8801 is a monomeric enzyme with dual affinity for substrate nitrate. We purified the recombinant NarB of Cyanothece sp. PCC 8801 and further investigated it by enzyme kinetics analysis, site-directed mutagenesis, inhibitor kinetics analysis, and electron paramagnetic resonance (EPR) spectroscopy. The NarB showed 2 kinetic regimes at pH 10.5 or 8 and electron-donor conditions methyl viologen or ferredoxin (Fd). Fd-dependent NR assay revealed NarB with very high affinity for nitrate (K(m)1, ∼1μM; K(m)2, ∼270μM). Metal analysis and EPR results showed that NarB contains a Mo cofactor and a [4Fe-4S] cluster. In addition, the R352A mutation on the proposed nitrate-binding site of NarB greatly altered both high- and low-affinity kinetic components. Furthermore, the effect of azide on the NarB of Cyanothece sp. PCC 8801 was more complex than that on the NarB of Synechococcus sp. PCC 7942 with its single kinetic regime. With 1mM azide, the kinetics of the wild-type NarB was transformed from 2 kinetic regimes to hyperbolic kinetics, and its activity was enhanced significantly under medium nitrate concentrations. Moreover, EPR results also suggested a structural difference between the two NarBs. Taken together, our results show that the NarB of Cyanothece sp. PCC 8801 contains only a single Mo-catalytic center, and we rule out that the enzyme has 2 independent, distinct catalytic sites. In addition, the NarB of Cyanothece sp. PCC 8801 may have a regulatory nitrate-binding site. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  8. Low dose prospective ECG-gated delayed enhanced dual-source computed tomography in reperfused acute myocardial infarction comparison with cardiac magnetic resonance

    International Nuclear Information System (INIS)

    Wang Rui; Zhang Zhaoqi; Xu Lei; Ma Qin; He Yi; Lu Dongxu; Yu Wei; Fan Zhanming

    2011-01-01

    Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 ± 9.57 HU vs. 72.63 ± 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 ± 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.

  9. Low dose prospective ECG-gated delayed enhanced dual-source computed tomography in reperfused acute myocardial infarction comparison with cardiac magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Wang Rui, E-mail: rui_wang1979@yahoo.cn [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Zhang Zhaoqi, E-mail: zhaoqi5000@vip.sohu.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Xu Lei, E-mail: leixu2001@hotmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Ma Qin, E-mail: tel1367@gmail.com [Department of Emergency, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); He Yi, E-mail: heyi139@sina.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Lu Dongxu, E-mail: larry.hi@163.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Yu Wei, E-mail: yuwei02@gmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Fan Zhanming, E-mail: fanzm120@tom.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China)

    2011-11-15

    Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 {+-} 9.57 HU vs. 72.63 {+-} 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 {+-} 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.

  10. Coupling a 1D Dual-permeability Model with an Infinite Slope Stability Approach to Quantify the Influence of Preferential Flow on Slope Stability

    NARCIS (Netherlands)

    Shao, W.; Bogaard, T.A.; Su, Y.; Bakker, M.

    2016-01-01

    In this study, a 1D hydro-mechanical model was developed by coupling a dual-permeability model with an infinite slope stability approach to investigate the influence of preferential flow on pressure propagation and slope stability. The dual-permeability model used two modified Darcy-Richards

  11. Dual diathesis-stressor model of emotional and linguistic contributions to developmental stuttering.

    Science.gov (United States)

    Walden, Tedra A; Frankel, Carl B; Buhr, Anthony P; Johnson, Kia N; Conture, Edward G; Karrass, Jan M

    2012-05-01

    This study assessed emotional and speech-language contributions to childhood stuttering. A dual diathesis-stressor framework guided this study, in which both linguistic requirements and skills, and emotion and its regulation, are hypothesized to contribute to stuttering. The language diathesis consists of expressive and receptive language skills. The emotion diathesis consists of proclivities to emotional reactivity and regulation of emotion, and the emotion stressor consists of experimentally manipulated emotional inductions prior to narrative speaking tasks. Preschool-age children who do and do not stutter were exposed to three emotion-producing overheard conversations-neutral, positive, and angry. Emotion and emotion-regulatory behaviors were coded while participants listened to each conversation and while telling a story after each overheard conversation. Instances of stuttering during each story were counted. Although there was no main effect of conversation type, results indicated that stuttering in preschool-age children is influenced by emotion and language diatheses, as well as coping strategies and situational emotional stressors. Findings support the dual diathesis-stressor model of stuttering.

  12. CT/FMT dual-model imaging of breast cancer based on peptide-lipid nanoparticles

    Science.gov (United States)

    Xu, Guoqiang; Lin, Qiaoya; Lian, Lichao; Qian, Yuan; Lu, Lisen; Zhang, Zhihong

    2016-03-01

    Breast cancer is one of the most harmful cancers in human. Its early diagnosis is expected to improve the patients' survival rate. X-ray computed tomography (CT) has been widely used in tumor detection for obtaining three-dimentional information. Fluorescence Molecular Tomography (FMT) imaging combined with near-infrared fluorescent dyes provides a powerful tool for the acquisition of molecular biodistribution information in deep tissues. Thus, the combination of CT and FMT imaging modalities allows us to better differentiate diseased tissues from normal tissues. Here we developed a tumor-targeting nanoparticle for dual-modality imaging based on a biocompatible HDL-mimicking peptide-phospholipid scaffold (HPPS) nanocarrier. By incorporation of CT contrast agents (iodinated oil) and far-infrared fluorescent dyes (DiR-BOA) into the hydrophobic core of HPPS, we obtained the FMT and CT signals simultaneously. Increased accumulation of the nanoparticles in the tumor lesions was achieved through the effect of the tumor-targeting peptide on the surface of nanoparticle. It resulted in excellent contrast between lesions and normal tissues. Together, the abilities to sensitively separate the lesions from adjacent normal tissues with the aid of a FMT/CT dual-model imaging approach make the targeting nanoparticles a useful tool for the diagnostics of breast cancer.

  13. Oxidative desulfurization of model diesel via dual activation by a protic ionic liquid

    Energy Technology Data Exchange (ETDEWEB)

    Lü, Hongying, E-mail: hylv@ytu.edu.cn; Wang, Shunan; Deng, Changliang; Ren, Wanzhong; Guo, Baocun

    2014-08-30

    Highlights: • A protic ionic liquid, [Hnmp]HCOO, was used as in ODS. • The mechanism of ODS was involved in dual activation by the PIL. • The [Hnmp]HCOO exhibited high catalytic activity in ODS. • The amounts of PILs and oxidant dosage play vital roles in desulfurization system. • This system can be recycled five times with an unnoticeable decrease in activity. - Abstract: A novel and green carboxylate-anion-based protic ionic liquid (PIL), [Hnmp]HCOO, was prepared through a simple and atom economic neutralization reaction between N-methyl-2-pyrrolidonium (NMP) and formic acids. Both FT-IR spectra and {sup 1}H NMR confirmed its simple salt structure. [Hnmp]HCOO exhibited so high catalytic activity that the dibenzothiophene (DBT) removal reached 99% at 50 °C in 3 h under conditions of V{sub PIL}/V{sub model} {sub oil} = 1:10 and H{sub 2}O{sub 2}/DBT (O/S, molar ratio) = 5. The catalytic oxidation reactivity of S-compounds was found to be in the order of DBT > 4,6-dimethyldibenzothiophene (4,6-DMDBT) > benzothiophene (BT). The investigation on mechanism showed that oxidative desulfurization was realized through dual activation of PIL. Moreover, [Hnmp]HCOO can be recycled for five times with an unnoticeable decrease in desulfurization activity.

  14. Oxidative desulfurization of model diesel via dual activation by a protic ionic liquid

    International Nuclear Information System (INIS)

    Lü, Hongying; Wang, Shunan; Deng, Changliang; Ren, Wanzhong; Guo, Baocun

    2014-01-01

    Highlights: • A protic ionic liquid, [Hnmp]HCOO, was used as in ODS. • The mechanism of ODS was involved in dual activation by the PIL. • The [Hnmp]HCOO exhibited high catalytic activity in ODS. • The amounts of PILs and oxidant dosage play vital roles in desulfurization system. • This system can be recycled five times with an unnoticeable decrease in activity. - Abstract: A novel and green carboxylate-anion-based protic ionic liquid (PIL), [Hnmp]HCOO, was prepared through a simple and atom economic neutralization reaction between N-methyl-2-pyrrolidonium (NMP) and formic acids. Both FT-IR spectra and 1 H NMR confirmed its simple salt structure. [Hnmp]HCOO exhibited so high catalytic activity that the dibenzothiophene (DBT) removal reached 99% at 50 °C in 3 h under conditions of V PIL /V model oil = 1:10 and H 2 O 2 /DBT (O/S, molar ratio) = 5. The catalytic oxidation reactivity of S-compounds was found to be in the order of DBT > 4,6-dimethyldibenzothiophene (4,6-DMDBT) > benzothiophene (BT). The investigation on mechanism showed that oxidative desulfurization was realized through dual activation of PIL. Moreover, [Hnmp]HCOO can be recycled for five times with an unnoticeable decrease in desulfurization activity

  15. Optimization of dual-wavelength intravascular photoacoustic imaging of atherosclerotic plaques using Monte Carlo optical modeling

    Science.gov (United States)

    Dana, Nicholas; Sowers, Timothy; Karpiouk, Andrei; Vanderlaan, Donald; Emelianov, Stanislav

    2017-10-01

    Coronary heart disease (the presence of coronary atherosclerotic plaques) is a significant health problem in the industrialized world. A clinical method to accurately visualize and characterize atherosclerotic plaques is needed. Intravascular photoacoustic (IVPA) imaging is being developed to fill this role, but questions remain regarding optimal imaging wavelengths. We utilized a Monte Carlo optical model to simulate IVPA excitation in coronary tissues, identifying optimal wavelengths for plaque characterization. Near-infrared wavelengths (≤1800 nm) were simulated, and single- and dual-wavelength data were analyzed for accuracy of plaque characterization. Results indicate light penetration is best in the range of 1050 to 1370 nm, where 5% residual fluence can be achieved at clinically relevant depths of ≥2 mm in arteries. Across the arterial wall, fluence may vary by over 10-fold, confounding plaque characterization. For single-wavelength results, plaque segmentation accuracy peaked at 1210 and 1720 nm, though correlation was poor (blood, a primary and secondary wavelength near 1210 and 1350 nm, respectively, may offer the best implementation of dual-wavelength IVPA imaging. These findings could guide the development of a cost-effective clinical system by highlighting optimal wavelengths and improving plaque characterization.

  16. Treatment of Murine Tumor Models of Breast Adenocarcinoma by Continuous Dual-Frequency Ultrasound

    Directory of Open Access Journals (Sweden)

    Amir Hoshang Barati

    2009-03-01

    Full Text Available Introduction: Acoustic transient cavitation is the primary mechanism of sonochemical reaction and has potential use for tumor treatment. In this study, the in vivo anti-tumor effect of simultaneous dual-frequency ultrasound at low-level intensity (ISATA < 6 W/cm2 was investigated in a spontaneous murine model of breast adenocarcinoma in Balb/c mice. Materials and Methods: Forty tumor bearing mice were divided into four groups (10 in each group. The treated groups received 15 or 30 minutes of combined dual-frequency ultrasound in continuous mode (1 MHzcon + 150 kHzcon respectively. The control and the sham groups contained the untreated mice. The tumor growth delay parameters including tumor volume, relative tumor volume, T5 and T2 (the needed time for each tumor to reach 5 and 2 times the initial tumor volume, respectively, survival period and percent of tumor growth inhibition ratio were measured on different days after treatment. Results: The results showed that the 30 min treatment was effective in tumor growth delay and percent of tumor growth inhibitory ratio compared to the sham and the control groups. The tumor volume growth and relative volume of tumors in the same treated group showed an anti-tumor effect relative to the sham and the control groups. There was a significant difference in tumor volume growth between this 30 min treatment group and the sham group 12 days after treatment (p-value

  17. Dual-joint modeling for estimation of total knee replacement contact forces during locomotion.

    Science.gov (United States)

    Hast, Michael W; Piazza, Stephen J

    2013-02-01

    Model-based estimation of in vivo contact forces arising between components of a total knee replacement is challenging because such forces depend upon accurate modeling of muscles, tendons, ligaments, contact, and multibody dynamics. Here we describe an approach to solving this problem with results that are tested by comparison to knee loads measured in vivo for a single subject and made available through the Grand Challenge Competition to Predict in vivo Tibiofemoral Loads. The approach makes use of a "dual-joint" paradigm in which the knee joint is alternately represented by (1) a ball-joint knee for inverse dynamic computation of required muscle controls and (2) a 12 degree-of-freedom (DOF) knee with elastic foundation contact at the tibiofemoral and patellofemoral articulations for forward dynamic integration. Measured external forces and kinematics were applied as a feedback controller and static optimization attempted to track measured knee flexion angles and electromyographic (EMG) activity. The resulting simulations showed excellent tracking of knee flexion (average RMS error of 2.53 deg) and EMG (muscle activations within ±10% envelopes of normalized measured EMG signals). Simulated tibiofemoral contact forces agreed qualitatively with measured contact forces, but their RMS errors were approximately 25% of the peak measured values. These results demonstrate the potential of a dual-joint modeling approach to predict joint contact forces from kinesiological data measured in the motion laboratory. It is anticipated that errors in the estimation of contact force will be reduced as more accurate subject-specific models of muscles and other soft tissues are developed.

  18. Meso-Scale Modelling of Deformation, Damage and Failure in Dual Phase Steels

    Science.gov (United States)

    Sari Sarraf, Iman

    Advanced high strength steels (AHSS), such as dual phase (DP) and transformation induced plasticity (TRIP) steels, offer high ductility, formability, and strength, as well as high strength-to-weight ratio and improved crash resistance. Dual phase steels belong to a family of high strength grades which consist of martensite, responsible for strengthening, distributed in a ductile ferrite matrix which accommodates the deformation throughout the forming process. It has been shown that the predominant damage mechanism and failure in DP steels depends on the ferrite and martensite grain sizes and their morphology, and can range from a mixture of brittle and ductile rupture to completely ductile rupture in a quasi-static uniaxial tension test. In this study, a hybrid finite element cellular automata model, initially proposed by Anton Shterenlikht (2003), was developed to evaluate the forming behaviour and predict the onset of instability and damage evolution in a dual phase steel. In this model, the finite element constitutive model is used to represent macro-level strain gradients and a damage variable, and two different cell arrays are designed to represent the ductile and brittle fracture modes in meso-scale. In the FE part of the model, a modified Rousselier ductile damage model is developed to account for nucleation, growth and coalescence of voids. Also, several rate-dependent hardening models were developed and evaluated to describe the work hardening flow curve of DP600. Based on statistical analysis and simulation results, a modified Johnson-Cook (JC) model and a multiplicative combination of the Voce-modified JC functions were found to be the most accurate hardening models. The developed models were then implemented in a user-defined material subroutine (VUMAT) for ABAQUS/Explicit finite element simulation software to simulate uniaxial tension tests at strain rates ranging from 0.001 1/s to 1000 1/s, Marciniak tests, and electrohydraulic free-forming (EHFF

  19. Dual Processing Model for Medical Decision-Making: An Extension to Diagnostic Testing.

    Science.gov (United States)

    Tsalatsanis, Athanasios; Hozo, Iztok; Kumar, Ambuj; Djulbegovic, Benjamin

    2015-01-01

    Dual Processing Theories (DPT) assume that human cognition is governed by two distinct types of processes typically referred to as type 1 (intuitive) and type 2 (deliberative). Based on DPT we have derived a Dual Processing Model (DPM) to describe and explain therapeutic medical decision-making. The DPM model indicates that doctors decide to treat when treatment benefits outweigh its harms, which occurs when the probability of the disease is greater than the so called "threshold probability" at which treatment benefits are equal to treatment harms. Here we extend our work to include a wider class of decision problems that involve diagnostic testing. We illustrate applicability of the proposed model in a typical clinical scenario considering the management of a patient with prostate cancer. To that end, we calculate and compare two types of decision-thresholds: one that adheres to expected utility theory (EUT) and the second according to DPM. Our results showed that the decisions to administer a diagnostic test could be better explained using the DPM threshold. This is because such decisions depend on objective evidence of test/treatment benefits and harms as well as type 1 cognition of benefits and harms, which are not considered under EUT. Given that type 1 processes are unique to each decision-maker, this means that the DPM threshold will vary among different individuals. We also showed that when type 1 processes exclusively dominate decisions, ordering a diagnostic test does not affect a decision; the decision is based on the assessment of benefits and harms of treatment. These findings could explain variations in the treatment and diagnostic patterns documented in today's clinical practice.

  20. Dual Processing Model for Medical Decision-Making: An Extension to Diagnostic Testing.

    Directory of Open Access Journals (Sweden)

    Athanasios Tsalatsanis

    Full Text Available Dual Processing Theories (DPT assume that human cognition is governed by two distinct types of processes typically referred to as type 1 (intuitive and type 2 (deliberative. Based on DPT we have derived a Dual Processing Model (DPM to describe and explain therapeutic medical decision-making. The DPM model indicates that doctors decide to treat when treatment benefits outweigh its harms, which occurs when the probability of the disease is greater than the so called "threshold probability" at which treatment benefits are equal to treatment harms. Here we extend our work to include a wider class of decision problems that involve diagnostic testing. We illustrate applicability of the proposed model in a typical clinical scenario considering the management of a patient with prostate cancer. To that end, we calculate and compare two types of decision-thresholds: one that adheres to expected utility theory (EUT and the second according to DPM. Our results showed that the decisions to administer a diagnostic test could be better explained using the DPM threshold. This is because such decisions depend on objective evidence of test/treatment benefits and harms as well as type 1 cognition of benefits and harms, which are not considered under EUT. Given that type 1 processes are unique to each decision-maker, this means that the DPM threshold will vary among different individuals. We also showed that when type 1 processes exclusively dominate decisions, ordering a diagnostic test does not affect a decision; the decision is based on the assessment of benefits and harms of treatment. These findings could explain variations in the treatment and diagnostic patterns documented in today's clinical practice.

  1. Early small-bowel ischemia: dual-energy CT improves conspicuity compared with conventional CT in a swine model.

    Science.gov (United States)

    Potretzke, Theodora A; Brace, Christopher L; Lubner, Meghan G; Sampson, Lisa A; Willey, Bridgett J; Lee, Fred T

    2015-04-01

    To compare dual-energy computed tomography (CT) with conventional CT for the detection of small-bowel ischemia in an experimental animal model. The study was approved by the animal care and use committee and was performed in accordance with the Guide for Care and Use of Laboratory Animals issued by the National Research Council. Ischemic bowel segments (n = 8) were created in swine (n = 4) by means of surgical occlusion of distal mesenteric arteries and veins. Contrast material-enhanced dual-energy CT and conventional single-energy CT (120 kVp) sequences were performed during the portal venous phase with a single-source fast-switching dual-energy CT scanner. Attenuation values and contrast-to-noise ratios of ischemic and perfused segments on iodine material-density, monospectral dual-energy CT (51 keV, 65 keV, and 70 keV), and conventional 120-kVp CT images were compared. Linear mixed-effects models were used for comparisons. The attenuation difference between ischemic and perfused segments was significantly greater on dual-energy 51-keV CT images than on conventional 120-kVp CT images (mean difference, 91.7 HU vs 47.6 HU; P conventional CT by increasing attenuation differences between ischemic and perfused segments on low-kiloelectron volt and iodine material density images. © RSNA, 2014.

  2. Mathematical model of thyristor inverter including a series-parallel resonant circuit

    OpenAIRE

    Luft, M.; Szychta, E.

    2008-01-01

    The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with the aid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.

  3. Mathematical Model of Thyristor Inverter Including a Series-parallel Resonant Circuit

    OpenAIRE

    Miroslaw Luft; Elzbieta Szychta

    2008-01-01

    The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with theaid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.

  4. Mathematical Model of Thyristor Inverter Including a Series-parallel Resonant Circuit

    Directory of Open Access Journals (Sweden)

    Miroslaw Luft

    2008-01-01

    Full Text Available The article presents a mathematical model of thyristor inverter including a series-parallel resonant circuit with theaid of state variable method. Maple procedures are used to compute current and voltage waveforms in the inverter.

  5. Compact extended model for doppler broadening of neutron absorption resonances in solids

    International Nuclear Information System (INIS)

    Villanueva, A. J; Granada, J.R

    2009-01-01

    We present a simplified compact model for calculating Doppler broadening of neutron absorption resonances in an incoherent Debye solid. Our model extends the effective temperature gas model to cover the whole range of energies and temperatures, and reduces the information of the dynamical system to a minimum content compatible with a much better accuracy of the calculation. This model is thus capable of replacing the existing algorithm in standard codes for resonance cross sections preparation aimed at neutron and reactor physics calculations. The model is applied to the 238 U 6.671 eV effective broadened cross section. We also show how this model can be used for thermometry in an improved fashion compared to the effective temperature gas model. Experimental data of the same resonance at low and high temperatures are also shown and the performances of each model are put to the test on this basis. [es

  6. Neutron strength functions: the link between resolved resonances and the optical model

    International Nuclear Information System (INIS)

    Moldauer, P.A.

    1980-01-01

    Neutron strength functions and scattering radii are useful as energy and channel radius independent parameters that characterize neutron scattering resonances and provide a connection between R-matrix resonance analysis and the optical model. The choice of R-matrix channel radii is discussed, as are limitations on the accuracies of strength functions. New definitions of the p-wave strength function and scattering radius are proposed. For light nuclei, where strength functions display optical model energy variations over the resolved resonances, a doubly reduced partial neutron width is introduced for more meaningful statistical analyses of widths. The systematic behavior of strength functions and scattering radii is discussed

  7. Testing crossover effects in an actor-partner interdependence model among Chinese dual-earner couples.

    Science.gov (United States)

    Liu, Huimin; Cheung, Fanny M

    2015-03-01

    The purpose of the present study is to examine the crossover effects from one partner's work-family interface (work-family conflict [WFC] and work-family enrichment [WFE]) to the other partner's four outcomes (psychological strain, life satisfaction, marital satisfaction and job satisfaction) in a sample of Chinese dual-earner couples. Married couples (N = 361) completed a battery of questionnaires, including the work-family interface scale, the psychological strain scale, the life, marital, as well as job satisfaction scale. Results from the actor-partner interdependence model (APIM) analyses showed that wives' WFE was negatively associated with husbands' psychological strain, and positively associated with husbands' life, marital and job satisfaction. Furthermore, husbands' WFC was negatively related to wives' marital satisfaction, whereas husbands' WFE was positively related to wives' marital satisfaction. Theoretical and practical implications were discussed, and future research directions were provided. © 2014 International Union of Psychological Science.

  8. Precommitted Investment Strategy versus Time-Consistent Investment Strategy for a Dual Risk Model

    Directory of Open Access Journals (Sweden)

    Lidong Zhang

    2014-01-01

    Full Text Available We are concerned with optimal investment strategy for a dual risk model. We assume that the company can invest into a risk-free asset and a risky asset. Short-selling and borrowing money are allowed. Due to lack of iterated-expectation property, the Bellman Optimization Principle does not hold. Thus we investigate the precommitted strategy and time-consistent strategy, respectively. We take three steps to derive the precommitted investment strategy. Furthermore, the time-consistent investment strategy is also obtained by solving the extended Hamilton-Jacobi-Bellman equations. We compare the precommitted strategy with time-consistent strategy and find that these different strategies have different advantages: the former can make value function maximized at the original time t=0 and the latter strategy is time-consistent for the whole time horizon. Finally, numerical analysis is presented for our results.

  9. Parameter Estimations and Optimal Design of Simple Step-Stress Model for Gamma Dual Weibull Distribution

    Directory of Open Access Journals (Sweden)

    Hamdy Mohamed Salem

    2018-03-01

    Full Text Available This paper considers life-testing experiments and how it is effected by stress factors: namely temperature, electricity loads, cycling rate and pressure. A major type of accelerated life tests is a step-stress model that allows the experimenter to increase stress levels more than normal use during the experiment to see the failure items. The test items are assumed to follow Gamma Dual Weibull distribution. Different methods for estimating the parameters are discussed. These include Maximum Likelihood Estimations and Confidence Interval Estimations which is based on asymptotic normality generate narrow intervals to the unknown distribution parameters with high probability. MathCAD (2001 program is used to illustrate the optimal time procedure through numerical examples.

  10. Dual Band Magnonic Crystals: Model System and Basic Spin Wave Dynamics

    Directory of Open Access Journals (Sweden)

    Federico Montoncello

    2016-01-01

    Full Text Available We investigate a special design of two-dimensional magnonic crystal, consisting of two superimposed lattices with different lattice constants, such that spin waves (SWs can propagate either in one or the other sublattice, depending on which of the two frequency bands they belong to. The SW bands are separated by a very large bandgap (in our model system, 6 GHz, easily tunable by changing the direction of an applied magnetic field, and the overlap of their spatial distribution, for any frequency of their bands, is always negligible. These properties make the designed system an ideal test system for a magnonic dual band waveguide, where the simultaneous excitation and subsequent propagation of two independent SW signals are allowed, with no mutual interference.

  11. [A process of aquatic ecological function regionalization: The dual tree framework and conceptual model].

    Science.gov (United States)

    Guo, Shu Hai; Wu, Bo

    2017-12-01

    Aquatic ecological regionalization and aquatic ecological function regionalization are the basis of water environmental management of a river basin and rational utilization of an aquatic ecosystem, and have been studied in China for more than ten years. Regarding the common problems in this field, the relationship between aquatic ecological regionalization and aquatic ecological function regionalization was discussed in this study by systematic analysis of the aquatic ecological zoning and the types of aquatic ecological function. Based on the dual tree structure, we put forward the RFCH process and the diamond conceptual model. Taking Liaohe River basin as an example and referring to the results of existing regionalization studies, we classified the aquatic ecological function regions based on three-class aquatic ecological regionalization. This study provided a process framework for aquatic ecological function regionalization of a river basin.

  12. Compound analysis of gallstones using dual energy computed tomography-Results in a phantom model

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, Ralf W., E-mail: ralfwbauer@aol.co [Department of Diagnostic and Interventional Radiology, Clinic of the Goethe University Frankfurt, Theodor-Stern-Kai 7, 60596 Frankfurt (Germany); Schulz, Julian R., E-mail: julian.schulz@t-online.d [Department of Diagnostic and Interventional Radiology, Clinic of the Goethe University Frankfurt, Theodor-Stern-Kai 7, 60596 Frankfurt (Germany); Zedler, Barbara, E-mail: zedler@em.uni-frankfurt.d [Department of Forensic Medicine, Clinic of the Goethe University Frankfurt, Kennedyallee 104, 60596 Frankfurt (Germany); Graf, Thomas G., E-mail: thomas.gt.graf@siemens.co [Siemens AG Healthcare Sector, Computed Tomography, Physics and Applications, Siemensstrasse 1, 91313 Forchheim (Germany); Vogl, Thomas J., E-mail: t.vogl@em.uni-frankfurt.d [Department of Diagnostic and Interventional Radiology, Clinic of the Goethe University Frankfurt, Theodor-Stern-Kai 7, 60596 Frankfurt (Germany)

    2010-07-15

    Purpose: The potential of dual energy computed tomography (DECT) for the analysis of gallstone compounds was investigated. The main goal was to find parameters, that can reliably define high percentage (>70%) cholesterol stones without calcium components. Materials and methods: 35 gallstones were analyzed with DECT using a phantom model. Stone samples were put into specimen containers filled with formalin. Containers were put into a water-filled cylindrical acrylic glass phantom. DECT scans were performed using a tube voltage/current of 140 kV/83 mAs (tube A) and 80 kV/340 mAs (tube B). ROI-measurements to determine CT attenuation of each sector of the stones that had different appearance on the CT images were performed. Finally, semi-quantitative infrared spectroscopy (FTIR) of these sectors was performed for chemical analysis. Results: ROI-measurements were performed in 45 different sectors in 35 gallstones. Sectors containing >70% of cholesterol and no calcium component (n = 20) on FTIR could be identified with 95% sensitivity and 100% specificity on DECT. These sectors showed typical attenuation of -8 {+-} 4 HU at 80 kV and +22 {+-} 3 HU at 140 kV. Even the presence of a small calcium component (<10%) hindered the reliable identification of cholesterol components as such. Conclusion: Dual energy CT allows for reliable identification of gallstones containing a high percentage of cholesterol and no calcium component in this pre-clinical phantom model. Results from in vivo or anthropomorphic phantom trials will have to confirm these results. This may enable the identification of patients eligible for non-surgical treatment options in the future.

  13. Dual Processes in Decision Making and Developmental Neuroscience: A Fuzzy-Trace Model.

    Science.gov (United States)

    Reyna, Valerie F; Brainerd, Charles J

    2011-09-01

    From Piaget to the present, traditional and dual-process theories have predicted improvement in reasoning from childhood to adulthood, and improvement has been observed. However, developmental reversals-that reasoning biases emerge with development -have also been observed in a growing list of paradigms. We explain how fuzzy-trace theory predicts both improvement and developmental reversals in reasoning and decision making. Drawing on research on logical and quantitative reasoning, as well as on risky decision making in the laboratory and in life, we illustrate how the same small set of theoretical principles apply to typical neurodevelopment, encompassing childhood, adolescence, and adulthood, and to neurological conditions such as autism and Alzheimer's disease. For example, framing effects-that risk preferences shift when the same decisions are phrases in terms of gains versus losses-emerge in early adolescence as gist-based intuition develops. In autistic individuals, who rely less on gist-based intuition and more on verbatim-based analysis, framing biases are attenuated (i.e., they outperform typically developing control subjects). In adults, simple manipulations based on fuzzy-trace theory can make framing effects appear and disappear depending on whether gist-based intuition or verbatim-based analysis is induced. These theoretical principles are summarized and integrated in a new mathematical model that specifies how dual modes of reasoning combine to produce predictable variability in performance. In particular, we show how the most popular and extensively studied model of decision making-prospect theory-can be derived from fuzzy-trace theory by combining analytical (verbatim-based) and intuitive (gist-based) processes.

  14. Compound analysis of gallstones using dual energy computed tomography-Results in a phantom model

    International Nuclear Information System (INIS)

    Bauer, Ralf W.; Schulz, Julian R.; Zedler, Barbara; Graf, Thomas G.; Vogl, Thomas J.

    2010-01-01

    Purpose: The potential of dual energy computed tomography (DECT) for the analysis of gallstone compounds was investigated. The main goal was to find parameters, that can reliably define high percentage (>70%) cholesterol stones without calcium components. Materials and methods: 35 gallstones were analyzed with DECT using a phantom model. Stone samples were put into specimen containers filled with formalin. Containers were put into a water-filled cylindrical acrylic glass phantom. DECT scans were performed using a tube voltage/current of 140 kV/83 mAs (tube A) and 80 kV/340 mAs (tube B). ROI-measurements to determine CT attenuation of each sector of the stones that had different appearance on the CT images were performed. Finally, semi-quantitative infrared spectroscopy (FTIR) of these sectors was performed for chemical analysis. Results: ROI-measurements were performed in 45 different sectors in 35 gallstones. Sectors containing >70% of cholesterol and no calcium component (n = 20) on FTIR could be identified with 95% sensitivity and 100% specificity on DECT. These sectors showed typical attenuation of -8 ± 4 HU at 80 kV and +22 ± 3 HU at 140 kV. Even the presence of a small calcium component (<10%) hindered the reliable identification of cholesterol components as such. Conclusion: Dual energy CT allows for reliable identification of gallstones containing a high percentage of cholesterol and no calcium component in this pre-clinical phantom model. Results from in vivo or anthropomorphic phantom trials will have to confirm these results. This may enable the identification of patients eligible for non-surgical treatment options in the future.

  15. Dual Processes in Decision Making and Developmental Neuroscience: A Fuzzy-Trace Model

    Science.gov (United States)

    Reyna, Valerie F.; Brainerd, Charles J.

    2011-01-01

    From Piaget to the present, traditional and dual-process theories have predicted improvement in reasoning from childhood to adulthood, and improvement has been observed. However, developmental reversals—that reasoning biases emerge with development —have also been observed in a growing list of paradigms. We explain how fuzzy-trace theory predicts both improvement and developmental reversals in reasoning and decision making. Drawing on research on logical and quantitative reasoning, as well as on risky decision making in the laboratory and in life, we illustrate how the same small set of theoretical principles apply to typical neurodevelopment, encompassing childhood, adolescence, and adulthood, and to neurological conditions such as autism and Alzheimer's disease. For example, framing effects—that risk preferences shift when the same decisions are phrases in terms of gains versus losses—emerge in early adolescence as gist-based intuition develops. In autistic individuals, who rely less on gist-based intuition and more on verbatim-based analysis, framing biases are attenuated (i.e., they outperform typically developing control subjects). In adults, simple manipulations based on fuzzy-trace theory can make framing effects appear and disappear depending on whether gist-based intuition or verbatim-based analysis is induced. These theoretical principles are summarized and integrated in a new mathematical model that specifies how dual modes of reasoning combine to produce predictable variability in performance. In particular, we show how the most popular and extensively studied model of decision making—prospect theory—can be derived from fuzzy-trace theory by combining analytical (verbatim-based) and intuitive (gist-based) processes. PMID:22096268

  16. Correlations between resonances in a statistical scattering model

    International Nuclear Information System (INIS)

    Gorin, T.; Rotter, I.

    1997-01-01

    The distortion of the regular motion in a quantum system by its coupling to the continuum of decay channels is investigated. The regular motion is described by means of a Poissonian ensemble. We focus on the case of only few channels K 2 K distribution in the GOE case. 2. Due to the coupling to the continuum, correlations are induced not only between the positions of the resonances but also between positions and widths. These correlations remain even in the strong coupling limit. In order to explain these results, an asymptotic expression for the width distribution is derived for the one channel case. It relates the width of a trapped resonance state to the distance between its two neighboring levels. (orig.)

  17. Self-consistent modelling of resonant tunnelling structures

    DEFF Research Database (Denmark)

    Fiig, T.; Jauho, A.P.

    1992-01-01

    We report a comprehensive study of the effects of self-consistency on the I-V-characteristics of resonant tunnelling structures. The calculational method is based on a simultaneous solution of the effective-mass Schrödinger equation and the Poisson equation, and the current is evaluated...... applied voltages and carrier densities at the emitter-barrier interface. We include the two-dimensional accumulation layer charge and the quantum well charge in our self-consistent scheme. We discuss the evaluation of the current contribution originating from the two-dimensional accumulation layer charges......, and our qualitative estimates seem consistent with recent experimental studies. The intrinsic bistability of resonant tunnelling diodes is analyzed within several different approximation schemes....

  18. An integrated model of clinical reasoning: dual-process theory of cognition and metacognition.

    Science.gov (United States)

    Marcum, James A

    2012-10-01

    Clinical reasoning is an important component for providing quality medical care. The aim of the present paper is to develop a model of clinical reasoning that integrates both the non-analytic and analytic processes of cognition, along with metacognition. The dual-process theory of cognition (system 1 non-analytic and system 2 analytic processes) and the metacognition theory are used to develop an integrated model of clinical reasoning. In the proposed model, clinical reasoning begins with system 1 processes in which the clinician assesses a patient's presenting symptoms, as well as other clinical evidence, to arrive at a differential diagnosis. Additional clinical evidence, if necessary, is acquired and analysed utilizing system 2 processes to assess the differential diagnosis, until a clinical decision is made diagnosing the patient's illness and then how best to proceed therapeutically. Importantly, the outcome of these processes feeds back, in terms of metacognition's monitoring function, either to reinforce or to alter cognitive processes, which, in turn, enhances synergistically the clinician's ability to reason quickly and accurately in future consultations. The proposed integrated model has distinct advantages over other models proposed in the literature for explicating clinical reasoning. Moreover, it has important implications for addressing the paradoxical relationship between experience and expertise, as well as for designing a curriculum to teach clinical reasoning skills. © 2012 Blackwell Publishing Ltd.

  19. A dual-phantom system for validation of velocity measurements in stenosis models under steady flow.

    Science.gov (United States)

    Blake, James R; Easson, William J; Hoskins, Peter R

    2009-09-01

    A dual-phantom system is developed for validation of velocity measurements in stenosis models. Pairs of phantoms with identical geometry and flow conditions are manufactured, one for ultrasound and one for particle image velocimetry (PIV). The PIV model is made from silicone rubber, and a new PIV fluid is made that matches the refractive index of 1.41 of silicone. Dynamic scaling was performed to correct for the increased viscosity of the PIV fluid compared with that of the ultrasound blood mimic. The degree of stenosis in the models pairs agreed to less than 1%. The velocities in the laminar flow region up to the peak velocity location agreed to within 15%, and the difference could be explained by errors in ultrasound velocity estimation. At low flow rates and in mild stenoses, good agreement was observed in the distal flow fields, excepting the maximum velocities. At high flow rates, there was considerable difference in velocities in the poststenosis flow field (maximum centreline differences of 30%), which would seem to represent real differences in hydrodynamic behavior between the two models. Sources of error included: variation of viscosity because of temperature (random error, which could account for differences of up to 7%); ultrasound velocity estimation errors (systematic errors); and geometry effects in each model, particularly because of imperfect connectors and corners (systematic errors, potentially affecting the inlet length and flow stability). The current system is best placed to investigate measurement errors in the laminar flow region rather than the poststenosis turbulent flow region.

  20. Resonance phenomena in a time-dependent, three-dimensional model of an idealized eddy

    Science.gov (United States)

    Rypina, I. I.; Pratt, L. J.; Wang, P.; Äe; -zgökmen, T. M.; Mezic, I.

    2015-08-01

    We analyze the geometry of Lagrangian motion and material barriers in a time-dependent, three-dimensional, Ekman-driven, rotating cylinder flow, which serves as an idealization for an isolated oceanic eddy and other overturning cells with cylindrical geometry in the ocean and atmosphere. The flow is forced at the top through an oscillating upper lid, and the response depends on the frequency and amplitude of lid oscillations. In particular, the Lagrangian geometry changes near the resonant tori of the unforced flow, whose frequencies are rationally related to the forcing frequencies. Multi-scale analytical expansions are used to simplify the flow in the vicinity of resonant trajectories and to investigate the resonant flow geometries. The resonance condition and scaling can be motivated by simple physical argument. The theoretically predicted flow geometries near resonant trajectories have then been confirmed through numerical simulations in a phenomenological model and in a full solution of the Navier-Stokes equations.

  1. A commentary on domestic animals as dual-purpose models that benefit agricultural and biomedical research.

    Science.gov (United States)

    Ireland, J J; Roberts, R M; Palmer, G H; Bauman, D E; Bazer, F W

    2008-10-01

    Research on domestic animals (cattle, swine, sheep, goats, poultry, horses, and aquatic species) at land grant institutions is integral to improving the global competitiveness of US animal agriculture and to resolving complex animal and human diseases. However, dwindling federal and state budgets, years of stagnant funding from USDA for the Competitive State Research, Education, and Extension Service National Research Initiative (CSREES-NRI) Competitive Grants Program, significant reductions in farm animal species and in numbers at land grant institutions, and declining enrollment for graduate studies in animal science are diminishing the resources necessary to conduct research on domestic species. Consequently, recruitment of scientists who use such models to conduct research relevant to animal agriculture and biomedicine at land grant institutions is in jeopardy. Concerned stakeholders have addressed this critical problem by conducting workshops, holding a series of meetings with USDA and National Institutes of Health (NIH) officials, and developing a white paper to propose solutions to obstacles impeding the use of domestic species as dual-purpose animal models for high-priority problems common to agriculture and biomedicine. In addition to shortfalls in research support and human resources, overwhelming use of mouse models in biomedicine, lack of advocacy from university administrators, long-standing cultural barriers between agriculture and human medicine, inadequate grantsmanship by animal scientists, and a scarcity of key reagents and resources are major roadblocks to progress. Solutions will require a large financial enhancement of USDA's Competitive Grants Program, educational programs geared toward explaining how research using agricultural animals benefits both animal agriculture and human health, and the development of a new mind-set in land grant institutions that fosters greater cooperation among basic and applied researchers. Recruitment of

  2. A Homogeneous and Self-Dual Interior-Point Linear Programming Algorithm for Economic Model Predictive Control

    DEFF Research Database (Denmark)

    Sokoler, Leo Emil; Frison, Gianluca; Skajaa, Anders

    2015-01-01

    We develop an efficient homogeneous and self-dual interior-point method (IPM) for the linear programs arising in economic model predictive control of constrained linear systems with linear objective functions. The algorithm is based on a Riccati iteration procedure, which is adapted to the linear...... system of equations solved in homogeneous and self-dual IPMs. Fast convergence is further achieved using a warm-start strategy. We implement the algorithm in MATLAB and C. Its performance is tested using a conceptual power management case study. Closed loop simulations show that 1) the proposed algorithm...

  3. A Reformulation of the Dual Career Conceptual Model for Analysis in an Organizational Scope: Revealing new Aspects

    Directory of Open Access Journals (Sweden)

    Heliani Berlato

    2017-01-01

    Full Text Available Couples who live a dual career, in general, are characterized by their continuing professional engagement and their desire for personal growth together. It is a synergy between career aspirations and family sphere, so that they co-exist; reflecting nowadays, a challenge for people who seek to live this duality. Not exempt from it, it is possible to understand the need for management models of people who are in harmony with the desires of dual career couples who are part of organizations. If in the 1980s the existence of dual career couples was not so common in Brazil, nowadays organizations increasingly receive these couples, which impacts the need for people management models to keep up with these social changes. Therefore, the model recognizes that the personal dimension (impacts on the organizational context cannot be avoided, and also that other factors affect both spheres (personal and organizational when referring to the normative roles that permeate these areas. The main intention of this essay is to construct a theoretical model of dual career to consider the factor - organization, as vital to understand (and accept the need to consider other dimensions on the dual career analytical perspective. The first evidences of dual career studies in Brazil revealed that the look at this movement only from the individual's margin is limited. This way, to consider the existence of other dimensions and consequently the influences they may cause, favors an expansion of the perspective, and also brings a detailing about the external factors (organization, society and culture that influence the dual career couple. To consider that this couple, as well as having personal challenges in the relationship between work and family, is subject to the culture that regulates their roles (men and women and that directly influences how organizations will handle that topic reveals the merit of this study. This, in turn, draws attention to the organizational sphere

  4. A single-trace dual-process model of episodic memory: a novel computational account of familiarity and recollection.

    Science.gov (United States)

    Greve, Andrea; Donaldson, David I; van Rossum, Mark C W

    2010-02-01

    Dual-process theories of episodic memory state that retrieval is contingent on two independent processes: familiarity (providing a sense of oldness) and recollection (recovering events and their context). A variety of studies have reported distinct neural signatures for familiarity and recollection, supporting dual-process theory. One outstanding question is whether these signatures reflect the activation of distinct memory traces or the operation of different retrieval mechanisms on a single memory trace. We present a computational model that uses a single neuronal network to store memory traces, but two distinct and independent retrieval processes access the memory. The model is capable of performing familiarity and recollection-based discrimination between old and new patterns, demonstrating that dual-process models need not to rely on multiple independent memory traces, but can use a single trace. Importantly, our putative familiarity and recollection processes exhibit distinct characteristics analogous to those found in empirical data; they diverge in capacity and sensitivity to sparse and correlated patterns, exhibit distinct ROC curves, and account for performance on both item and associative recognition tests. The demonstration that a single-trace, dual-process model can account for a range of empirical findings highlights the importance of distinguishing between neuronal processes and the neuronal representations on which they operate.

  5. Estimate of rain evaporation rates from dual-wavelength lidar measurements: comparison against a model analytical solution

    Science.gov (United States)

    Lolli, Simone; Di Girolamo, Paolo; Demoz, Belay; Li, Xiaowen; Welton, Ellsworth J.

    2018-04-01

    Rain evaporation significantly contributes to moisture and heat cloud budgets. In this paper, we illustrate an approach to estimate the median volume raindrop diameter and the rain evaporation rate profiles from dual-wavelength lidar measurements. These observational results are compared with those provided by a model analytical solution. We made use of measurements from the multi-wavelength Raman lidar BASIL.

  6. Why did distinct types of dual-earner models in Czech, Slovak and East German societies develop and persist?

    Czech Academy of Sciences Publication Activity Database

    Hašková, Hana; Klenner, Ch.

    2010-01-01

    Roč. 22, č. 3 (2010), s. 266-288 ISSN 1437-2940 R&D Projects: GA AV ČR IAA700280901; GA ČR GAP404/10/0021 Institutional research plan: CEZ:AV0Z70280505 Keywords : dual earner model * Central and Eastern Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.037, year: 2010

  7. Due Process in Dual Process: Model-Recovery Simulations of Decision-Bound Strategy Analysis in Category Learning

    Science.gov (United States)

    Edmunds, Charlotte E. R.; Milton, Fraser; Wills, Andy J.

    2018-01-01

    Behavioral evidence for the COVIS dual-process model of category learning has been widely reported in over a hundred publications (Ashby & Valentin, 2016). It is generally accepted that the validity of such evidence depends on the accurate identification of individual participants' categorization strategies, a task that usually falls to…

  8. The Cortical Organization of Speech Processing: Feedback Control and Predictive Coding the Context of a Dual-Stream Model

    Science.gov (United States)

    Hickok, Gregory

    2012-01-01

    Speech recognition is an active process that involves some form of predictive coding. This statement is relatively uncontroversial. What is less clear is the source of the prediction. The dual-stream model of speech processing suggests that there are two possible sources of predictive coding in speech perception: the motor speech system and the…

  9. Hedonic tone and activation level in the mood-creativity link : Toward a dual pathway to creativity model

    NARCIS (Netherlands)

    De Dreu, Carsten K. W.; Baas, Matthijs; Nijstad, Bernard A.

    To understand when and why mood states influence creativity, the authors developed and tested a dual pathway to creativity model; creative fluency (number of ideas or insights) and originality (novelty) are functions of cognitive flexibility, persistence, or some combination thereof. Invoking work

  10. A dual process model of diversity outcomes : The case of the South African Police Service in the Pretoria area

    NARCIS (Netherlands)

    Jackson, L.T.B.; van de Vijver, F.J.R.; Molokoane, D.H.

    2013-01-01

    Orientation: The study addresses the question of how employees of the South African Police Service (SAPS) cope with intercultural relations in an increasingly diverse organisation. Research purpose: A dual-process model of diversity outcomes was tested in which a distinction is made between a

  11. Effect of Matrix-Wellbore Flow and Porosity on Pressure Transient Response in Shale Formation Modeling by Dual Porosity and Dual Permeability System

    Directory of Open Access Journals (Sweden)

    Daolun Li

    2015-01-01

    Full Text Available A mathematical dual porosity and dual permeability numerical model based on perpendicular bisection (PEBI grid is developed to describe gas flow behaviors in shale-gas reservoirs by incorporating slippage corrected permeability and adsorbed gas effect. Parametric studies are conducted for a horizontal well with multiple infinite conductivity hydraulic fractures in shale-gas reservoir to investigate effect of matrix-wellbore flow, natural fracture porosity, and matrix porosity. We find that the ratio of fracture permeability to matrix permeability approximately decides the bottom hole pressure (BHP error caused by omitting the flow between matrix and wellbore and that the effect of matrix porosity on BHP is related to adsorption gas content. When adsorbed gas accounts for large proportion of the total gas storage in shale formation, matrix porosity only has a very small effect on BHP. Otherwise, it has obvious influence. This paper can help us understand the complex pressure transient response due to existence of the adsorbed gas and help petroleum engineers to interpret the field data better.

  12. Rectifier Current Control for an LLC Resonant Converter Based on a Simplified Linearized Model

    Directory of Open Access Journals (Sweden)

    Zhijian Fang

    2018-03-01

    Full Text Available In this paper, a rectifier current control for an LLC resonant converter is proposed, based on a simplified, two-order, linearized model that adds a rectifier current feedback inner loop to improve dynamic performance. Compared to the traditional large-signal model with seven resonant states, this paper utilizes a rectifier current state to represent the characteristics of the resonant states, simplifying the LLC resonant model from seven orders to two orders. Then, the rectifier current feedback inner loop is proposed to increase the control system damping, improving dynamic performance. The modeling and design methodology for the LLC resonant converter are also presented in this paper. A frequency analysis is conducted to verify the accuracy of the simplified model. Finally, a 200 W LLC resonant converter prototype is built to verify the effectiveness of the proposed control strategy. Compared to a traditional single-loop controller, the settling time and voltage droop were reduced from 10.8 ms to 8.6 ms and from 6.8 V to 4.8 V, respectively, using the proposed control strategy.

  13. Logical reasoning versus information processing in the dual-strategy model of reasoning.

    Science.gov (United States)

    Markovits, Henry; Brisson, Janie; de Chantal, Pier-Luc

    2017-01-01

    One of the major debates concerning the nature of inferential reasoning is between counterexample-based strategies such as mental model theory and statistical strategies underlying probabilistic models. The dual-strategy model, proposed by Verschueren, Schaeken, & d'Ydewalle (2005a, 2005b), which suggests that people might have access to both kinds of strategy has been supported by several recent studies. These have shown that statistical reasoners make inferences based on using information about premises in order to generate a likelihood estimate of conclusion probability. However, while results concerning counterexample reasoners are consistent with a counterexample detection model, these results could equally be interpreted as indicating a greater sensitivity to logical form. In order to distinguish these 2 interpretations, in Studies 1 and 2, we presented reasoners with Modus ponens (MP) inferences with statistical information about premise strength and in Studies 3 and 4, naturalistic MP inferences with premises having many disabling conditions. Statistical reasoners accepted the MP inference more often than counterexample reasoners in Studies 1 and 2, while the opposite pattern was observed in Studies 3 and 4. Results show that these strategies must be defined in terms of information processing, with no clear relations to "logical" reasoning. These results have additional implications for the underlying debate about the nature of human reasoning. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  14. A longitudinal investigation of older adults' physical activity: Testing an integrated dual-process model.

    Science.gov (United States)

    Arnautovska, Urska; Fleig, Lena; O'Callaghan, Frances; Hamilton, Kyra

    2017-02-01

    To assess the effects of conscious and non-conscious processes for prediction of older adults' physical activity (PA), we tested a dual-process model that integrated motivational (behavioural intention) and volitional (action planning and coping planning) processes with non-conscious, automatic processes (habit). Participants (N = 215) comprised community-dwelling older adults (M = 73.8 years). A longitudinal design was adopted to investigate direct and indirect effects of intentions, habit strength (Time 1), and action planning and coping planning (Time 2) on PA behaviour (Time 3). Structural equation modelling was used to evaluate the model. The model provided a good fit to the data, accounting for 44% of the variance in PA behaviour at Time 3. PA was predicted by intentions, action planning, and habit strength, with action planning mediating the intention-behaviour relationship. An effect of sex was also found where males used fewer planning strategies and engaged in more PA than females. By investigating an integration of conscious and non-conscious processes, this study provides a novel understanding of older adults' PA. Interventions aiming to promote PA behaviour of older adults should target the combination of psychological processes.

  15. Testing a Dual Process Model of Gender-Based Violence: A Laboratory Examination.

    Science.gov (United States)

    Berke, Danielle S; Zeichner, Amos

    2016-01-01

    The dire impact of gender-based violence on society compels development of models comprehensive enough to capture the diversity of its forms. Research has established hostile sexism (HS) as a robust predictor of gender-based violence. However, to date, research has yet to link men's benevolent sexism (BS) to physical aggression toward women, despite correlations between BS and HS and between BS and victim blaming. One model, the opposing process model of benevolent sexism (Sibley & Perry, 2010), suggests that, for men, BS acts indirectly through HS to predict acceptance of hierarchy-enhancing social policy as an expression of a preference for in-group dominance (i. e., social dominance orientation [SDO]). The extent to which this model applies to gender-based violence remains untested. Therefore, in this study, 168 undergraduate men in a U. S. university participated in a competitive reaction time task, during which they had the option to shock an ostensible female opponent as a measure of gender-based violence. Results of multiple-mediation path analyses indicated dual pathways potentiating gender-based violence and highlight SDO as a particularly potent mechanism of this violence. Findings are discussed in terms of group dynamics and norm-based violence prevention.

  16. Three-dimensional visualization and analysis of a dual-disk resonator with dielectric misalignment and surface anomaly using edge finite elements

    Science.gov (United States)

    Villalva, Gustavo Jose

    The search for life in other planets and solar systems by scientists and engineers brings about an effort to design and develop equipment of high standards which extend the capability to listen for signals which have been traveling in space many light years. In this study the purpose was to provide a more realistic and illustrative scientific understanding of one such piece of precision equipment, the dielectric resonator, which designers seek to extend its frequency stability below 10-15. At such tolerances special cryogenic cooling procedures are required. Due to its accuracy it can be used to set short term time and frequency standards to correct the atomic clock. A theoretical means of studying this type of resonant device is necessary. One contribution made in extending the current understanding of such a device is the scientific tool developed specifically for this dissertation. It applies the Minimum Theorem from variational calculus using edge finite elements for numerical modeling. The use of quasi-linear vector basis functions allowed an implementation of Helmholtz's three-dimensional equation without a penalty term. Furthermore, the intermixing of spurious solutions with the true ones due to a nodal basis was eliminated. Calculation of the average edge electric fields was made possible by applying the Rayleigh-Ritz criterion. Model enclosure was provided by a cylindrical metal shield situated in a rectangular coordinate system. Linear, homogeneous, nonmagnetic, lossless, uniaxial, and anisotropic media were considered. Integration of NASA's Unix Lanczos eigensolver permitted the accurate estimation of the smaller eigenvalues and associated vectors for large matrices on workstations and personal computers in relatively short computational times. Calculation of the lower frequency modes demonstrated the ability to address device imperfections for two selected cases. Both were influenced by problems encountered in the use of crystals constrained by cost, or

  17. Identifying western yellow-billed cuckoo breeding habitat with a dual modelling approach

    Science.gov (United States)

    Johnson, Matthew J.; Hatten, James R.; Holmes, Jennifer A.; Shafroth, Patrick B.

    2017-01-01

    The western population of the yellow-billed cuckoo (Coccyzus americanus) was recently listed as threatened under the federal Endangered Species Act. Yellow-billed cuckoo conservation efforts require the identification of features and area requirements associated with high quality, riparian forest habitat at spatial scales that range from nest microhabitat to landscape, as well as lower-suitability areas that can be enhanced or restored. Spatially explicit models inform conservation efforts by increasing ecological understanding of a target species, especially at landscape scales. Previous yellow-billed cuckoo modelling efforts derived plant-community maps from aerial photography, an expensive and oftentimes inconsistent approach. Satellite models can remotely map vegetation features (e.g., vegetation density, heterogeneity in vegetation density or structure) across large areas with near perfect repeatability, but they usually cannot identify plant communities. We used aerial photos and satellite imagery, and a hierarchical spatial scale approach, to identify yellow-billed cuckoo breeding habitat along the Lower Colorado River and its tributaries. Aerial-photo and satellite models identified several key features associated with yellow-billed cuckoo breeding locations: (1) a 4.5 ha core area of dense cottonwood-willow vegetation, (2) a large native, heterogeneously dense forest (72 ha) around the core area, and (3) moderately rough topography. The odds of yellow-billed cuckoo occurrence decreased rapidly as the amount of tamarisk cover increased or when cottonwood-willow vegetation was limited. We achieved model accuracies of 75–80% in the project area the following year after updating the imagery and location data. The two model types had very similar probability maps, largely predicting the same areas as high quality habitat. While each model provided unique information, a dual-modelling approach provided a more complete picture of yellow-billed cuckoo habitat

  18. Continuum Modeling of Inductor Hysteresis and Eddy Current Loss Effects in Resonant Circuits

    Energy Technology Data Exchange (ETDEWEB)

    Pries, Jason L. [ORNL; Tang, Lixin [ORNL; Burress, Timothy A. [ORNL

    2017-10-01

    This paper presents experimental validation of a high-fidelity toroid inductor modeling technique. The aim of this research is to accurately model the instantaneous magnetization state and core losses in ferromagnetic materials. Quasi–static hysteresis effects are captured using a Preisach model. Eddy currents are included by coupling the associated quasi-static Everett function to a simple finite element model representing the inductor cross sectional area. The modeling technique is validated against the nonlinear frequency response from two different series RLC resonant circuits using inductors made of electrical steel and soft ferrite. The method is shown to accurately model shifts in resonant frequency and quality factor. The technique also successfully predicts a discontinuity in the frequency response of the ferrite inductor resonant circuit.

  19. Analysis of Dual Mobility Liner Rim Damage Using Retrieved Components and Cadaver Models.

    Science.gov (United States)

    Nebergall, Audrey K; Freiberg, Andrew A; Greene, Meridith E; Malchau, Henrik; Muratoglu, Orhun; Rowell, Shannon; Zumbrunn, Thomas; Varadarajan, Kartik M

    2016-07-01

    The objective of this study was to assess the retentive rim of retrieved dual mobility liners for visible evidence of deformation from femoral neck contact and to use cadaver models to determine if anterior soft tissue impingement could contribute to such deformation. Fifteen surgically retrieved polyethylene liners were assessed for evidence of rim deformation. The average time in vivo was 31.4 months, and all patients were revised for reasons other than intraprosthetic dislocation. Liner interaction with the iliopsoas was studied visually and with fluoroscopy in cadaver specimens using a dual mobility system different than the retrieval study. For fluoroscopic visualization, a metal wire was sutured to the iliopsoas and wires were also embedded into grooves on the outer surface of the liner and the inner head. All retrievals showed evidence of femoral neck contact. The cadaver experiments showed that liner motion was impeded by impingement with the iliopsoas tendon in low flexion angles. When observing the hip during maximum hyperextension, 0°, 15°, and 30° of flexion, there was noticeable tenting of the iliopsoas caused by impingement with the liner. Liner rim deformation resulting from contact with the femoral neck likely begins during early in vivo function. The presence of deformation is indicative of a mechanism inhibiting mobility of the liner. The cadaver studies showed that liner motion could be impeded because of its impingement with the iliopsoas. Such soft tissue impingement may be one mechanism by which liner motion is routinely inhibited, which can result in load transfer from the neck to the rim. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. Modeling indirect detectors for performance optimization of a digital mammographic detector for dual energy applications

    International Nuclear Information System (INIS)

    Martini, N; Koukou, V; Sotiropoulou, P; Nikiforidis, G; Kalyvas, N; Michail, C; Valais, I; Kandarakis, I; Fountos, G; Bakas, A

    2015-01-01

    Dual Energy imaging is a promising method for visualizing masses and microcalcifications in digital mammography. The advent of two X-ray energies (low and high) requires a suitable detector. The scope of this work is to determine optimum detector parameters for dual energy applications. The detector was modeled through the linear cascaded (LCS) theory. It was assumed that a phosphor material was coupled to a CMOS photodetector (indirect detection). The pixel size was 22.5 μm. The phosphor thickness was allowed to vary between 20mg/cm 2 and 160mg/cm 2 The phosphor materials examined where Gd 2 O 2 S:Tb and Gd 2 O 2 S:Eu. Two Tungsten (W) anode X-ray spectra at 35 kV (filtered with 100 μm Palladium (Pd)) and 70 kV (filtered with 800 pm Ytterbium (Yb)), corresponding to low and high energy respectively, were considered to be incident on the detector. For each combination the contrast- to-noise ratio (CNR) and the detector optical gain (DOG), showing the sensitivity of the detector, were calculated. The 40 mg/cm 2 and 70 mg/cm 2 Gd 2 O 2 S:Tb exhibited the higher DOG values for the low and high energy correspondingly. Higher CNR between microcalcification and mammary gland exhibited the 70mg/cm 2 and the 100mg/cm 2 Gd 2 O 2 S:Tb for the low and the high energy correspondingly

  1. A model of the transverse modes of stable and unstable porro-prism resonators using symmetry considerations

    Science.gov (United States)

    Burger, Liesl; Forbes, Andrew

    2007-09-01

    A simple model of a Porro prism laser resonator has been found to correctly predict the formation of the "petal" mode patterns typical of these resonators. A geometrical analysis of the petals suggests that these petals are the lowest-order modes of this type of resonator. Further use of the model reveals the formation of more complex beam patterns, and the nature of these patterns is investigated. Also, the output of stable and unstable resonator modes is presented.

  2. Modeling intraparticle transports during propylene polymerizations using supported metallocene and dual function metallocene as catalysts: Single particle model

    Directory of Open Access Journals (Sweden)

    Li Hua-Rong

    2014-01-01

    Full Text Available Two improved multigrain models (MGMs for preparing homopolypropylene and long chain branched polypropylene via propylene polymerization using silica-supported metallocene or dual function metallocene as catalysts are presented in this paper. The presented models are used to predict the intraparticle flow fields involved in the polymerizations. The simulation results show that the flow field distributions involve dare basically identical. The results also show that both the two polymerization processes have an initiation stage and the controlling step for them is reaction-diffusion-reaction with the polymerization proceeding. Furthermore, the simulation results show that the intra particle mass transfer resistance has significant effect on the polymerization but the heat transfer resistance can be ignored.

  3. Brain activations during bimodal dual tasks depend on the nature and combination of component tasks

    Directory of Open Access Journals (Sweden)

    Emma eSalo

    2015-02-01

    Full Text Available We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or simple (speaker-gender or font-shade discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley’s model modality atypical, that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.

  4. Transition polarizability model of induced resonance Raman optical activity

    Czech Academy of Sciences Publication Activity Database

    Yamamoto, S.; Bouř, Petr

    2013-01-01

    Roč. 34, č. 25 (2013), s. 2152-2158 ISSN 0192-8651 R&D Projects: GA ČR GAP208/11/0105; GA ČR GA13-03978S; GA MŠk(CZ) LH11033 Grant - others:AV ČR(CZ) M200551205 Institutional support: RVO:61388963 Keywords : induced resonance Raman optical activity * europium complexes * density functional computations * light scattering Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.601, year: 2013

  5. Duality in non-linear B and F models: equivalence between self-dual and topologically massive Born-Infeld B and F models

    International Nuclear Information System (INIS)

    Menezes, R.; Nascimento, J.R.S.; Ribeiro, R.F.; Wotzasek, C.

    2002-01-01

    We study the dual equivalence between the non-linear generalization of the self-dual (NSD BF ) and the topologically massive B and F models with particular emphasis on the non-linear electrodynamics proposed by Born and Infeld. This is done through a dynamical gauge embedding of the non-linear self-dual model yielding to a gauge invariant and dynamically equivalent theory. We clearly show that non-polinomial NSD BF models can be map, through a properly defined duality transformation into TM BF actions. The general result obtained is then particularized for a number of examples, including the Born-Infeld-BF (BIBF) model that has experienced a revival in the recent literature

  6. A Continuous Dual-Process Model of Remember/Know Judgments

    Science.gov (United States)

    Wixted, John T.; Mickes, Laura

    2010-01-01

    The dual-process theory of recognition memory holds that recognition decisions can be based on recollection or familiarity, and the remember/know procedure is widely used to investigate those 2 processes. Dual-process theory in general and the remember/know procedure in particular have been challenged by an alternative strength-based…

  7. Towards model-based control of RCCI-CDF mode-switching in dual fuel engines

    NARCIS (Netherlands)

    Indrajuana, Armando; Bekdemir, C.; Feru, E.; Willems, F.P.T.

    2018-01-01

    The operation of a dual fuel combustion engine using combustion mode-switching offers the benefit of higher thermal efficiency compared to single-mode operation. For various fuel combinations, the engine research community has shown that running dual fuel engines in Reactivity Controlled Compression

  8. Physical optics modeling of modal patterns in a crossed porro prism resonator

    CSIR Research Space (South Africa)

    Litvin, IA

    2006-07-01

    Full Text Available A physical optics model is proposed to describe the transverse modal patterns in crossed Porro prism resonators. The model departs from earlier attempts in that the prisms are modeled as non-classical rotating elements with amplitude and phase...

  9. Random matrix approach to plasmon resonances in the random impedance network model of disordered nanocomposites

    Science.gov (United States)

    Olekhno, N. A.; Beltukov, Y. M.

    2018-05-01

    Random impedance networks are widely used as a model to describe plasmon resonances in disordered metal-dielectric and other two-component nanocomposites. In the present work, the spectral properties of resonances in random networks are studied within the framework of the random matrix theory. We have shown that the appropriate ensemble of random matrices for the considered problem is the Jacobi ensemble (the MANOVA ensemble). The obtained analytical expressions for the density of states in such resonant networks show a good agreement with the results of numerical simulations in a wide range of metal filling fractions 0

  10. Topological Symmetry, Spin Liquids and CFT Duals of Polyakov Model with Massless Fermions

    Energy Technology Data Exchange (ETDEWEB)

    Unsal, Mithat

    2008-04-30

    We prove the absence of a mass gap and confinement in the Polyakov model with massless complex fermions in any representation of the gauge group. A U(1){sub *} topological shift symmetry protects the masslessness of one dual photon. This symmetry emerges in the IR as a consequence of the Callias index theorem and abelian duality. For matter in the fundamental representation, the infrared limits of this class of theories interpolate between weakly and strongly coupled conformal field theory (CFT) depending on the number of flavors, and provide an infinite class of CFTs in d = 3 dimensions. The long distance physics of the model is same as certain stable spin liquids. Altering the topology of the adjoint Higgs field by turning it into a compact scalar does not change the long distance dynamics in perturbation theory, however, non-perturbative effects lead to a mass gap for the gauge fluctuations. This provides conceptual clarity to many subtle issues about compact QED{sub 3} discussed in the context of quantum magnets, spin liquids and phase fluctuation models in cuprate superconductors. These constructions also provide new insights into zero temperature gauge theory dynamics on R{sup 2,1} and R{sup 2,1} x S{sup 1}. The confined versus deconfined long distance dynamics is characterized by a discrete versus continuous topological symmetry.

  11. Two-dimensional analytical model for dual-material control-gate tunnel FETs

    Science.gov (United States)

    Xu, Hui Fang; Dai, Yue Hua; Gui Guan, Bang; Zhang, Yong Feng

    2016-09-01

    An analytical model for a dual-material control-gate (DMCG) tunnel field effect transistor (TFET) is presented for the first time in this paper, and the influence of the mobile charges on the potential profile is taken into account. On the basis of the potential profile, the lateral electric field is derived and the expression for the drain current is obtained by integrating the band-to-band tunneling (BTBT) generation rate applicable to low-bandgap and high-bandgap materials over the tunneling region. The model also predicts the impacts of the control-gate work function on the potential and drain current. The advantage of this work is that it not only offers physical insight into device physics but also provides the basic designing guideline for DMCG TFETs, enabling the designer to optimize the device in terms of the on-state current, the on-off current ratio, and suppressed ambipolar behavior. Very good agreements for both the potential and drain current are observed between the model calculations and the simulated results.

  12. Modeling of Dual Gate Material Hetero-dielectric Strained PNPN TFET for Improved ON Current

    Science.gov (United States)

    Kumari, Tripty; Saha, Priyanka; Dash, Dinesh Kumar; Sarkar, Subir Kumar

    2018-01-01

    The tunnel field effect transistor (TFET) is considered to be a promising alternative device for future low-power VLSI circuits due to its steep subthreshold slope, low leakage current and its efficient performance at low supply voltage. However, the main challenging issue associated with realizing TFET for wide scale applications is its low ON current. To overcome this, a dual gate material with the concept of dielectric engineering has been incorporated into conventional TFET structure to tune the tunneling width at source-channel interface allowing significant flow of carriers. In addition to this, N+ pocket is implanted at source-channel junction of the proposed structure and the effect of strain is added for exploring the performance of the model in nanoscale regime. All these added features upgrade the device characteristics leading to higher ON current, low leakage and low threshold voltage. The present work derives the surface potential, electric field expression and drain current by solving 2D Poisson's equation at different boundary conditions. A comparative analysis of proposed model with conventional TFET has been done to establish the superiority of the proposed structure. All analytical results have been compared with the results obtained in SILVACO ATLAS device simulator to establish the accuracy of the derived analytical model.

  13. FAO-56 Dual Model Combined with Multi-Sensor Remote Sensing for Regional Evapotranspiration Estimations

    Directory of Open Access Journals (Sweden)

    Rim Amri

    2014-06-01

    Full Text Available The main goal of this study is to evaluate the potential of the FAO-56 dual technique for the estimation of regional evapotranspiration (ET and its constituent components (crop transpiration and soil evaporation, for two classes of vegetation (olives trees and cereals in the semi-arid region of the Kairouan plain in central Tunisia. The proposed approach combines the FAO-56 technique with remote sensing (optical and microwave, not only for vegetation characterization, as proposed in other studies but also for the estimation of soil evaporation, through the use of satellite moisture products. Since it is difficult to use ground flux measurements to validate remotely sensed data at regional scales, comparisons were made with the land surface model ISBA-A-gs which is a physical SVAT (Soil–Vegetation–Atmosphere Transfer model, an operational tool developed by Météo-France. It is thus shown that good results can be obtained with this relatively simple approach, based on the FAO-56 technique combined with remote sensing, to retrieve temporal variations of ET. The approach proposed for the daily mapping of evapotranspiration at 1 km resolution is approved in two steps, for the period between 1991 and 2007. In an initial step, the ISBA-A-gs soil moisture outputs are compared with ERS/WSC products. Then, the output of the FAO-56 technique is compared with the output generated by the SVAT ISBA-A-gs model.

  14. Long-term consequences of a prolonged febrile seizure in a dual pathology model.

    Science.gov (United States)

    Gibbs, Steve; Chattopadhyaya, Bidisha; Desgent, Sébastien; Awad, Patricia N; Clerk-Lamalice, Olivier; Levesque, Maxime; Vianna, Rose-Mari; Rébillard, Rose-Marie; Delsemme, Andrée-Anne; Hébert, David; Tremblay, Luc; Lepage, Martin; Descarries, Laurent; Di Cristo, Graziella; Carmant, Lionel

    2011-08-01

    Clinical evidence suggests that febrile status epilepticus (SE) in children can lead to acute hippocampal injury and subsequent temporal lobe epilepsy. The contribution of febrile SE to the mechanisms underlying temporal lobe epilepsy are however poorly understood. A rat model of temporal lobe epilepsy following hyperthermic SE was previously established in our laboratory, wherein a focal cortical lesion induced at postnatal day 1 (P1), followed by a hyperthermic SE (more than 30 min) at P10, leads to hippocampal atrophy at P22 (dual pathology model) and spontaneous recurrent seizures (SRS) with mild visuospatial memory deficits in adult rats. The goal of this study was to identify the long term electrophysiological, anatomical and molecular changes in this model. Following hyperthermic SE, all cortically lesioned pups developed progressive SRS as adults, characterized by the onset of highly rhythmic activity in the hippocampus. A reduction of hippocampal volume on the side of the lesion preceded the SRS and was associated with a loss of hippocampal neurons, a marked decrease in pyramidal cell spine density, an increase in the hippocampal levels of NMDA receptor NR2A subunit, but no significant change in GABA receptors. These findings suggest that febrile SE in the abnormal brain leads to hippocampal injury that is followed by progressive network reorganization and molecular changes that contribute to the epileptogenesis as well as the observed memory deficits. Copyright © 2011 Elsevier Inc. All rights reserved.

  15. Dual RBFNNs-Based Model-Free Adaptive Control With Aspen HYSYS Simulation.

    Science.gov (United States)

    Zhu, Yuanming; Hou, Zhongsheng; Qian, Feng; Du, Wenli

    2017-03-01

    In this brief, we propose a new data-driven model-free adaptive control (MFAC) method with dual radial basis function neural networks (RBFNNs) for a class of discrete-time nonlinear systems. The main novelty lies in that it provides a systematic design method for controller structure by the direct usage of I/O data, rather than using the first-principle model or offline identified plant model. The controller structure is determined by equivalent-dynamic-linearization representation of the ideal nonlinear controller, and the controller parameters are tuned by the pseudogradient information extracted from the I/O data of the plant, which can deal with the unknown nonlinear system. The stability of the closed-loop control system and the stability of the training process for RBFNNs are guaranteed by rigorous theoretical analysis. Meanwhile, the effectiveness and the applicability of the proposed method are further demonstrated by the numerical example and Aspen HYSYS simulation of distillation column in crude styrene produce process.

  16. Modeling and understanding of effects of randomness in arrays of resonant meta-atoms

    DEFF Research Database (Denmark)

    Tretyakov, Sergei A.; Albooyeh, Mohammad; Alitalo, Pekka

    2013-01-01

    In this review presentation we will discuss approaches to modeling and understanding electromagnetic properties of 2D and 3D lattices of small resonant particles (meta-atoms) in transition from regular (periodic) to random (amorphous) states. Nanostructured metasurfaces (2D) and metamaterials (3D......) are arrangements of optically small but resonant particles (meta-atoms). We will present our results on analytical modeling of metasurfaces with periodical and random arrangements of electrically and magnetically resonant meta-atoms with identical or random sizes, both for the normal and oblique-angle excitations....... We show how the electromagnetic response of metasurfaces is related to the statistical parameters of the structure. Furthermore, we will discuss the phenomenon of anti-resonance in extracted effective parameters of metamaterials and clarify its relation to the periodicity (or amorphous nature...

  17. Computer aided design of Langasite resonant cantilevers: analytical models and simulations

    Science.gov (United States)

    Tellier, C. R.; Leblois, T. G.; Durand, S.

    2010-05-01

    Analytical models for the piezoelectric excitation and for the wet micromachining of resonant cantilevers are proposed. Firstly, computations of metrological performances of micro-resonators allow us to select special cuts and special alignment of the cantilevers. Secondly the self-elaborated simulator TENSOSIM based on the kinematic and tensorial model furnishes etching shapes of cantilevers. As the result the number of selected cuts is reduced. Finally the simulator COMSOL® is used to evaluate the influence of final etching shape on metrological performances and especially on the resonance frequency. Changes in frequency are evaluated and deviating behaviours of structures with less favourable built-ins are tested showing that the X cut is the best cut for LGS resonant cantilevers vibrating in flexural modes (type 1 and type 2) or in torsion mode.

  18. A model for precalculus students to determine the resonance frequency of a trumpet mouthpiece

    Science.gov (United States)

    Chapman, Robert C.

    2004-05-01

    The trumpet mouthpiece as a Helmholtz resonator is used to show precalculus students a mathematical model for determining the approximate resonance frequency of the mouthpiece. The mathematics is limited to algebra and trigonometry. Using a system of mouthpieces that have interchangeable cups and backbores, students are introduced to the acoustics of this resonator. By gathering data on 51 different configurations of mouthpieces, the author modifies the existing Helmholtz resonator equation to account for both cup volumes and backbore configurations. Students then use this model for frequency predictions. Included are how to measure the different physical attributes of a trumpet mouthpiece at minimal cost. This includes methods for measuring cup volume, backbore volume, backbore length, throat area, etc. A portion of this phase is de-signed for students to become acquainted with some of the vocabulary of acoustics and the physics of sound.

  19. Texture zero neutrino models and their connection with resonant leptogenesis

    Science.gov (United States)

    Achelashvili, Avtandil; Tavartkiladze, Zurab

    2018-04-01

    Within the low scale resonant leptogenesis scenario, the cosmological CP asymmetry may arise by radiative corrections through the charged lepton Yukawa couplings. While in some cases, as one expects, decisive role is played by the λτ coupling, we show that in specific neutrino textures only by inclusion of the λμ the cosmological CP violation is generated at 1-loop level. With the purpose to relate the cosmological CP violation to the leptonic CP phase δ, we consider an extension of MSSM with two right handed neutrinos (RHN), which are degenerate in mass at high scales. Together with this, we first consider two texture zero 3 × 2 Dirac Yukawa matrices of neutrinos. These via see-saw generated neutrino mass matrices augmented by single ΔL = 2 dimension five (d = 5) operator give predictive neutrino sectors with calculable CP asymmetries. The latter is generated through λμ,τ coupling(s) at 1-loop level. Detailed analysis of the leptogenesis is performed. We also revise some one texture zero Dirac Yukawa matrices, considered earlier, and show that addition of a single ΔL = 2, d = 5 entry in the neutrino mass matrices, together with newly computed 1-loop corrections to the CP asymmetries, give nice accommodation of the neutrino sector and desirable amount of the baryon asymmetry via the resonant leptogenesis even for rather low RHN masses (∼few TeV-107 GeV).

  20. Mathematical Modeling of Resonant Processes in Confined Geometry of Atomic and Atom-Ion Traps

    Science.gov (United States)

    Melezhik, Vladimir S.

    2018-02-01

    We discuss computational aspects of the developed mathematical models for resonant processes in confined geometry of atomic and atom-ion traps. The main attention is paid to formulation in the nondirect product discrete-variable representation (npDVR) of the multichannel scattering problem with nonseparable angular part in confining traps as the boundary-value problem. Computational efficiency of this approach is demonstrated in application to atomic and atom-ion confinement-induced resonances we predicted recently.

  1. Roper resonances and generator coordinate method in the chiral-soliton model

    International Nuclear Information System (INIS)

    Meissner, T.; Gruemmer, F.; Goeke, K.; Harvey, M.

    1989-01-01

    The nucleon and Δ Roper resonances are described by means of the generator coordinate method in the framework of the nontopological chiral-soliton model. Solitons with various sizes are constructed with a constrained variational technique. The masses of all known Roper resonances come out to within 150 MeV of their experimental values. A nucleon compression modulus of about 4 GeV is extracted. The limits of the approach due to the polarization of the Dirac vacuum are displayed

  2. Dual-source computed tomography. Effect on regional and global left ventricular function assessment compared to magnetic resonance imaging; Untersuchung der regionalen und globalen linksventrikulaeren Funktion mit der Dual-Source-Computertomografie im Vergleich zur Magnetresonanztomografie

    Energy Technology Data Exchange (ETDEWEB)

    Lueders, F.; Seifarth, H.; Wessling, J.; Heindel, W.; Juergens, Kai Uwe [Inst. fuer Klinische Radiologie, Universitaetsklinikum Muenster (Germany); Fischbach, R. [Klinik fuer Radiologie, Nuklearmedizin und Neuroradiologie, Asklepios Klinik Altona (Germany)

    2009-10-15

    Purpose: to determine regional and global left ventricular (LV) functional parameters and to perform segmental wall thickness (SWT) and motion (WM) analysis of dual source CT (DSCT) with optimized temporal resolution versus MRI. Materials and Methods: 30 patients with known or suspected CAD, non-obstructive HCM, DCM, ARVCM, Fallot Tetralogy, cardiac sarcoidosis and cardiac metastasis underwent DSCT and MRI. The DSCT and MR images were evaluated: end-systolic (ESV), end-diastolic LV (EDV) volumes, stroke volume (SV), ejection fraction (EF), and myocardial mass (MM) as well as LV wall thickening and segmental WM applying the AHA model were obtained and statistically analyzed. Results: The mean LV-EDV (r = 0.96) and ESV (r = 0.98) as well as LV-EF (r = 0.97), SV (r = 0.83), and MM (r = 0.95) correlated well. Bland Altman analysis revealed little systematic underestimation of LV-EF (-1.1 {+-} 7.8%), EDV (-0.3 {+-} 18.2 ml), SV (-1.3 {+-} 16.7 ml) and little overestimation of ESV (1.1 {+-} 7.8 ml) and MM (12.8 {+-} 14.4 g) determined by DSCT. Systolic reconstruction time points correlated well (DSCT 32.2 {+-} 6.7 vs. MRI 35.6 {+-} 4.4% RR-interval). The LV wall thickness obtained by DSCT and MRI showed close correlation in all segments (diameter diff 0.42 {+-} 1 mm). In 413 segments (89%) WM abnormalities were equally rated, whereas DSCT tended to underestimate the degree of wall motion impairment. Conclusion: DSCT with optimized temporal resolution enables regional and global LV function analysis as well as segmental WM analysis in good correlation with MRI. However, the degree of WM impairment is slightly underestimated by DSCT. (orig.)

  3. Construction of anthropomorphic hybrid, dual-lattice voxel models for optimizing image quality and dose in radiography

    Science.gov (United States)

    Petoussi-Henss, Nina; Becker, Janine; Greiter, Matthias; Schlattl, Helmut; Zankl, Maria; Hoeschen, Christoph

    2014-03-01

    In radiography there is generally a conflict between the best image quality and the lowest possible patient dose. A proven method of dosimetry is the simulation of radiation transport in virtual human models (i.e. phantoms). However, while the resolution of these voxel models is adequate for most dosimetric purposes, they cannot provide the required organ fine structures necessary for the assessment of the imaging quality. The aim of this work is to develop hybrid/dual-lattice voxel models (called also phantoms) as well as simulation methods by which patient dose and image quality for typical radiographic procedures can be determined. The results will provide a basis to investigate by means of simulations the relationships between patient dose and image quality for various imaging parameters and develop methods for their optimization. A hybrid model, based on NURBS (Non Linear Uniform Rational B-Spline) and PM (Polygon Mesh) surfaces, was constructed from an existing voxel model of a female patient. The organs of the hybrid model can be then scaled and deformed in a non-uniform way i.e. organ by organ; they can be, thus, adapted to patient characteristics without losing their anatomical realism. Furthermore, the left lobe of the lung was substituted by a high resolution lung voxel model, resulting in a dual-lattice geometry model. "Dual lattice" means in this context the combination of voxel models with different resolution. Monte Carlo simulations of radiographic imaging were performed with the code EGS4nrc, modified such as to perform dual lattice transport. Results are presented for a thorax examination.

  4. Implementation science: a role for parallel dual processing models of reasoning?

    Directory of Open Access Journals (Sweden)

    Phillips Paddy A

    2006-05-01

    Full Text Available Abstract Background A better theoretical base for understanding professional behaviour change is needed to support evidence-based changes in medical practice. Traditionally strategies to encourage changes in clinical practices have been guided empirically, without explicit consideration of underlying theoretical rationales for such strategies. This paper considers a theoretical framework for reasoning from within psychology for identifying individual differences in cognitive processing between doctors that could moderate the decision to incorporate new evidence into their clinical decision-making. Discussion Parallel dual processing models of reasoning posit two cognitive modes of information processing that are in constant operation as humans reason. One mode has been described as experiential, fast and heuristic; the other as rational, conscious and rule based. Within such models, the uptake of new research evidence can be represented by the latter mode; it is reflective, explicit and intentional. On the other hand, well practiced clinical judgments can be positioned in the experiential mode, being automatic, reflexive and swift. Research suggests that individual differences between people in both cognitive capacity (e.g., intelligence and cognitive processing (e.g., thinking styles influence how both reasoning modes interact. This being so, it is proposed that these same differences between doctors may moderate the uptake of new research evidence. Such dispositional characteristics have largely been ignored in research investigating effective strategies in implementing research evidence. Whilst medical decision-making occurs in a complex social environment with multiple influences and decision makers, it remains true that an individual doctor's judgment still retains a key position in terms of diagnostic and treatment decisions for individual patients. This paper argues therefore, that individual differences between doctors in terms of

  5. Implementation science: a role for parallel dual processing models of reasoning?

    Science.gov (United States)

    Sladek, Ruth M; Phillips, Paddy A; Bond, Malcolm J

    2006-05-25

    A better theoretical base for understanding professional behaviour change is needed to support evidence-based changes in medical practice. Traditionally strategies to encourage changes in clinical practices have been guided empirically, without explicit consideration of underlying theoretical rationales for such strategies. This paper considers a theoretical framework for reasoning from within psychology for identifying individual differences in cognitive processing between doctors that could moderate the decision to incorporate new evidence into their clinical decision-making. Parallel dual processing models of reasoning posit two cognitive modes of information processing that are in constant operation as humans reason. One mode has been described as experiential, fast and heuristic; the other as rational, conscious and rule based. Within such models, the uptake of new research evidence can be represented by the latter mode; it is reflective, explicit and intentional. On the other hand, well practiced clinical judgments can be positioned in the experiential mode, being automatic, reflexive and swift. Research suggests that individual differences between people in both cognitive capacity (e.g., intelligence) and cognitive processing (e.g., thinking styles) influence how both reasoning modes interact. This being so, it is proposed that these same differences between doctors may moderate the uptake of new research evidence. Such dispositional characteristics have largely been ignored in research investigating effective strategies in implementing research evidence. Whilst medical decision-making occurs in a complex social environment with multiple influences and decision makers, it remains true that an individual doctor's judgment still retains a key position in terms of diagnostic and treatment decisions for individual patients. This paper argues therefore, that individual differences between doctors in terms of reasoning are important considerations in any

  6. Dual hit lipopolysaccharide & oleic acid combination induced rat model of acute lung injury/acute respiratory distress syndrome.

    Science.gov (United States)

    Hagawane, T N; Gaikwad, R V; Kshirsagar, N A

    2016-05-01

    Despite advances in therapy and overall medical care, acute lung injury (ALI)/acute respiratory distress syndrome (ARDS) management remains a problem. Hence the objective of this study was to develop a rat model that mimics human ALI/ARDS. Four groups of Wistar rats, 48 per group were treated with (i) intratracheal (IT) lipopolysaccharide (LPS) (5 mg/kg) dissolved in normal saline (NS), (ii) intravenous (iv) oleic acid (OA) (250 μl/kg) suspension in bovine serum albumin (BSA), (iii) dual hit: IT LPS (2 mg/kg) dissolved in NS and iv OA (100 μl/kg) and (iv) control group: IT NS and iv BSA. From each group at set periods of time various investigations like chest x-rays, respiratory rate (RR), tidal volume (TV), total cell count, differential cell count, total protein count and cytokine levels in bronchoalveolar lavage fluid (BALF), lung wet/dry weight ratio and histopathological examination were done. It was noted that the respiratory rate, and tumour necrosis factor-α (TNF-α) levels were significantly higher at 4 h in the dual hit group as compared to LPS, OA and control groups. Interleukin-6 (IL-6) levels were significantly higher in the dual hit group as compared to LPS at 8 and 24 h, OA at 8 h and control (at all time intervals) group. IL-1β levels were significantly higher in LPS and dual hit groups at all time intervals, but not in OA and control groups. The injury induced in dual hit group was earlier and more sustained as compared to LPS and OA alone. The lung pathology and changes in respiration functions produced by the dual hit model were closer to the diagnostic criteria of ALI/ARDS in terms of clinical manifestations and pulmonary injury and the injury persisted longer as compared to LPS and OA single hit model. Therefore, the ARDS model produced by the dual hit method was closer to the diagnostic criteria of ARDS in terms of clinical manifestations and pulmonary injury.

  7. Scaling up stomatal conductance from leaf to canopy using a dual-leaf model for estimating crop evapotranspiration.

    Directory of Open Access Journals (Sweden)

    Risheng Ding

    Full Text Available The dual-source Shuttleworth-Wallace model has been widely used to estimate and partition crop evapotranspiration (λET. Canopy stomatal conductance (Gsc, an essential parameter of the model, is often calculated by scaling up leaf stomatal conductance, considering the canopy as one single leaf in a so-called "big-leaf" model. However, Gsc can be overestimated or underestimated depending on leaf area index level in the big-leaf model, due to a non-linear stomatal response to light. A dual-leaf model, scaling up Gsc from leaf to canopy, was developed in this study. The non-linear stomata-light relationship was incorporated by dividing the canopy into sunlit and shaded fractions and calculating each fraction separately according to absorbed irradiances. The model includes: (1 the absorbed irradiance, determined by separately integrating the sunlit and shaded leaves with consideration of both beam and diffuse radiation; (2 leaf area for the sunlit and shaded fractions; and (3 a leaf conductance model that accounts for the response of stomata to PAR, vapor pressure deficit and available soil water. In contrast to the significant errors of Gsc in the big-leaf model, the predicted Gsc using the dual-leaf model had a high degree of data-model agreement; the slope of the linear regression between daytime predictions and measurements was 1.01 (R2 = 0.98, with RMSE of 0.6120 mm s-1 for four clear-sky days in different growth stages. The estimates of half-hourly λET using the dual-source dual-leaf model (DSDL agreed well with measurements and the error was within 5% during two growing seasons of maize with differing hydrometeorological and management strategies. Moreover, the estimates of soil evaporation using the DSDL model closely matched actual measurements. Our results indicate that the DSDL model can produce more accurate estimation of Gsc and λET, compared to the big-leaf model, and thus is an effective alternative approach for estimating and

  8. A bio-behavioral model of addiction treatment: applying dual representation theory to craving management and relapse prevention.

    Science.gov (United States)

    Matto, Holly

    2005-01-01

    A bio-behavioral approach to drug addiction treatment is outlined. The presented treatment model uses dual representation theory as a guiding framework for understanding the bio-behavioral processes activated during the application of expressive therapeutic methods. Specifically, the treatment model explains how visual processing techniques can supplement traditional relapse prevention therapy protocols, to help clients better manage cravings and control triggers in hard-to-treat populations such as chronic substance-dependent persons.

  9. Phase-field modelling and synchrotron validation of phase transformations in martensitic dual-phase steel

    International Nuclear Information System (INIS)

    Thiessen, R.G.; Sietsma, J.; Palmer, T.A.; Elmer, J.W.; Richardson, I.M.

    2007-01-01

    A thermodynamically based method to describe the phase transformations during heating and cooling of martensitic dual-phase steel has been developed, and in situ synchrotron measurements of phase transformations have been undertaken to support the model experimentally. Nucleation routines are governed by a novel implementation of the classical nucleation theory in a general phase-field code. Physically-based expressions for the temperature-dependent interface mobility and the driving forces for transformation have also been constructed. Modelling of martensite was accomplished by assuming a carbon supersaturation of the body-centred-cubic ferrite lattice. The simulations predict kinetic aspects of the austenite formation during heating and ferrite formation upon cooling. Simulations of partial austenitising thermal cycles predicted peak and retained austenite percentages of 38.2% and 6.7%, respectively, while measurements yielded peak and retained austenite percentages of 31.0% and 7.2% (±1%). Simulations of a complete austenitisation thermal cycle predicted the measured complete austenitisation and, upon cooling, a retained austenite percentage of 10.3% while 9.8% (±1%) retained austenite was measured

  10. Tritium transport modeling at system level for the EUROfusion dual coolant lithium-lead breeding blanket

    Science.gov (United States)

    Urgorri, F. R.; Moreno, C.; Carella, E.; Rapisarda, D.; Fernández-Berceruelo, I.; Palermo, I.; Ibarra, A.

    2017-11-01

    The dual coolant lithium lead (DCLL) breeding blanket is one of the four breeder blanket concepts under consideration within the framework of EUROfusion consortium activities. The aim of this work is to develop a model that can dynamically track tritium concentrations and fluxes along each part of the DCLL blanket and the ancillary systems associated to it at any time. Because of tritium nature, the phenomena of diffusion, dissociation, recombination and solubilisation have been modeled in order to describe the interaction between the lead-lithium channels, the structural material, the flow channel inserts and the helium channels that are present in the breeding blanket. Results have been obtained for a pulsed generation scenario for DEMO. The tritium inventory in different parts of the blanket, the permeation rates from the breeder to the secondary coolant and the amount of tritium extracted from the lead-lithium loop have been computed. Results present an oscillating behavior around mean values. The obtained average permeation rate from the liquid metal to the helium is 1.66 mg h-1 while the mean tritium inventory in the whole system is 417 mg. Besides the reference case results, parametric studies of the lead-lithium mass flow rate, the tritium extraction efficiency and the tritium solubility in lead-lithium have been performed showing the reaction of the system to the variation of these parameters.

  11. Informational model verification of ZVS Buck quasi-resonant DC-DC converter

    Science.gov (United States)

    Vakovsky, Dimiter; Hinov, Nikolay

    2016-12-01

    The aim of the paper is to create a polymorphic informational model of a ZVS Buck quasi-resonant DC-DC converter for the modeling purposes of the object. For the creation of the model is applied flexible open standards for setting, storing, publishing and exchange of data in distributed information environment. The created model is useful for creation of many and different by type variants with different configuration of the composing elements and different inner model of the examined object.

  12. Ferromagnetic linewidth measurements employing electrodynamic model of the magnetic plasmon resonance

    Science.gov (United States)

    Krupka, Jerzy; Aleshkevych, Pavlo; Salski, Bartlomiej; Kopyt, Pawel

    2018-02-01

    The mode of uniform precession, or Kittel mode, in a magnetized ferromagnetic sphere, has recently been proven to be the magnetic plasmon resonance. In this paper we show how to apply the electrodynamic model of the magnetic plasmon resonance for accurate measurements of the ferromagnetic resonance linewidth ΔH. Two measurement methods are presented. The first one employs Q-factor measurements of the magnetic plasmon resonance coupled to the resonance of an empty metallic cavity. Such coupled modes are known as magnon-polariton modes, i.e. hybridized modes between the collective spin excitation and the cavity excitation. The second one employs direct Q-factor measurements of the magnetic plasmon resonance in a filter setup with two orthogonal semi-loops used for coupling. Q-factor measurements are performed employing a vector network analyser. The methods presented in this paper allow one to extend the measurement range of the ferromagnetic resonance linewidth ΔH well beyond the limits of the commonly used measurement standards in terms of the size of the samples and the lowest measurable linewidths. Samples that can be measured with the newly proposed methods may have larger size as compared to the size of samples that were used in the standard methods restricted by the limits of perturbation theory.

  13. Realistic Gamow shell model for resonance and continuum in atomic nuclei

    Science.gov (United States)

    Xu, F. R.; Sun, Z. H.; Wu, Q.; Hu, B. S.; Dai, S. J.

    2018-02-01

    The Gamow shell model can describe resonance and continuum for atomic nuclei. The model is established in the complex-moment (complex-k) plane of the Berggren coordinates in which bound, resonant and continuum states are treated on equal footing self-consistently. In the present work, the realistic nuclear force, CD Bonn, has been used. We have developed the full \\hat{Q}-box folded-diagram method to derive the realistic effective interaction in the model space which is nondegenerate and contains resonance and continuum channels. The CD-Bonn potential is renormalized using the V low-k method. With choosing 16O as the inert core, we have applied the Gamow shell model to oxygen isotopes.

  14. Vector and axial-vector resonances in composite models of the Higgs boson

    Energy Technology Data Exchange (ETDEWEB)

    Franzosi, Diogo Buarque [II. Physikalisches Institut, Universität Göttingen,Friedrich-Hund-Platz 1, 37077 Göttingen (Germany); Cacciapaglia, Giacomo; Cai, Haiying; Deandrea, Aldo [Univ Lyon, Université Lyon 1, CNRS/IN2P3, IPNL,F-69622, Villeurbanne (France); Frandsen, Mads [CP-Origins & Danish Institute for Advanced Study DIAS, University of Southern Denmark,Campusvej 55, DK-5230 Odense M (Denmark)

    2016-11-11

    We provide a non-linear realisation of composite Higgs models in the context of the SU(4)/Sp(4) symmetry breaking pattern, where the effective Lagrangian of the spin-0 and spin-1 resonances is constructed via the CCWZ prescription using the Hidden Symmetry formalism. We investigate the EWPT constraints by accounting the effects from reduced Higgs couplings and integrating out heavy spin-1 resonances. This theory emerges from an underlying theory of gauge interactions with fermions, thus first principle lattice results predict the massive spectrum in composite Higgs models. This model can be used as a template for the phenomenology of composite Higgs models at the LHC and at future 100 TeV colliders, as well as for other application. In this work, we focus on the formalism for spin-1 resonances and their bounds from di-lepton and di-boson searches at the LHC.

  15. Dynamic PET of human liver inflammation: impact of kinetic modeling with optimization-derived dual-blood input function.

    Science.gov (United States)

    Wang, Guobao; Corwin, Michael T; Olson, Kristin A; Badawi, Ramsey D; Sarkar, Souvik

    2018-05-30

    The hallmark of nonalcoholic steatohepatitis is hepatocellular inflammation and injury in the setting of hepatic steatosis. Recent work has indicated that dynamic 18F-FDG PET with kinetic modeling has the potential to assess hepatic inflammation noninvasively, while static FDG-PET did not show a promise. Because the liver has dual blood supplies, kinetic modeling of dynamic liver PET data is challenging in human studies. The objective of this study is to evaluate and identify a dual-input kinetic modeling approach for dynamic FDG-PET of human liver inflammation. Fourteen human patients with nonalcoholic fatty liver disease were included in the study. Each patient underwent one-hour dynamic FDG-PET/CT scan and had liver biopsy within six weeks. Three models were tested for kinetic analysis: traditional two-tissue compartmental model with an image-derived single-blood input function (SBIF), model with population-based dual-blood input function (DBIF), and modified model with optimization-derived DBIF through a joint estimation framework. The three models were compared using Akaike information criterion (AIC), F test and histopathologic inflammation reference. The results showed that the optimization-derived DBIF model improved the fitting of liver time activity curves and achieved lower AIC values and higher F values than the SBIF and population-based DBIF models in all patients. The optimization-derived model significantly increased FDG K1 estimates by 101% and 27% as compared with traditional SBIF and population-based DBIF. K1 by the optimization-derived model was significantly associated with histopathologic grades of liver inflammation while the other two models did not provide a statistical significance. In conclusion, modeling of DBIF is critical for kinetic analysis of dynamic liver FDG-PET data in human studies. The optimization-derived DBIF model is more appropriate than SBIF and population-based DBIF for dynamic FDG-PET of liver inflammation. © 2018

  16. Study on Complex Advertising and Price Competition Dual-Channel Supply Chain Models Considering the Overconfidence Manufacturer

    Directory of Open Access Journals (Sweden)

    Junhai Ma

    2016-01-01

    Full Text Available In order to explore how the manufacturers make decisions when two manufacturers compete for local advertising investment, we examine two noncooperative models (Stackelberg and Nash game and propose a cost sharing contract to investigate channel competition of dual-channel supply chain. The dominant power between manufacturer and retailer and the effect of channel competition strategy on price are mainly discussed. In addition, dynamic system concepts are integrated into Stackelberg game model based on bounded rational mechanism. We analyze the local stability and find that the stability level of the dual-channel supply chains depends crucially on the price adjustment speed, the level of demand uncertainty, and the risk preference. The outcome shows that, under the master-slave game model, the profits of manufacturers are greater than that under decentralized decision-making mode, and the profits of retailers under master-slave game model are less than that under decentralized decision-making mode. The profits of manufacturers and retailers in the stable region are greater than that in unstable region. Finally, the delay feedback control method is utilized and effectively controls the chaotic behavior of dual-channel supply chain model. The results have theoretical and practical significance for the game models in terms of advertising and price competition.

  17. Balanced sparse model for tight frames in compressed sensing magnetic resonance imaging.

    Directory of Open Access Journals (Sweden)

    Yunsong Liu

    Full Text Available Compressed sensing has shown to be promising to accelerate magnetic resonance imaging. In this new technology, magnetic resonance images are usually reconstructed by enforcing its sparsity in sparse image reconstruction models, including both synthesis and analysis models. The synthesis model assumes that an image is a sparse combination of atom signals while the analysis model assumes that an image is sparse after the application of an analysis operator. Balanced model is a new sparse model that bridges analysis and synthesis models by introducing a penalty term on the distance of frame coefficients to the range of the analysis operator. In this paper, we study the performance of the balanced model in tight frame based compressed sensing magnetic resonance imaging and propose a new efficient numerical algorithm to solve the optimization problem. By tuning the balancing parameter, the new model achieves solutions of three models. It is found that the balanced model has a comparable performance with the analysis model. Besides, both of them achieve better results than the synthesis model no matter what value the balancing parameter is. Experiment shows that our proposed numerical algorithm constrained split augmented Lagrangian shrinkage algorithm for balanced model (C-SALSA-B converges faster than previously proposed algorithms accelerated proximal algorithm (APG and alternating directional method of multipliers for balanced model (ADMM-B.

  18. Nonlinear behaviour of cantilevered carbon nanotube resonators based on a new nonlinear electrostatic load model

    Science.gov (United States)

    Farokhi, Hamed; Païdoussis, Michael P.; Misra, Arun K.

    2018-04-01

    The present study examines the nonlinear behaviour of a cantilevered carbon nanotube (CNT) resonator and its mass detection sensitivity, employing a new nonlinear electrostatic load model. More specifically, a 3D finite element model is developed in order to obtain the electrostatic load distribution on cantilevered CNT resonators. A new nonlinear electrostatic load model is then proposed accounting for the end effects due to finite length. Additionally, a new nonlinear size-dependent continuum model is developed for the cantilevered CNT resonator, employing the modified couple stress theory (to account for size-effects) together with the Kelvin-Voigt model (to account for nonlinear damping); the size-dependent model takes into account all sources of nonlinearity, i.e. geometrical and inertial nonlinearities as well as nonlinearities associated with damping, small-scale, and electrostatic load. The nonlinear equation of motion of the cantilevered CNT resonator is obtained based on the new models developed for the CNT resonator and the electrostatic load. The Galerkin method is then applied to the nonlinear equation of motion, resulting in a set of nonlinear ordinary differential equations, consisting of geometrical, inertial, electrical, damping, and size-dependent nonlinear terms. This high-dimensional nonlinear discretized model is solved numerically utilizing the pseudo-arclength continuation technique. The nonlinear static and dynamic responses of the system are examined for various cases, investigating the effect of DC and AC voltages, length-scale parameter, nonlinear damping, and electrostatic load. Moreover, the mass detection sensitivity of the system is examined for possible application of the CNT resonator as a nanosensor.

  19. What makes us think? A three-stage dual-process model of analytic engagement.

    Science.gov (United States)

    Pennycook, Gordon; Fugelsang, Jonathan A; Koehler, Derek J

    2015-08-01

    The distinction between intuitive and analytic thinking is common in psychology. However, while often being quite clear on the characteristics of the two processes ('Type 1' processes are fast, autonomous, intuitive, etc. and 'Type 2' processes are slow, deliberative, analytic, etc.), dual-process theorists have been heavily criticized for being unclear on the factors that determine when an individual will think analytically or rely on their intuition. We address this issue by introducing a three-stage model that elucidates the bottom-up factors that cause individuals to engage Type 2 processing. According to the model, multiple Type 1 processes may be cued by a stimulus (Stage 1), leading to the potential for conflict detection (Stage 2). If successful, conflict detection leads to Type 2 processing (Stage 3), which may take the form of rationalization (i.e., the Type 1 output is verified post hoc) or decoupling (i.e., the Type 1 output is falsified). We tested key aspects of the model using a novel base-rate task where stereotypes and base-rate probabilities cued the same (non-conflict problems) or different (conflict problems) responses about group membership. Our results support two key predictions derived from the model: (1) conflict detection and decoupling are dissociable sources of Type 2 processing and (2) conflict detection sometimes fails. We argue that considering the potential stages of reasoning allows us to distinguish early (conflict detection) and late (decoupling) sources of analytic thought. Errors may occur at both stages and, as a consequence, bias arises from both conflict monitoring and decoupling failures. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. Dual-Source Linear Energy Prediction (LINE-P) Model in the Context of WSNs.

    Science.gov (United States)

    Ahmed, Faisal; Tamberg, Gert; Le Moullec, Yannick; Annus, Paul

    2017-07-20

    Energy harvesting technologies such as miniature power solar panels and micro wind turbines are increasingly used to help power wireless sensor network nodes. However, a major drawback of energy harvesting is its varying and intermittent characteristic, which can negatively affect the quality of service. This calls for careful design and operation of the nodes, possibly by means of, e.g., dynamic duty cycling and/or dynamic frequency and voltage scaling. In this context, various energy prediction models have been proposed in the literature; however, they are typically compute-intensive or only suitable for a single type of energy source. In this paper, we propose Linear Energy Prediction "LINE-P", a lightweight, yet relatively accurate model based on approximation and sampling theory; LINE-P is suitable for dual-source energy harvesting. Simulations and comparisons against existing similar models have been conducted with low and medium resolutions (i.e., 60 and 22 min intervals/24 h) for the solar energy source (low variations) and with high resolutions (15 min intervals/24 h) for the wind energy source. The results show that the accuracy of the solar-based and wind-based predictions is up to approximately 98% and 96%, respectively, while requiring a lower complexity and memory than the other models. For the cases where LINE-P's accuracy is lower than that of other approaches, it still has the advantage of lower computing requirements, making it more suitable for embedded implementation, e.g., in wireless sensor network coordinator nodes or gateways.

  1. Resonances and fusion in heavy ion reactions: new models and developments

    International Nuclear Information System (INIS)

    Cindro, N.

    1982-01-01

    Several aspects of the problem of the resonant behaviour of heavy-ion induced reactions are discussed. First, the problem is set in its relation to fundamental nuclear physics and our understanding of nuclear structure. It is suggested that, if the resonant behaviour of heavy-ion reactions is indeed due to the presence of particular configurations in the composite systems, these configurations must have a very specific nature which prevents their mixing with the adjacent states or else other conditons (e.g. low level density) should be met. Further on, the problem of resonant behaviour observed in back-angle elastic scattering and in forward-angle reaction data is discussed. Collisions between heavy ions leading to the composite systems 36 Ar and 40 Ca are used to discuss the apparent lack of correlation between these two sets of data. A way to understand it, based on the fragmentation of broad resonances, is suggested. In the third part the relation between structure in the fusion cross section excitation functions and that in reaction channel cross sections is discussed. Finally, in the fourth part, the orbiting-cluster model of heavy-ion resonances is briefly described and its predictions discussed. Based on this model a list is given of colliding heavy-ion systems where resonances are expected. (author)

  2. Theoretical model and optimization of a novel temperature sensor based on quartz tuning fork resonators

    International Nuclear Information System (INIS)

    Xu Jun; You Bo; Li Xin; Cui Juan

    2007-01-01

    To accurately measure temperatures, a novel temperature sensor based on a quartz tuning fork resonator has been designed. The principle of the quartz tuning fork temperature sensor is that the resonant frequency of the quartz resonator changes with the variation in temperature. This type of tuning fork resonator has been designed with a new doubly rotated cut work at flexural vibration mode as temperature sensor. The characteristics of the temperature sensor were evaluated and the results sufficiently met the target of development for temperature sensor. The theoretical model for temperature sensing has been developed and built. The sensor structure was analysed by finite element method (FEM) and optimized, including tuning fork geometry, tine electrode pattern and the sensor's elements size. The performance curve of output versus measured temperature is given. The results from theoretical analysis and experiments indicate that the sensor's sensitivity can reach 60 ppm 0 C -1 with the measured temperature range varying from 0 to 100 0 C

  3. Non-monotonic resonance in a spatially forced Lengyel-Epstein model

    Energy Technology Data Exchange (ETDEWEB)

    Haim, Lev [Physics Department, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel); Department of Oncology, Soroka University Medical Center, Beer-Sheva 84101 (Israel); Hagberg, Aric [Center for Nonlinear Studies, Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Meron, Ehud [Physics Department, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel); Department of Solar Energy and Environmental Physics, BIDR, Ben-Gurion University of the Negev, Sede Boqer Campus, Midreshet Ben-Gurion 84990 (Israel)

    2015-06-15

    We study resonant spatially periodic solutions of the Lengyel-Epstein model modified to describe the chlorine dioxide-iodine-malonic acid reaction under spatially periodic illumination. Using multiple-scale analysis and numerical simulations, we obtain the stability ranges of 2:1 resonant solutions, i.e., solutions with wavenumbers that are exactly half of the forcing wavenumber. We show that the width of resonant wavenumber response is a non-monotonic function of the forcing strength, and diminishes to zero at sufficiently strong forcing. We further show that strong forcing may result in a π/2 phase shift of the resonant solutions, and argue that the nonequilibrium Ising-Bloch front bifurcation can be reversed. We attribute these behaviors to an inherent property of forcing by periodic illumination, namely, the increase of the mean spatial illumination as the forcing amplitude is increased.

  4. Anomalous solute transport in saturated porous media: Relating transport model parameters to electrical and nuclear magnetic resonance properties

    Science.gov (United States)

    Swanson, Ryan D; Binley, Andrew; Keating, Kristina; France, Samantha; Osterman, Gordon; Day-Lewis, Frederick D.; Singha, Kamini

    2015-01-01

    The advection-dispersion equation (ADE) fails to describe commonly observed non-Fickian solute transport in saturated porous media, necessitating the use of other models such as the dual-domain mass-transfer (DDMT) model. DDMT model parameters are commonly calibrated via curve fitting, providing little insight into the relation between effective parameters and physical properties of the medium. There is a clear need for material characterization techniques that can provide insight into the geometry and connectedness of pore spaces related to transport model parameters. Here, we consider proton nuclear magnetic resonance (NMR), direct-current (DC) resistivity, and complex conductivity (CC) measurements for this purpose, and assess these methods using glass beads as a control and two different samples of the zeolite clinoptilolite, a material that demonstrates non-Fickian transport due to intragranular porosity. We estimate DDMT parameters via calibration of a transport model to column-scale solute tracer tests, and compare NMR, DC resistivity, CC results, which reveal that grain size alone does not control transport properties and measured geophysical parameters; rather, volume and arrangement of the pore space play important roles. NMR cannot provide estimates of more-mobile and less-mobile pore volumes in the absence of tracer tests because these estimates depend critically on the selection of a material-dependent and flow-dependent cutoff time. Increased electrical connectedness from DC resistivity measurements are associated with greater mobile pore space determined from transport model calibration. CC was hypothesized to be related to length scales of mass transfer, but the CC response is unrelated to DDMT.

  5. RECONSTRUCTION OF A HUMAN LUNG MORPHOLOGY MODEL FROM MAGNETIC RESONANCE IMAGES

    Science.gov (United States)

    RATIONALE A description of lung morphological structure is necessary for modeling the deposition and fate of inhaled therapeutic aerosols. A morphological model of the lung boundary was generated from magnetic resonance (MR) images with the goal of creating a framework for anato...

  6. COMPUTER RECONSTRUCTION OF A HUMAN LUNG MORPHOLOGY MODEL FROM MAGNETIC RESONANCE (MR) IMAGES

    Science.gov (United States)

    A mathematical description of the morphological structure of the lung is necessary for modeling and analysis of the deposition of inhaled aerosols. A morphological model of the lung boundary was generated from magnetic resonance (MR) images, with the goal of creating a frame...

  7. A collective model description of the low lying and giant dipole resonant properties of 40424446Ca

    International Nuclear Information System (INIS)

    Weise, J.I.

    1982-01-01

    The low-lying and giant dipole resonant properties of the even-even calcium isotopes are calculated within the framework of the Gneuss-Greiner model and compared with the experimental data. In the low energy region, comparison is also made with the predictions of a coexistence model

  8. Inverse modeling of rainfall infiltration with a dual permeability approach using different matrix-fracture coupling variants.

    Science.gov (United States)

    Blöcher, Johanna; Kuraz, Michal

    2017-04-01

    In this contribution we propose implementations of the dual permeability model with different inter-domain exchange descriptions and metaheuristic optimization algorithms for parameter identification and mesh optimization. We compare variants of the coupling term with different numbers of parameters to test if a reduction of parameters is feasible. This can reduce parameter uncertainty in inverse modeling, but also allow for different conceptual models of the domain and matrix coupling. The different variants of the dual permeability model are implemented in the open-source objective library DRUtES written in FORTRAN 2003/2008 in 1D and 2D. For parameter identification we use adaptations of the particle swarm optimization (PSO) and Teaching-learning-based optimization (TLBO), which are population-based metaheuristics with different learning strategies. These are high-level stochastic-based search algorithms that don't require gradient information or a convex search space. Despite increasing computing power and parallel processing, an overly fine mesh is not feasible for parameter identification. This creates the need to find a mesh that optimizes both accuracy and simulation time. We use a bi-objective PSO algorithm to generate a Pareto front of optimal meshes to account for both objectives. The dual permeability model and the optimization algorithms were tested on virtual data and field TDR sensor readings. The TDR sensor readings showed a very steep increase during rapid rainfall events and a subsequent steep decrease. This was theorized to be an effect of artificial macroporous envelopes surrounding TDR sensors creating an anomalous region with distinct local soil hydraulic properties. One of our objectives is to test how well the dual permeability model can describe this infiltration behavior and what coupling term would be most suitable.

  9. To Resolve or Not To Resolve, that Is the Question: The Dual-Path Model of Incongruity Resolution and Absurd Verbal Humor by fMRI.

    Science.gov (United States)

    Dai, Ru H; Chen, Hsueh-Chih; Chan, Yu C; Wu, Ching-Lin; Li, Ping; Cho, Shu L; Hu, Jon-Fan

    2017-01-01

    It is well accepted that the humor comprehension processing involves incongruity detection and resolution and then induces a feeling of amusement. However, this three-stage model of humor processing does not apply to absurd humor (so-called nonsense humor). Absurd humor contains an unresolvable incongruity but can still induce a feeling of mirth. In this study, we used functional magnetic resonance imaging (fMRI) to identify the neural mechanisms of absurd humor. Specifically, we aimed to investigate the neural substrates associated with the complete resolution of incongruity resolution humor and partial resolution of absurd humor. Based on the fMRI data, we propose a dual-path model of incongruity resolution and absurd verbal humor. According to this model, the detection and resolution for the incongruity of incongruity resolution humor activate brain regions involved in the temporo-parietal lobe (TPJ) implicated in the integration of multiple information and precuneus, likely to be involved in the ability of perspective taking. The appreciation of incongruity resolution humor activates regions the posterior cingulate cortex (PCC), implicated in autobiographic or event memory retrieval, and parahippocampal gyrus (PHG), implying the funny feeling. By contrast, the partial resolution of absurd humor elicits greater activation in the fusiform gyrus which have been implicated in word processing, inferior frontal gyrus (IFG) for the process of incongruity resolution and superior temporal gyrus (STG) for the pragmatic awareness.

  10. Z flux-line lattices and self-dual equations in the standard model

    International Nuclear Information System (INIS)

    Bimonte, G.; Lozano, G.

    1994-04-01

    We derive gauge covariant self-dual equations for the SU(2) x U(1) y theory of electroweak interactions and show that they admit solutions describing a periodic lattice of Z-strings. (author). 14 refs

  11. Integrating the behavioral and neural dynamics of response selection in a dual-task paradigm: a dynamic neural field model of Dux et al. (2009).

    Science.gov (United States)

    Buss, Aaron T; Wifall, Tim; Hazeltine, Eliot; Spencer, John P

    2014-02-01

    People are typically slower when executing two tasks than when only performing a single task. These dual-task costs are initially robust but are reduced with practice. Dux et al. (2009) explored the neural basis of dual-task costs and learning using fMRI. Inferior frontal junction (IFJ) showed a larger hemodynamic response on dual-task trials compared with single-task trial early in learning. As dual-task costs were eliminated, dual-task hemodynamics in IFJ reduced to single-task levels. Dux and colleagues concluded that the reduction of dual-task costs is accomplished through increased efficiency of information processing in IFJ. We present a dynamic field theory of response selection that addresses two questions regarding these results. First, what mechanism leads to the reduction of dual-task costs and associated changes in hemodynamics? We show that a simple Hebbian learning mechanism is able to capture the quantitative details of learning at both the behavioral and neural levels. Second, is efficiency isolated to cognitive control areas such as IFJ, or is it also evident in sensory motor areas? To investigate this, we restrict Hebbian learning to different parts of the neural model. None of the restricted learning models showed the same reductions in dual-task costs as the unrestricted learning model, suggesting that efficiency is distributed across cognitive control and sensory motor processing systems.

  12. Modeling Psychological Contract Violation using Dual Regime Models: An Event-based Approach.

    Science.gov (United States)

    Hofmans, Joeri

    2017-01-01

    A good understanding of the dynamics of psychological contract violation requires theories, research methods and statistical models that explicitly recognize that violation feelings follow from an event that violates one's acceptance limits, after which interpretative processes are set into motion, determining the intensity of these violation feelings. Whereas theories-in the form of the dynamic model of the psychological contract-and research methods-in the form of daily diary research and experience sampling research-are available by now, the statistical tools to model such a two-stage process are still lacking. The aim of the present paper is to fill this gap in the literature by introducing two statistical models-the Zero-Inflated model and the Hurdle model-that closely mimic the theoretical process underlying the elicitation violation feelings via two model components: a binary distribution that models whether violation has occurred or not, and a count distribution that models how severe the negative impact is. Moreover, covariates can be included for both model components separately, which yields insight into their unique and shared antecedents. By doing this, the present paper offers a methodological-substantive synergy, showing how sophisticated methodology can be used to examine an important substantive issue.

  13. Modeling dendrite density from magnetic resonance diffusion measurements

    DEFF Research Database (Denmark)

    Jespersen, Sune Nørhøj; Kroenke, CD; Østergaard, Leif

    2007-01-01

    in this model: (i) the dendrites and axons, which are modeled as long cylinders with two diffusion coefficients, parallel (DL) and perpendicular (DT) to the cylindrical axis, and (ii) an isotropic monoexponential diffusion component describing water diffusion within and across all other structures, i.......e., in extracellular space and glia cells. The model parameters are estimated from 153 diffusion-weighted images acquired from a formalin-fixed baboon brain. A close correspondence between the data and the signal model is found, with the model parameters consistent with literature values. The model provides......Diffusion-weighted imaging (DWI) provides a noninvasive tool to probe tissue microstructure. We propose a simplified model of neural cytoarchitecture intended to capture the essential features important for water diffusion as measured by NMR. Two components contribute to the NMR signal...

  14. SMATASY. A Program for the model independent description of the Z resonance

    International Nuclear Information System (INIS)

    Kirsch, S.; Riemann, T.

    1994-07-01

    SMATASY is an interface for the ZF I T T ER package and may be used for the model independent description of the Z resonance at LEP 1 and SLC. It allows the determination of the Z mass and width and its resonance shape parameters r and j for cross-sections and their asymmetries. The r describes the peak height and j the interference of the Z resonance with photon exchange in each scattering channel and for σ T , σ FB , σ lr , σ pol etc. separately. Alternatively, the helicity amplitudes for a given scattering channel may be determined. We compare our formalism with other model independent approaches. The model independent treatment of QED corrections in SMATASY is applicable also far away from the Z peak. (orig.)

  15. Modeling the effectiveness of U(VI) biomineralization in dual-porosity porous media

    Science.gov (United States)

    Rotter, B. E.; Barry, D. A.; Gerhard, J. I.; Small, J. S.

    2011-05-01

    SummaryUranium contamination is a serious environmental concern worldwide. Recent attention has focused on the in situ immobilization of uranium by stimulation of dissimilatory metal-reducing bacteria (DMRB). The objective of this work was to investigate the effectiveness of this approach in heterogeneous and structured porous media, since such media may significantly affect the geochemical and microbial processes taking place in contaminated sites, impacting remediation efficiency during biostimulation. A biogeochemical reactive transport model was developed for uranium remediation by immobile-region-resident DMRB in two-region porous media. Simulations were used to investigate the parameter sensitivities of the system over wide-ranging geochemical, microbial and groundwater transport conditions. The results suggest that optimal biomineralization is generally likely to occur when the regional mass transfer timescale is less than one-thirtieth the value of the volumetric flux timescale, and/or the organic carbon fermentation timescale is less than one-thirtieth the value of the advective timescale, and/or the mobile region porosity ranges between equal to and four times the immobile region porosity. Simulations including U(VI) surface complexation to Fe oxides additionally suggest that, while systems exhibiting U(VI) surface complexation may be successfully remediated, they are likely to display different degrees of remediation efficiency over varying microbial efficiency, mobile-immobile mass transfer, and porosity ratios. Such information may aid experimental and field designs, allowing for optimized remediation in dual-porosity (two-region) biostimulated DMRB U(VI) remediation schemes.

  16. Dual Binding Site and Selective Acetylcholinesterase Inhibitors Derived from Integrated Pharmacophore Models and Sequential Virtual Screening

    Directory of Open Access Journals (Sweden)

    Shikhar Gupta

    2014-01-01

    Full Text Available In this study, we have employed in silico methodology combining double pharmacophore based screening, molecular docking, and ADME/T filtering to identify dual binding site acetylcholinesterase inhibitors that can preferentially inhibit acetylcholinesterase and simultaneously inhibit the butyrylcholinesterase also but in the lesser extent than acetylcholinesterase. 3D-pharmacophore models of AChE and BuChE enzyme inhibitors have been developed from xanthostigmine derivatives through HypoGen and validated using test set, Fischer’s randomization technique. The best acetylcholinesterase and butyrylcholinesterase inhibitors pharmacophore hypotheses Hypo1_A and Hypo1_B, with high correlation coefficient of 0.96 and 0.94, respectively, were used as 3D query for screening the Zinc database. The screened hits were then subjected to the ADME/T and molecular docking study to prioritise the compounds. Finally, 18 compounds were identified as potential leads against AChE enzyme, showing good predicted activities and promising ADME/T properties.

  17. Dual-Model Reverse CKF Algorithm in Cooperative Navigation for USV

    Directory of Open Access Journals (Sweden)

    Bo Xu

    2014-01-01

    Full Text Available As one of the most promising research directions, cooperative location with high precision and low-cost IMU is becoming an emerging research topic in many positioning fields. Low-cost MEMS/DVL is a preferred solution for dead-reckoning in multi-USV cooperative network. However, large misalignment angles and large gyro drift coexist in low-cost MEMS that leads to the poor observability. Based on cubature Kalman filter (CKF algorithm that has access to high accuracy and relative small computation, dual-model filtering scheme is proposed. It divides the whole process into two subsections that cut off the coupling relations and improve the observability of MEMS errors: it first estimates large misalignment angle and then estimates the gyro drift. Furthermore, to improve the convergence speed of large misalignment angle estimated in the first subsection, “time reversion” concept is introduced. It uses a short period time to forward and backward several times to improve convergence speed effectively. Finally, simulation analysis and experimental verification is conducted. Simulation and experimental results show that the algorithm can effectively improve the cooperative navigation performance.

  18. Estimation of dual phase lag model parameters using the evolutionary algorithms

    Directory of Open Access Journals (Sweden)

    B. Mochnacki

    2011-07-01

    Full Text Available Generalization of Fourier law, in particular the introduction of two ‘delay times’ (relaxation time q and thermalization time T leads to thenew form of energy equation called the dual-phase-lag model (DPLM. This equation should be applied in a case of microscale heat transfermodeling. In particular, DPLM constitutes a good approximation of thermal processes which are characterized by extremely short duration(e.g. ultrafast laser pulse, extreme temperature gradients and geometrical features of domain considered (e.g. thin metal film. The aim ofconsiderations presented in this paper is the identification of two above mentioned positive constants q, T. They correspond to the relaxationtime, which is the mean time for electrons to change their energy states and the thermalization time, which is the mean time required forc(TTl G(TT electrons and lattice to reach equilibrium. In this paper the DPlLMlequation ise appllied for analysis of thermal processes proceeding in a thint metal film subjected to a laser beam. At the stage of computations connected with the identification problem solution the evolutionaryalgorithms are used. To solve the problem the additional information concerning the transient temperature distribution on a metal film surface is assumed to be known.

  19. Modeling the diffusion magnetic resonance imaging signal inside neurons

    International Nuclear Information System (INIS)

    Nguyen, D V; Li, J R; Grebenkov, D S; Le Bihan, D

    2014-01-01

    The Bloch-Torrey partial differential equation (PDE) describes the complex transverse water proton magnetization due to diffusion-encoding magnetic field gradient pulses. The integral of the solution of this PDE yields the diffusion magnetic resonance imaging (dMRI) signal. In a complex medium such as cerebral tissue, it is difficult to explicitly link the dMRI signal to biological parameters such as the cellular geometry or the cellular volume fraction. Studying the dMRI signal arising from a single neuron can provide insight into how the geometrical structure of neurons influences the measured signal. We formulate the Bloch-Torrey PDE inside a single neuron, under no water exchange condition with the extracellular space, and show how to reduce the 3D simulation in the full neuron to a 3D simulation around the soma and 1D simulations in the neurites. We show that this latter approach is computationally much faster than full 3D simulation and still gives accurate results over a wide range of diffusion times

  20. Graft function assessment in mouse models of single- and dual- kidney transplantation.

    Science.gov (United States)

    Wang, Lei; Wang, Ximing; Jiang, Shan; Wei, Jin; Buggs, Jacentha; Fu, Liying; Zhang, Jie; Liu, Ruisheng

    2018-05-23

    Animal models of kidney transplantation (KTX) are widely used in studying immune response of hosts to implanted grafts. Additionally, KTX can be used in generating kidney-specific knockout animal models by transplantation of kidneys from donors with global knockout of a gene to wild type recipients or vise verse. Dual kidney transplantation (DKT) provides a more physiological environment for recipients than single kidney transplantation (SKT). However, DKT in mice is rare due to technical challenges. In this study, we successfully performed DKT in mice and compared the hemodynamic response and graft function with SKT. The surgical time, complications and survival rate of DKT were not significantly different from SKT, where survival rates were above 85%. Mice with DKT showed less injury and quicker recovery with lower plasma creatinine (Pcr) and higher GFR than SKT mice (Pcr = 0.34 and 0.17 mg/dl in DKT vs. 0.50 and 0.36 mg/dl in SKT at 1 and 3 days, respectively; GFR = 215 and 131 µl/min for DKT and SKT, respectively). In addition, the DKT exhibited better renal functional reserve and long-term outcome of renal graft function than SKT based on the response to acute volume expansion. In conclusion, we have successfully generated a mouse DKT model. The hemodynamic responses of DKT better mimic physiological situations with less kidney injury and better recovery than SKT because of reduced confounding factors such as single nephron hyperfiltration. We anticipate DKT in mice will provide an additional tool for evaluation of renal significance in physiology and disease.