WorldWideScience

Sample records for domain-related protein warp

  1. Analysis of von Willebrand factor A domain-related protein (WARP polymorphism in temperate and tropical Plasmodium vivax field isolates

    Directory of Open Access Journals (Sweden)

    Zakeri Sedigheh

    2009-06-01

    Full Text Available Abstract Background The identification of key molecules is crucial for designing transmission-blocking vaccines (TBVs, among those ookinete micronemal proteins are candidate as a general class of malaria transmission-blocking targets. Here, the sequence analysis of an extra-cellular malaria protein expressed in ookinetes, named von Willebrand factor A domain-related protein (WARP, is reported in 91 Plasmodium vivax isolates circulating in different regions of Iran. Methods Clinical isolates were collected from north temperate and southern tropical regions in Iran. Primers have been designed based on P. vivax sequence (ctg_6991 which amplified a fragment of about 1044 bp with no size variation. Direct sequencing of PCR products was used to determine polymorphism and further bioinformatics analysis in P. vivax sexual stage antigen, pvwarp. Results Amplified pvwarp gene showed 886 bp in size, with no intron. BLAST analysis showed a similarity of 98–100% to P. vivax Sal-I strain; however, Iranian isolates had 2 bp mismatches in 247 and 531 positions that were non-synonymous substitution [T (ACT to A (GCT and R (AGA to S (AGT] in comparison with the Sal-I sequence. Conclusion This study presents the first large-scale survey on pvwarp polymorphism in the world, which provides baseline data for developing WARP-based TBV against both temperate and tropical P. vivax isolates.

  2. Solution structure of GSP13 from Bacillus subtilis exhibits an S1 domain related to cold shock proteins

    International Nuclear Information System (INIS)

    Yu Wenyu; Hu Jicheng; Yu Bingke; Xia Wei; Jin Changwen; Xia Bin

    2009-01-01

    GSP13 encoded by gene yugI is a σ B -dependent general stress protein in Bacillus subtilis, which can be induced by heat shock, salt stress, ethanol stress, glucose starvation, oxidative stress and cold shock. Here we report the solution structure of GSP13 and it is the first structure of S1 domain containing protein in Bacillus subtilis. The structure of GSP13 mainly consists of a typical S1 domain along with a C-terminal 50-residue flexible tail, different from the other known S1 domain containing proteins. Comparison with other S1 domain structures reveals that GSP13 has a conserved RNA binding surface, and it may function similarly to cold shock proteins in response to cold stress

  3. De novo design of RNA-binding proteins with a prion-like domain related to ALS/FTD proteinopathies.

    Science.gov (United States)

    Mitsuhashi, Kana; Ito, Daisuke; Mashima, Kyoko; Oyama, Munenori; Takahashi, Shinichi; Suzuki, Norihiro

    2017-12-04

    Aberrant RNA-binding proteins form the core of the neurodegeneration cascade in spectrums of disease, such as amyotrophic lateral sclerosis (ALS)/frontotemporal dementia (FTD). Six ALS-related molecules, TDP-43, FUS, TAF15, EWSR1, heterogeneous nuclear (hn)RNPA1 and hnRNPA2 are RNA-binding proteins containing candidate mutations identified in ALS patients and those share several common features, including harboring an aggregation-prone prion-like domain (PrLD) containing a glycine/serine-tyrosine-glycine/serine (G/S-Y-G/S)-motif-enriched low-complexity sequence and rich in glutamine and/or asparagine. Additinally, these six molecules are components of RNA granules involved in RNA quality control and become mislocated from the nucleus to form cytoplasmic inclusion bodies (IBs) in the ALS/FTD-affected brain. To reveal the essential mechanisms involved in ALS/FTD-related cytotoxicity associated with RNA-binding proteins containing PrLDs, we designed artificial RNA-binding proteins harboring G/S-Y-G/S-motif repeats with and without enriched glutamine residues and nuclear-import/export-signal sequences and examined their cytotoxicity in vitro. These proteins recapitulated features of ALS-linked molecules, including insoluble aggregation, formation of cytoplasmic IBs and components of RNA granules, and cytotoxicity instigation. These findings indicated that these artificial RNA-binding proteins mimicked features of ALS-linked molecules and allowed the study of mechanisms associated with gain of toxic functions related to ALS/FTD pathogenesis.

  4. Sirepo - Warp

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-25

    Sirepo is an open source framework for cloud computing. The graphical user interface (GUI) for Sirepo, also known as the client, executes in any HTML5 compliant web browser on any computing platform, including tablets. The client is built in JavaScript, making use of the following open source libraries: Bootstrap, which is fundamental for cross-platform web applications; AngularJS, which provides a model–view–controller (MVC) architecture and GUI components; and D3.js, which provides interactive plots and data-driven transformations. The Sirepo server is built on the following Python technologies: Flask, which is a lightweight framework for web development; Jin-ja, which is a secure and widely used templating language; and Werkzeug, a utility library that is compliant with the WSGI standard. We use Nginx as the HTTP server and proxy, which provides a scalable event-driven architecture. The physics codes supported by Sirepo execute inside a Docker container. One of the codes supported by Sirepo is Warp. Warp is a particle-in-cell (PIC) code de-signed to simulate high-intensity charged particle beams and plasmas in both the electrostatic and electromagnetic regimes, with a wide variety of integrated physics models and diagnostics. At pre-sent, Sirepo supports a small subset of Warp’s capabilities. Warp is open source and is part of the Berkeley Lab Accelerator Simulation Toolkit.

  5. Warp speed ahead

    Science.gov (United States)

    Swarup, Bob

    2008-01-01

    Warp drives are a staple of science fiction, transporting the heroes of shows like Star Trek between galaxies in a matter of hours. Now, increasing numbers of cosmologists are wondering whether this technology might eventually become science fact. Dozens of scientific papers on warp drives have appeared since 1994 when Miguel Alcubierre - a theoretical physicist then at the University of Wales in Cardiff - first argued that a warp drive was theoretically possible (Class. Quantum Grav. 11 L73)

  6. Superluminal warp drive

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Diaz, Pedro F. [Colina de los Chopos, Centro de Fisica ' Miguel A. Catalan' , Instituto de Matematicas y Fisica Fundamental, Consejo Superior de Investigaciones Cientificas, Serrano 121, 28006 Madrid (Spain)], E-mail: p.gonzalezdiaz@imaff.cfmac.csic.es

    2007-09-20

    In this Letter we consider a warp drive spacetime resulting from that suggested by Alcubierre when the spaceship can only travel faster than light. Restricting to the two dimensions that retains most of the physics, we derive the thermodynamic properties of the warp drive and show that the temperature of the spaceship rises up as its apparent velocity increases. We also find that the warp drive spacetime can be exhibited in a manifestly cosmological form.

  7. Instability of warped discs

    Science.gov (United States)

    Doǧan, S.; Nixon, C. J.; King, A. R.; Pringle, J. E.

    2018-05-01

    Accretion discs are generally warped. If a warp in a disc is too large, the disc can `break' apart into two or more distinct planes, with only tenuous connections between them. Further, if an initially planar disc is subject to a strong differential precession, then it can be torn apart into discrete annuli that precess effectively independently. In previous investigations, torque-balance formulae have been used to predict where and when the disc breaks into distinct parts. In this work, focusing on discs with Keplerian rotation and where the shearing motions driving the radial communication of the warp are damped locally by turbulence (the `diffusive' regime), we investigate the stability of warped discs to determine the precise criterion for an isolated warped disc to break. We find and solve the dispersion relation, which, in general, yields three roots. We provide a comprehensive analysis of this viscous-warp instability and the emergent growth rates and their dependence on disc parameters. The physics of the instability can be understood as a combination of (1) a term that would generally encapsulate the classical Lightman-Eardley instability in planar discs (given by ∂(νΣ)/∂Σ < 0) but is here modified by the warp to include ∂(ν1|ψ|)/∂|ψ| < 0, and (2) a similar condition acting on the diffusion of the warp amplitude given in simplified form by ∂(ν2|ψ|)/∂|ψ| < 0. We discuss our findings in the context of discs with an imposed precession, and comment on the implications for different astrophysical systems.

  8. Warp Field Mechanics 101

    Science.gov (United States)

    White, Harold

    2011-01-01

    This paper will begin with a short review of the Alcubierre warp drive metric and describes how the phenomenon might work based on the original paper. The canonical form of the metric was developed and published in [6] which provided key insight into the field potential and boost for the field which remedied a critical paradox in the original Alcubierre concept of operations. A modified concept of operations based on the canonical form of the metric that remedies the paradox is presented and discussed. The idea of a warp drive in higher dimensional space-time (manifold) will then be briefly considered by comparing the null-like geodesics of the Alcubierre metric to the Chung-Freese metric to illustrate the mathematical role of hyperspace coordinates. The net effect of using a warp drive technology coupled with conventional propulsion systems on an exploration mission will be discussed using the nomenclature of early mission planning. Finally, an overview of the warp field interferometer test bed being implemented in the Advanced Propulsion Physics Laboratory: Eagleworks (APPL:E) at the Johnson Space Center will be detailed. While warp field mechanics has not had a Chicago Pile moment, the tools necessary to detect a modest instance of the phenomenon are near at hand.

  9. Generalized Canonical Time Warping.

    Science.gov (United States)

    Zhou, Feng; De la Torre, Fernando

    2016-02-01

    Temporal alignment of human motion has been of recent interest due to its applications in animation, tele-rehabilitation and activity recognition. This paper presents generalized canonical time warping (GCTW), an extension of dynamic time warping (DTW) and canonical correlation analysis (CCA) for temporally aligning multi-modal sequences from multiple subjects performing similar activities. GCTW extends previous work on DTW and CCA in several ways: (1) it combines CCA with DTW to align multi-modal data (e.g., video and motion capture data); (2) it extends DTW by using a linear combination of monotonic functions to represent the warping path, providing a more flexible temporal warp. Unlike exact DTW, which has quadratic complexity, we propose a linear time algorithm to minimize GCTW. (3) GCTW allows simultaneous alignment of multiple sequences. Experimental results on aligning multi-modal data, facial expressions, motion capture data and video illustrate the benefits of GCTW. The code is available at http://humansensing.cs.cmu.edu/ctw.

  10. LittleQuickWarp: an ultrafast image warping tool.

    Science.gov (United States)

    Qu, Lei; Peng, Hanchuan

    2015-02-01

    Warping images into a standard coordinate space is critical for many image computing related tasks. However, for multi-dimensional and high-resolution images, an accurate warping operation itself is often very expensive in terms of computer memory and computational time. For high-throughput image analysis studies such as brain mapping projects, it is desirable to have high performance image warping tools that are compatible with common image analysis pipelines. In this article, we present LittleQuickWarp, a swift and memory efficient tool that boosts 3D image warping performance dramatically and at the same time has high warping quality similar to the widely used thin plate spline (TPS) warping. Compared to the TPS, LittleQuickWarp can improve the warping speed 2-5 times and reduce the memory consumption 6-20 times. We have implemented LittleQuickWarp as an Open Source plug-in program on top of the Vaa3D system (http://vaa3d.org). The source code and a brief tutorial can be found in the Vaa3D plugin source code repository. Copyright © 2014 Elsevier Inc. All rights reserved.

  11. Warping for trim statics

    KAUST Repository

    Zhang, Dongliang

    2014-08-05

    The quality of migration images depends on the accuracy of the velocity model. For large velocity errors, the migration image is strongly distorted, which unflattens events in the common image gathers and consequently leads to a blurring in the stacked migration image. To mitigate this problem, we propose dynamic image warping to flatten the common image gathers before stacking and to enhance the signal-to-noise ratio of the migration image. Numerical tests on the Marmousi model and GOM data show that image warping of the prestack images followed by stacking leads to much better resolved reflectors than the original migration image. The problem, however, is that the reflector locations have increased uncertainty because the wrong velocity model is still used.

  12. Warping for trim statics

    KAUST Repository

    Zhang, Dongliang; Wang, Xin; Huang, Yunsong; Schuster, Gerard T.

    2014-01-01

    The quality of migration images depends on the accuracy of the velocity model. For large velocity errors, the migration image is strongly distorted, which unflattens events in the common image gathers and consequently leads to a blurring in the stacked migration image. To mitigate this problem, we propose dynamic image warping to flatten the common image gathers before stacking and to enhance the signal-to-noise ratio of the migration image. Numerical tests on the Marmousi model and GOM data show that image warping of the prestack images followed by stacking leads to much better resolved reflectors than the original migration image. The problem, however, is that the reflector locations have increased uncertainty because the wrong velocity model is still used.

  13. Warp drive with zero expansion

    Energy Technology Data Exchange (ETDEWEB)

    Natario, Jose [Department of Mathematics, Instituto Superior Tecnico (Portugal)

    2002-03-21

    It is commonly believed that Alcubierre's warp drive works by contracting space in front of the warp bubble and expanding the space behind it. We show that this contraction/expansion is but a marginal consequence of the choice made by Alcubierre and explicitly construct a similar spacetime where no contraction/expansion occurs. Global and optical properties of warp-drive spacetimes are also discussed.

  14. Warped products and black holes

    International Nuclear Information System (INIS)

    Hong, Soon-Tae

    2005-01-01

    We apply the warped product space-time scheme to the Banados-Teitelboim-Zanelli black holes and the Reissner-Nordstroem-anti-de Sitter black hole to investigate their interior solutions in terms of warped products. It is shown that there exist no discontinuities of the Ricci and Einstein curvatures across event horizons of these black holes

  15. The calculation of warping spools of warp-knitting machines

    Directory of Open Access Journals (Sweden)

    Vitaliy V. Chaban

    2014-12-01

    Full Text Available The paper is devoted to the development of scientific bases of the knitting machine design, in particular, to the calculation of warping spools of warp-knitting machines. The method of calculating the operating parameters of warping spools and mode of winding is offered. A formula that is obtained allows to define relationship between the parameters of the threads wound on a warping spool, their pull, structural dimensions of spool barrel and the diameter of spooling. With the given spool design and the given value of permissible tension of the material of its barrel, the offered formula allows to determine the maximum tension of the threads in the process of their winding on a spool. By this formula the safe diameter of winding the threads onto the spool can be calculated at a given pull of the threads during winding.

  16. Semiclassical instability of warp drives

    Energy Technology Data Exchange (ETDEWEB)

    Barcelo, C [Instituto de Astrofisica de Andalucia, IAA-CSIC, Glorieta de la Astronomia s/n, 18008 Granada (Spain); Finazzi, S; Liberati, S, E-mail: carlos@iaa.e, E-mail: finazzi@sissa.i, E-mail: liberati@sissa.i

    2010-05-01

    Warp drives, at least theoretically, provide a way to travel at superluminal speeds. However, even if one succeeded in providing the necessary exotic matter to construct them, it would still be necessary to check whether they would survive to the switching on of quantum effects. In this contribution we will report on the behaviour of the Renormalized Stress-Energy Tensor (RSET) in the spacetimes associated with superluminal warp drives. We find that the RSET will exponentially grow in time close to the front wall of the superluminal bubble, hence strongly supporting the conclusion that the warp-drive geometries are unstable against semiclassical back-reaction.

  17. Quantum effects in warp drives

    Directory of Open Access Journals (Sweden)

    Finazzi Stefano

    2013-09-01

    Full Text Available Warp drives are interesting configurations that, at least theoretically, provide a way to travel at superluminal speed. Unfortunately, several issues seem to forbid their realization. First, a huge amount of exotic matter is required to build them. Second, the presence of quantum fields propagating in superluminal warp-drive geometries makes them semiclassically unstable. Indeed, a Hawking-like high-temperature flux of particles is generated inside the warp-drive bubble, which causes an exponential growth of the energy density measured at the front wall of the bubble by freely falling observers. Moreover, superluminal warp drives remain unstable even if the Lorentz symmetry is broken by the introduction of regulating higher order terms in the Lagrangian of the quantum field. If the dispersion relation of the quantum field is subluminal, a black-hole laser phenomenon yields an exponential amplification of the emitted flux. If it is superluminal, infrared effects cause a linear growth of this flux.

  18. Time Warp Operating System (TWOS)

    Science.gov (United States)

    Bellenot, Steven F.

    1993-01-01

    Designed to support parallel discrete-event simulation, TWOS is complete implementation of Time Warp mechanism - distributed protocol for virtual time synchronization based on process rollback and message annihilation.

  19. Conformal boundaries of warped products

    DEFF Research Database (Denmark)

    Kokkendorff, Simon Lyngby

    2006-01-01

    In this note we prove a result on how to determine the conformal boundary of a type of warped product of two length spaces in terms of the individual conformal boundaries. In the situation, that we treat, the warping and conformal distortion functions are functions of distance to a base point....... The result is applied to produce examples of CAT(0)-spaces, where the conformal and ideal boundaries differ in interesting ways....

  20. Correlation functions of warped CFT

    Science.gov (United States)

    Song, Wei; Xu, Jianfei

    2018-04-01

    Warped conformal field theory (WCFT) is a two dimensional quantum field theory whose local symmetry algebra consists of a Virasoro algebra and a U(1) Kac-Moody algebra. In this paper, we study correlation functions for primary operators in WCFT. Similar to conformal symmetry, warped conformal symmetry is very constraining. The form of the two and three point functions are determined by the global warped conformal symmetry while the four point functions can be determined up to an arbitrary function of the cross ratio. The warped conformal bootstrap equation are constructed by formulating the notion of crossing symmetry. In the large central charge limit, four point functions can be decomposed into global warped conformal blocks, which can be solved exactly. Furthermore, we revisit the scattering problem in warped AdS spacetime (WAdS), and give a prescription on how to match the bulk result to a WCFT retarded Green's function. Our result is consistent with the conjectured holographic dualities between WCFT and WAdS.

  1. Warped penguin diagrams

    International Nuclear Information System (INIS)

    Csaki, Csaba; Grossman, Yuval; Tanedo, Philip; Tsai, Yuhsin

    2011-01-01

    We present an analysis of the loop-induced magnetic dipole operator in the Randall-Sundrum model of a warped extra dimension with anarchic bulk fermions and an IR brane-localized Higgs. These operators are finite at one-loop order and we explicitly calculate the branching ratio for μ→eγ using the mixed position/momentum space formalism. The particular bound on the anarchic Yukawa and Kaluza-Klein (KK) scales can depend on the flavor structure of the anarchic matrices. It is possible for a generic model to either be ruled out or unaffected by these bounds without any fine-tuning. We quantify how these models realize this surprising behavior. We also review tree-level lepton flavor bounds in these models and show that these are on the verge of tension with the μ→eγ bounds from typical models with a 3 TeV Kaluza-Klein scale. Further, we illuminate the nature of the one-loop finiteness of these diagrams and show how to accurately determine the degree of divergence of a five-dimensional loop diagram using both the five-dimensional and KK formalism. This power counting can be obfuscated in the four-dimensional Kaluza-Klein formalism and we explicitly point out subtleties that ensure that the two formalisms agree. Finally, we remark on the existence of a perturbative regime in which these one-loop results give the dominant contribution.

  2. Wireless Augmented Reality Prototype (WARP)

    Science.gov (United States)

    Devereaux, A. S.

    1999-01-01

    Initiated in January, 1997, under NASA's Office of Life and Microgravity Sciences and Applications, the Wireless Augmented Reality Prototype (WARP) is a means to leverage recent advances in communications, displays, imaging sensors, biosensors, voice recognition and microelectronics to develop a hands-free, tetherless system capable of real-time personal display and control of computer system resources. Using WARP, an astronaut may efficiently operate and monitor any computer-controllable activity inside or outside the vehicle or station. The WARP concept is a lightweight, unobtrusive heads-up display with a wireless wearable control unit. Connectivity to the external system is achieved through a high-rate radio link from the WARP personal unit to a base station unit installed into any system PC. The radio link has been specially engineered to operate within the high- interference, high-multipath environment of a space shuttle or space station module. Through this virtual terminal, the astronaut will be able to view and manipulate imagery, text or video, using voice commands to control the terminal operations. WARP's hands-free access to computer-based instruction texts, diagrams and checklists replaces juggling manuals and clipboards, and tetherless computer system access allows free motion throughout a cabin while monitoring and operating equipment.

  3. Dynamics of warped flux compactifications

    International Nuclear Information System (INIS)

    Shiu, Gary; Underwood, Bret; Torroba, Gonzalo; Douglas, Michael R.

    2008-01-01

    We discuss the four dimensional effective action for type IIB flux compactifications, and obtain the quadratic terms taking warp effects into account. The analysis includes both the 4-d zero modes and their KK excitations, which become light at large warping. We identify an 'axial' type gauge for the supergravity fluctuations, which makes the four dimensional degrees of freedom manifest. The other key ingredient is the existence of constraints coming from the ten dimensional equations of motion. Applying these conditions leads to considerable simplifications, enabling us to obtain the low energy lagrangian explicitly. In particular, the warped Kaehler potential for metric moduli is computed and it is shown that there are no mixings with the KK fluctuations and the result differs from previous proposals. The four dimensional potential contains a generalization of the Gukov-Vafa-Witten term, plus usual mass terms for KK modes.

  4. Warped product space-times

    Science.gov (United States)

    An, Xinliang; Wong, Willie Wai Yeung

    2018-01-01

    Many classical results in relativity theory concerning spherically symmetric space-times have easy generalizations to warped product space-times, with a two-dimensional Lorentzian base and arbitrary dimensional Riemannian fibers. We first give a systematic presentation of the main geometric constructions, with emphasis on the Kodama vector field and the Hawking energy; the construction is signature independent. This leads to proofs of general Birkhoff-type theorems for warped product manifolds; our theorems in particular apply to situations where the warped product manifold is not necessarily Einstein, and thus can be applied to solutions with matter content in general relativity. Next we specialize to the Lorentzian case and study the propagation of null expansions under the assumption of the dominant energy condition. We prove several non-existence results relating to the Yamabe class of the fibers, in the spirit of the black-hole topology theorem of Hawking–Galloway–Schoen. Finally we discuss the effect of the warped product ansatz on matter models. In particular we construct several cosmological solutions to the Einstein–Euler equations whose spatial geometry is generally not isotropic.

  5. Atlas warping for brain morphometry

    Science.gov (United States)

    Machado, Alexei M. C.; Gee, James C.

    1998-06-01

    In this work, we describe an automated approach to morphometry based on spatial normalizations of the data, and demonstrate its application to the analysis of gender differences in the human corpus callosum. The purpose is to describe a population by a reduced and representative set of variables, from which a prior model can be constructed. Our approach is rooted in the assumption that individual anatomies can be considered as quantitative variations on a common underlying qualitative plane. We can therefore imagine that a given individual's anatomy is a warped version of some referential anatomy, also known as an atlas. The spatial warps which transform a labeled atlas into anatomic alignment with a population yield immediate knowledge about organ size and shape in the group. Furthermore, variation within the set of spatial warps is directly related to the anatomic variation among the subjects. Specifically, the shape statistics--mean and variance of the mappings--for the population can be calculated in a special basis, and an eigendecomposition of the variance performed to identify the most significant modes of shape variation. The results obtained with the corpus callosum study confirm the existence of substantial anatomical differences between males and females, as reported in previous experimental work.

  6. Superluminal warp drive and dark energy

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Diaz, Pedro F. [Colina de los Chopos, Centro de Fisica ' Miguel A. Catalan' , Instituto de Matematicas y Fisica Fundamental, Consejo Superior de Investigaciones Cientificas, Serrano 121, 28006 Madrid (Spain)], E-mail: p.gonzalezdiaz@imaff.cfmac.csic.es

    2007-11-29

    In this Letter we consider a warp drive spacetime where the spaceship can only travel faster than light. Restricting to the two-dimensional case, we find that if the warp drive is placed in an accelerating universe the warp bubble size increases in a comoving way to the expansion of the universe in which it is immersed. Also shown is the result that the apparent velocity of the ship steadily increases with time as phantom energy is accreted onto it.

  7. Fundamental limitations on 'warp drive' spacetimes

    International Nuclear Information System (INIS)

    Lobo, Francisco S N; Visser, Matt

    2004-01-01

    'Warp drive' spacetimes are useful as 'gedanken-experiments' that force us to confront the foundations of general relativity, and among other things, to precisely formulate the notion of 'superluminal' communication. After carefully formulating the Alcubierre and Natario warp drive spacetimes, and verifying their non-perturbative violation of the classical energy conditions, we consider a more modest question and apply linearized gravity to the weak-field warp drive, testing the energy conditions to first and second orders of the warp-bubble velocity, v. Since we take the warp-bubble velocity to be non-relativistic, v << c, we are not primarily interested in the 'superluminal' features of the warp drive. Instead we focus on a secondary feature of the warp drive that has not previously been remarked upon-the warp drive (if it could be built) would be an example of a 'reaction-less drive'. For both the Alcubierre and Natario warp drives we find that the occurrence of significant energy condition violations is not just a high-speed effect, but that the violations persist even at arbitrarily low speeds. A particularly interesting feature of this construction is that it is now meaningful to think of placing a finite mass spaceship at the centre of the warp bubble, and then see how the energy in the warp field compares with the mass-energy of the spaceship. There is no hope of doing this in Alcubierre's original version of the warp field, since by definition the point at the centre of the warp bubble moves on a geodesic and is 'massless'. That is, in Alcubierre's original formalism and in the Natario formalism the spaceship is always treated as a test particle, while in the linearized theory we can treat the spaceship as a finite mass object. For both the Alcubierre and Natario warp drives we find that even at low speeds the net (negative) energy stored in the warp fields must be a significant fraction of the mass of the spaceship

  8. Warped models in string theory

    International Nuclear Information System (INIS)

    Acharya, B.S.; Benini, F.; Valandro, R.

    2006-12-01

    Warped models, originating with the ideas of Randall and Sundrum, provide a fascinating extension of the standard model with interesting consequences for the LHC. We investigate in detail how string theory realises such models, with emphasis on fermion localisation and the computation of Yukawa couplings. We find, in contrast to the 5d models, that fermions can be localised anywhere in the extra dimension, and that there are new mechanisms to generate exponential hierarchies amongst the Yukawa couplings. We also suggest a way to distinguish these string theory models with data from the LHC. (author)

  9. Warped AdS3 black holes

    International Nuclear Information System (INIS)

    Anninos, Dionysios; Li Wei; Padi, Megha; Song Wei; Strominger, Andrew

    2009-01-01

    Three dimensional topologically massive gravity (TMG) with a negative cosmological constant -l -2 and positive Newton constant G admits an AdS 3 vacuum solution for any value of the graviton mass μ. These are all known to be perturbatively unstable except at the recently explored chiral point μl = 1. However we show herein that for every value of μl ≠ 3 there are two other (potentially stable) vacuum solutions given by SL(2,R) x U(1)-invariant warped AdS 3 geometries, with a timelike or spacelike U(1) isometry. Critical behavior occurs at μl = 3, where the warping transitions from a stretching to a squashing, and there are a pair of warped solutions with a null U(1) isometry. For μl > 3, there are known warped black hole solutions which are asymptotic to warped AdS 3 . We show that these black holes are discrete quotients of warped AdS 3 just as BTZ black holes are discrete quotients of ordinary AdS 3 . Moreover new solutions of this type, relevant to any theory with warped AdS 3 solutions, are exhibited. Finally we note that the black hole thermodynamics is consistent with the hypothesis that, for μl > 3, the warped AdS 3 ground state of TMG is holographically dual to a 2D boundary CFT with central charges c R -formula and c L -formula.

  10. Geodesic congruences in warped spacetimes

    International Nuclear Information System (INIS)

    Ghosh, Suman; Dasgupta, Anirvan; Kar, Sayan

    2011-01-01

    In this article, we explore the kinematics of timelike geodesic congruences in warped five-dimensional bulk spacetimes, with and without thick or thin branes. Beginning with geodesic flows in the Randall-Sundrum anti-de Sitter geometry without and with branes, we find analytical expressions for the expansion scalar and comment on the effects of including thin branes on its evolution. Later, we move on to congruences in more general warped bulk geometries with a cosmological thick brane and a time-dependent extra dimensional scale. Using analytical expressions for the velocity field, we interpret the expansion, shear and rotation (ESR) along the flows, as functions of the extra dimensional coordinate. The evolution of a cross-sectional area orthogonal to the congruence, as seen from a local observer's point of view, is also shown graphically. Finally, the Raychaudhuri and geodesic equations in backgrounds with a thick brane are solved numerically in order to figure out the role of initial conditions (prescribed on the ESR) and spacetime curvature on the evolution of the ESR.

  11. The geometry of warped product singularities

    Science.gov (United States)

    Stoica, Ovidiu Cristinel

    In this article, the degenerate warped products of singular semi-Riemannian manifolds are studied. They were used recently by the author to handle singularities occurring in General Relativity, in black holes and at the big-bang. One main result presented here is that a degenerate warped product of semi-regular semi-Riemannian manifolds with the warping function satisfying a certain condition is a semi-regular semi-Riemannian manifold. The connection and the Riemann curvature of the warped product are expressed in terms of those of the factor manifolds. Examples of singular semi-Riemannian manifolds which are semi-regular are constructed as warped products. Applications include cosmological models and black holes solutions with semi-regular singularities. Such singularities are compatible with a certain reformulation of the Einstein equation, which in addition holds at semi-regular singularities too.

  12. Seesaw mechanism in warped geometry

    International Nuclear Information System (INIS)

    Huber, S.J.; Shafi, Q.

    2003-09-01

    We show how the seesaw mechanism for neutrino masses can be realized within a five dimensional (5D) warped geometry framework. Intermediate scale standard model (SM) singlet neutrino masses, needed to explain the atmospheric and solar neutrino oscillations, are shown to be proportional to M P1 .exp((2c-1)πkR), where c denotes the coefficient of the 5D Dirac mass term for the singlet neutrino which also has a Planck scale Majorana mass localized on the Planck-brane, and kR∼11 in order to resolve the gauge hierarchy problem. The case with a bulk 5D Majorana mass term for the singlet neutrino is briefly discussed. (orig.)

  13. Seesaw mechanism in warped geometry

    International Nuclear Information System (INIS)

    Huber, Stephan J.; Shafi, Qaisar

    2004-01-01

    We show how the seesaw mechanism for neutrino masses can be realized within a five-dimensional (5D) warped geometry framework. Intermediate scale standard model (SM) singlet neutrino masses, needed to explain the atmospheric and solar neutrino oscillations, are shown to be proportional to M Pl exp((2c-1)πkR), where c denotes the coefficient of the 5D Dirac mass term for the singlet neutrino which also has a Planck scale Majorana mass localized on the Planck-brane, and kR∼11 in order to resolve the gauge hierarchy problem. The case with a bulk 5D Majorana mass term for the singlet neutrino is briefly discussed

  14. Method for adjusting warp measurements to a different board dimension

    Science.gov (United States)

    William T. Simpson; John R. Shelly

    2000-01-01

    Warp in lumber is a common problem that occurs while lumber is being dried. In research or other testing programs, it is sometimes necessary to compare warp of different species or warp caused by different process variables. If lumber dimensions are not the same, then direct comparisons are not possible, and adjusting warp to a common dimension would be desirable so...

  15. Conformal Vector Fields on Doubly Warped Product Manifolds and Applications

    Directory of Open Access Journals (Sweden)

    H. K. El-Sayied

    2016-01-01

    Full Text Available This article aimed to study and explore conformal vector fields on doubly warped product manifolds as well as on doubly warped spacetime. Then we derive sufficient conditions for matter and Ricci collineations on doubly warped product manifolds. A special attention is paid to concurrent vector fields. Finally, Ricci solitons on doubly warped product spacetime admitting conformal vector fields are considered.

  16. Seamless warping of diffusion tensor fields

    DEFF Research Database (Denmark)

    Xu, Dongrong; Hao, Xuejun; Bansal, Ravi

    2008-01-01

    To warp diffusion tensor fields accurately, tensors must be reoriented in the space to which the tensors are warped based on both the local deformation field and the orientation of the underlying fibers in the original image. Existing algorithms for warping tensors typically use forward mapping...... of seams, including voxels in which the deformation is extensive. Backward mapping, however, cannot reorient tensors in the template space because information about the directional orientation of fiber tracts is contained in the original, unwarped imaging space only, and backward mapping alone cannot...... transfer that information to the template space. To combine the advantages of forward and backward mapping, we propose a novel method for the spatial normalization of diffusion tensor (DT) fields that uses a bijection (a bidirectional mapping with one-to-one correspondences between image spaces) to warp DT...

  17. Bouncing cosmology from warped extra dimensional scenario

    Energy Technology Data Exchange (ETDEWEB)

    Das, Ashmita; Maity, Debaprasad [Indian Institute of Technology, Department of Physics, Guwahati, Assam (India); Paul, Tanmoy; SenGupta, Soumitra [Indian Association for the Cultivation of Science, Department of Theoretical Physics, Kolkata (India)

    2017-12-15

    From the perspective of four dimensional effective theory on a two brane warped geometry model, we examine the possibility of ''bouncing phenomena''on our visible brane. Our results reveal that the presence of a warped extra dimension lead to a non-singular bounce on the brane scale factor and hence can remove the ''big-bang singularity''. We also examine the possible parametric regions for which this bouncing is possible. (orig.)

  18. Bouncing cosmology from warped extra dimensional scenario

    Science.gov (United States)

    Das, Ashmita; Maity, Debaprasad; Paul, Tanmoy; SenGupta, Soumitra

    2017-12-01

    From the perspective of four dimensional effective theory on a two brane warped geometry model, we examine the possibility of "bouncing phenomena"on our visible brane. Our results reveal that the presence of a warped extra dimension lead to a non-singular bounce on the brane scale factor and hence can remove the "big-bang singularity". We also examine the possible parametric regions for which this bouncing is possible.

  19. Seamless warping of diffusion tensor fields

    DEFF Research Database (Denmark)

    Xu, Dongrong; Hao, Xuejun; Bansal, Ravi

    2008-01-01

    deformations in an attempt to ensure that the local deformations in the warped image remains true to the orientation of the underlying fibers; forward mapping, however, can also create "seams" or gaps and consequently artifacts in the warped image by failing to define accurately the voxels in the template...... space where the magnitude of the deformation is large (e.g., |Jacobian| > 1). Backward mapping, in contrast, defines voxels in the template space by mapping them back to locations in the original imaging space. Backward mapping allows every voxel in the template space to be defined without the creation...

  20. Statistics of galaxy warps in the HDF North and South

    NARCIS (Netherlands)

    Reshetnikov, [No Value; Battaner, E; Combes, F; Jimenez-Vicente, J

    We present a statistical study of the presence of galaxy warps in the Hubble deep fields. Among a complete sample of 45 edge-on galaxies above a diameter of 1."3, we find 5 galaxies to be certainly warped and 6 galaxies as good candidates. In addition, 4 galaxies reveal a characteristic U-warp.

  1. Needle bar for warp knitting machines

    Science.gov (United States)

    Hagel, Adolf; Thumling, Manfred

    1979-01-01

    Needle bar for warp knitting machines with a number of needles individually set into slits of the bar and having shafts cranked to such an extent that the head section of each needle is in alignment with the shaft section accommodated by the slit. Slackening of the needles will thus not influence the needle spacing.

  2. RELAXATION OF WARPED DISKS: THE CASE OF PURE HYDRODYNAMICS

    Energy Technology Data Exchange (ETDEWEB)

    Sorathia, Kareem A.; Krolik, Julian H. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States); Hawley, John F. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904 (United States)

    2013-05-10

    Orbiting disks may exhibit bends due to a misalignment between the angular momentum of the inner and outer regions of the disk. We begin a systematic simulational inquiry into the physics of warped disks with the simplest case: the relaxation of an unforced warp under pure fluid dynamics, i.e., with no internal stresses other than Reynolds stress. We focus on the nonlinear regime in which the bend rate is large compared to the disk aspect ratio. When warps are nonlinear, strong radial pressure gradients drive transonic radial motions along the disk's top and bottom surfaces that efficiently mix angular momentum. The resulting nonlinear decay rate of the warp increases with the warp rate and the warp width, but, at least in the parameter regime studied here, is independent of the sound speed. The characteristic magnitude of the associated angular momentum fluxes likewise increases with both the local warp rate and the radial range over which the warp extends; it also increases with increasing sound speed, but more slowly than linearly. The angular momentum fluxes respond to the warp rate after a delay that scales with the square root of the time for sound waves to cross the radial extent of the warp. These behaviors are at variance with a number of the assumptions commonly used in analytic models to describe linear warp dynamics.

  3. Warped Kähler potentials and fluxes

    Energy Technology Data Exchange (ETDEWEB)

    Martucci, Luca [Dipartimento di Fisica ed Astronomia “Galileo Galilei' ,Università di Padova & I.N.F.N. Sezione di Padova,Via Marzolo 8, 35131 Padova (Italy)

    2017-01-13

    The four-dimensional effective theory for type IIB warped flux compactifications proposed in https://www.doi.org/10.1007/JHEP03(2015)067 is completed by taking into account the backreaction of the Kähler moduli on the three-form fluxes. The only required modification consists in a flux-dependent contribution to the chiral fields parametrising the Kähler moduli. The resulting supersymmetric effective theory satisfies the no-scale condition and consistently combines previous partial results present in the literature. Similar results hold for M-theory warped compactifications on Calabi-Yau fourfolds, whose effective field theory and Kähler potential are also discussed.

  4. Warped Kähler potentials and fluxes

    International Nuclear Information System (INIS)

    Martucci, Luca

    2017-01-01

    The four-dimensional effective theory for type IIB warped flux compactifications proposed in https://www.doi.org/10.1007/JHEP03(2015)067 is completed by taking into account the backreaction of the Kähler moduli on the three-form fluxes. The only required modification consists in a flux-dependent contribution to the chiral fields parametrising the Kähler moduli. The resulting supersymmetric effective theory satisfies the no-scale condition and consistently combines previous partial results present in the literature. Similar results hold for M-theory warped compactifications on Calabi-Yau fourfolds, whose effective field theory and Kähler potential are also discussed.

  5. Wormholes, warp drives and energy conditions

    CERN Document Server

    2017-01-01

    Top researchers in the field of gravitation present the state-of-the-art topics outlined in this book, ranging from the stability of rotating wormholes solutions supported by ghost scalar fields, modified gravity applied to wormholes, the study of novel semi-classical and nonlinear energy conditions, to the applications of quantum effects and the superluminal version of the warp drive in modified spacetime. Based on Einstein's field equations, this cutting-edge research area explores the more far-fetched theoretical outcomes of General Relativity and relates them to quantum field theory. This includes quantum energy inequalities, flux energy conditions, and wormhole curvature, and sheds light on not just the theoretical physics but also on the possible applications to warp drives and time travel. This book extensively explores the physical properties and characteristics of these 'exotic spacetimes,' describing in detail the general relativistic geometries that generate closed timelike curves.

  6. Flavor universal resonances and warped gravity

    Energy Technology Data Exchange (ETDEWEB)

    Agashe, Kaustubh; Du, Peizhi; Hong, Sungwoo; Sundrum, Raman [Maryland Center for Fundamental Physics, Department of Physics,University of Maryland, College Park, MD 20742 (United States)

    2017-01-04

    Warped higher-dimensional compactifications with “bulk” standard model, or their AdS/CFT dual as the purely 4D scenario of Higgs compositeness and partial compositeness, offer an elegant approach to resolving the electroweak hierarchy problem as well as the origins of flavor structure. However, low-energy electroweak/flavor/CP constraints and the absence of non-standard physics at LHC Run 1 suggest that a “little hierarchy problem” remains, and that the new physics underlying naturalness may lie out of LHC reach. Assuming this to be the case, we show that there is a simple and natural extension of the minimal warped model in the Randall-Sundrum framework, in which matter, gauge and gravitational fields propagate modestly different degrees into the IR of the warped dimension, resulting in rich and striking consequences for the LHC (and beyond). The LHC-accessible part of the new physics is AdS/CFT dual to the mechanism of “vectorlike confinement”, with TeV-scale Kaluza-Klein excitations of the gauge and gravitational fields dual to spin-0,1,2 composites. Unlike the minimal warped model, these low-lying excitations have predominantly flavor-blind and flavor/CP-safe interactions with the standard model. Remarkably, this scenario also predicts small deviations from flavor-blindness originating from virtual effects of Higgs/top compositeness at ∼O(10) TeV, with subdominant resonance decays into Higgs/top-rich final states, giving the LHC an early “preview” of the nature of the resolution of the hierarchy problem. Discoveries of this type at LHC Run 2 would thereby anticipate (and set a target for) even more explicit explorations of Higgs compositeness at a 100 TeV collider, or for next-generation flavor tests.

  7. Lorentz Violation in Warped Extra Dimensions

    International Nuclear Information System (INIS)

    Rizzo, Thomas G.

    2011-01-01

    Higher dimensional theories which address some of the problematic issues of the Standard Model(SM) naturally involve some form of D = 4 + n-dimensional Lorentz invariance violation (LIV). In such models the fundamental physics which leads to, e.g., field localization, orbifolding, the existence of brane terms and the compactification process all can introduce LIV in the higher dimensional theory while still preserving 4-d Lorentz invariance. In this paper, attempting to capture some of this physics, we extend our previous analysis of LIV in 5-d UED-type models to those with 5- d warped extra dimensions. To be specific, we employ the 5-d analog of the SM Extension of Kostelecky et al. which incorporates a complete set of operators arising from spontaneous LIV. We show that while the response of the bulk scalar, fermion and gauge fields to the addition of LIV operators in warped models is qualitatively similar to what happens in the flat 5-d UED case, the gravity sector of these models reacts very differently than in flat space. Specifically, we show that LIV in this warped case leads to a non-zero bulk mass for the 5-d graviton and so the would-be zero mode, which we identify as the usual 4-d graviton, must necessarily become massive. The origin of this mass term is the simultaneous existence of the constant non-zero AdS 5 curvature and the loss of general co-ordinate invariance via LIV in the 5-d theory. Thus warped 5-d models with LIV in the gravity sector are not phenomenologically viable.

  8. Superluminal warp drives are semiclassically unstable

    Energy Technology Data Exchange (ETDEWEB)

    Finazzi, S; Liberati, S [SISSA, via Beirut 2-4, Trieste 34151, Italy and INFN sezione di Trieste (Italy); Barcelo, C, E-mail: finazzi@sissa.i, E-mail: liberati@sissa.i, E-mail: carlos@iaa.e [Instituto de Astrofisica de AndalucIa, CSIC, Camino Bajo de Huetor 50, 18008 Granada (Spain)

    2010-04-01

    Warp drives are very interesting configurations of General Relativity: they provide a way to travel at superluminal speeds, albeit at the cost of requiring exotic matter to build them. Even if one succeeded in providing the necessary exotic matter, it would still be necessary to check whether they would survive to the switching on of quantum effects. Semiclassical corrections to warp-drive geometries created out of an initially flat spacetime have been analyzed in a previous work by the present authors in special locations, close to the wall of the bubble and in its center. Here, we present an exact numerical analysis of the renormalized stress-energy tensor (RSET) in the whole bubble. We find that the the RSET will exponentially grow in time close to the front wall of the superluminal bubble, after some transient terms have disappeared, hence strongly supporting our previous conclusion that the warp-drive geometries are unstable against semiclassical back-reaction. This result seems to implement the chronology protection conjecture, forbiddig the set up of a structure potentially dangerous for causality.

  9. Fundamental limitations on 'warp drive' spacetimes

    Energy Technology Data Exchange (ETDEWEB)

    Lobo, Francisco S N [Centro de Astronomia e AstrofIsica da Universidade de Lisboa, Campo Grande, Ed. C8 1749-016 Lisbon (Portugal); Visser, Matt [School of Mathematical and Computing Sciences, Victoria University of Wellington, PO Box 600, Wellington (New Zealand)

    2004-12-21

    'Warp drive' spacetimes are useful as 'gedanken-experiments' that force us to confront the foundations of general relativity, and among other things, to precisely formulate the notion of 'superluminal' communication. After carefully formulating the Alcubierre and Natario warp drive spacetimes, and verifying their non-perturbative violation of the classical energy conditions, we consider a more modest question and apply linearized gravity to the weak-field warp drive, testing the energy conditions to first and second orders of the warp-bubble velocity, v. Since we take the warp-bubble velocity to be non-relativistic, v << c, we are not primarily interested in the 'superluminal' features of the warp drive. Instead we focus on a secondary feature of the warp drive that has not previously been remarked upon-the warp drive (if it could be built) would be an example of a 'reaction-less drive'. For both the Alcubierre and Natario warp drives we find that the occurrence of significant energy condition violations is not just a high-speed effect, but that the violations persist even at arbitrarily low speeds. A particularly interesting feature of this construction is that it is now meaningful to think of placing a finite mass spaceship at the centre of the warp bubble, and then see how the energy in the warp field compares with the mass-energy of the spaceship. There is no hope of doing this in Alcubierre's original version of the warp field, since by definition the point at the centre of the warp bubble moves on a geodesic and is 'massless'. That is, in Alcubierre's original formalism and in the Natario formalism the spaceship is always treated as a test particle, while in the linearized theory we can treat the spaceship as a finite mass object. For both the Alcubierre and Natario warp drives we find that even at low speeds the net (negative) energy stored in the warp fields must be a significant fraction

  10. Alcubierre's warp drive: Problems and prospects

    International Nuclear Information System (INIS)

    Broeck, Chris van den

    2000-01-01

    Alcubierre's warp drive geometry seemingly represents the ultimate dream for interstellar travel: there is no speed limit, the passengers are weightless whatever the acceleration, and there is no time dilation. However, in its original form, the proposal suffers from several fatal flaws, such as unreasonably high energies, energy moving in a locally spacelike direction, and a violation of the energy conditions of classical Einstein gravity. I present a possible solution for one of these problems, and I suggest ways to at least soften the others

  11. Warping methods for spectroscopic and chromatographic signal alignment: A tutorial

    Energy Technology Data Exchange (ETDEWEB)

    Bloemberg, Tom G., E-mail: T.Bloemberg@science.ru.nl [Radboud University Nijmegen, Institute for Molecules and Materials, Heyendaalseweg 135, 6525 AJ Nijmegen (Netherlands); Radboud University Nijmegen, Education Institute for Molecular Sciences, Heyendaalseweg 135, 6525 AJ Nijmegen (Netherlands); Gerretzen, Jan; Lunshof, Anton [Radboud University Nijmegen, Institute for Molecules and Materials, Heyendaalseweg 135, 6525 AJ Nijmegen (Netherlands); Wehrens, Ron [Centre for Research and Innovation, Fondazione Edmund Mach, Via E. Mach, 1, 38010 San Michele all’Adige, TN (Italy); Buydens, Lutgarde M.C. [Radboud University Nijmegen, Institute for Molecules and Materials, Heyendaalseweg 135, 6525 AJ Nijmegen (Netherlands)

    2013-06-05

    Highlights: •The concepts of warping and alignment are introduced. •The most important warping methods are critically reviewed and explained. •Reference selection, evaluation and place of warping in preprocessing are discussed. •Some pitfalls, especially for LC–MS and similar data, are addressed. •Examples are provided, together with programming scripts to rework and extend them. -- Abstract: Warping methods are an important class of methods that can correct for misalignments in (a.o.) chemical measurements. Their use in preprocessing of chromatographic, spectroscopic and spectrometric data has grown rapidly over the last decade. This tutorial review aims to give a critical introduction to the most important warping methods, the place of warping in preprocessing and current views on the related matters of reference selection, optimization, and evaluation. Some pitfalls in warping, notably for liquid chromatography–mass spectrometry (LC–MS) data and similar, will be discussed. Examples will be given of the application of a number of freely available warping methods to a nuclear magnetic resonance (NMR) spectroscopic dataset and a chromatographic dataset. As part of the Supporting Information, we provide a number of programming scripts in Matlab and R, allowing the reader to work the extended examples in detail and to reproduce the figures in this paper.

  12. DigiWarp: a method for deformable mouse atlas warping to surface topographic data

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Anand A; Shattuck, David W; Toga, Arthur W [Laboratory of Neuro Imaging, UCLA School of Medicine, Los Angeles, CA 90095 (United States); Chaudhari, Abhijit J [Department of Radiology, UC Davis School of Medicine, Sacramento, CA 95817 (United States); Li Changqing; Cherry, Simon R [Department of Biomedical Engineering, University of California-Davis, Davis, CA 95616 (United States); Dutta, Joyita; Leahy, Richard M, E-mail: anand.joshi@loni.ucla.ed, E-mail: leahy@sipi.usc.ed [Signal and Image Processing Institute, University of Southern California, Los Angeles, CA 90089 (United States)

    2010-10-21

    For pre-clinical bioluminescence or fluorescence optical tomography, the animal's surface topography and internal anatomy need to be estimated for improving the quantitative accuracy of reconstructed images. The animal's surface profile can be measured by all-optical systems, but estimation of the internal anatomy using optical techniques is non-trivial. A 3D anatomical mouse atlas may be warped to the estimated surface. However, fitting an atlas to surface topography data is challenging because of variations in the posture and morphology of imaged mice. In addition, acquisition of partial data (for example, from limited views or with limited sampling) can make the warping problem ill-conditioned. Here, we present a method for fitting a deformable mouse atlas to surface topographic range data acquired by an optical system. As an initialization procedure, we match the posture of the atlas to the posture of the mouse being imaged using landmark constraints. The asymmetric L{sup 2} pseudo-distance between the atlas surface and the mouse surface is then minimized in order to register two data sets. A Laplacian prior is used to ensure smoothness of the surface warping field. Once the atlas surface is normalized to match the range data, the internal anatomy is transformed using elastic energy minimization. We present results from performance evaluation studies of our method where we have measured the volumetric overlap between the internal organs delineated directly from MRI or CT and those estimated by our proposed warping scheme. Computed Dice coefficients indicate excellent overlap in the brain and the heart, with fair agreement in the kidneys and the bladder.

  13. DigiWarp: a method for deformable mouse atlas warping to surface topographic data

    International Nuclear Information System (INIS)

    Joshi, Anand A; Shattuck, David W; Toga, Arthur W; Chaudhari, Abhijit J; Li Changqing; Cherry, Simon R; Dutta, Joyita; Leahy, Richard M

    2010-01-01

    For pre-clinical bioluminescence or fluorescence optical tomography, the animal's surface topography and internal anatomy need to be estimated for improving the quantitative accuracy of reconstructed images. The animal's surface profile can be measured by all-optical systems, but estimation of the internal anatomy using optical techniques is non-trivial. A 3D anatomical mouse atlas may be warped to the estimated surface. However, fitting an atlas to surface topography data is challenging because of variations in the posture and morphology of imaged mice. In addition, acquisition of partial data (for example, from limited views or with limited sampling) can make the warping problem ill-conditioned. Here, we present a method for fitting a deformable mouse atlas to surface topographic range data acquired by an optical system. As an initialization procedure, we match the posture of the atlas to the posture of the mouse being imaged using landmark constraints. The asymmetric L 2 pseudo-distance between the atlas surface and the mouse surface is then minimized in order to register two data sets. A Laplacian prior is used to ensure smoothness of the surface warping field. Once the atlas surface is normalized to match the range data, the internal anatomy is transformed using elastic energy minimization. We present results from performance evaluation studies of our method where we have measured the volumetric overlap between the internal organs delineated directly from MRI or CT and those estimated by our proposed warping scheme. Computed Dice coefficients indicate excellent overlap in the brain and the heart, with fair agreement in the kidneys and the bladder.

  14. Soft hairy warped black hole entropy

    Science.gov (United States)

    Grumiller, Daniel; Hacker, Philip; Merbis, Wout

    2018-02-01

    We reconsider warped black hole solutions in topologically massive gravity and find novel boundary conditions that allow for soft hairy excitations on the horizon. To compute the associated symmetry algebra we develop a general framework to compute asymptotic symmetries in any Chern-Simons-like theory of gravity. We use this to show that the near horizon symmetry algebra consists of two u (1) current algebras and recover the surprisingly simple entropy formula S = 2 π( J 0 + + J 0 - ), where J 0 ± are zero mode charges of the current algebras. This provides the first example of a locally non-maximally symmetric configuration exhibiting this entropy law and thus non-trivial evidence for its universality.

  15. Warped unification, proton stability, and dark matter.

    Science.gov (United States)

    Agashe, Kaustubh; Servant, Géraldine

    2004-12-03

    We show that solving the problem of baryon-number violation in nonsupersymmetric grand unified theories (GUT's) in warped higher-dimensional spacetime can lead to a stable Kaluza-Klein particle. This exotic particle has gauge quantum numbers of a right-handed neutrino, but carries fractional baryon number and is related to the top quark within the higher-dimensional GUT. A combination of baryon number and SU(3) color ensures its stability. Its relic density can easily be of the right value for masses in the 10 GeV-few TeV range. An exciting aspect of these models is that the entire parameter space will be tested at near future dark matter direct detection experiments. Other exotic GUT partners of the top quark are also light and can be produced at high energy colliders with distinctive signatures.

  16. Language comprehension warps the mirror neuron system

    Directory of Open Access Journals (Sweden)

    Noah eZarr

    2013-12-01

    Full Text Available Is the mirror neuron system (MNS used in language understanding? According to embodied accounts of language comprehension, understanding sentences describing actions makes use of neural mechanisms of action control, including the MNS. Consequently, repeatedly comprehending sentences describing similar actions should induce adaptation of the MNS thereby warping its use in other cognitive processes such as action recognition and prediction. To test this prediction, participants read blocks of multiple sentences where each sentence in the block described transfer of objects in a direction away or toward the reader. Following each block, adaptation was measured by having participants predict the end-point of videotaped actions. The adapting sentences disrupted prediction of actions in the same direction, but a only for videos of biological motion, and b only when the effector implied by the language (e.g., the hand matched the videos. These findings are signatures of the mirror neuron system.

  17. Language comprehension warps the mirror neuron system.

    Science.gov (United States)

    Zarr, Noah; Ferguson, Ryan; Glenberg, Arthur M

    2013-01-01

    Is the mirror neuron system (MNS) used in language understanding? According to embodied accounts of language comprehension, understanding sentences describing actions makes use of neural mechanisms of action control, including the MNS. Consequently, repeatedly comprehending sentences describing similar actions should induce adaptation of the MNS thereby warping its use in other cognitive processes such as action recognition and prediction. To test this prediction, participants read blocks of multiple sentences where each sentence in the block described transfer of objects in a direction away or toward the reader. Following each block, adaptation was measured by having participants predict the end-point of videotaped actions. The adapting sentences disrupted prediction of actions in the same direction, but (a) only for videos of biological motion, and (b) only when the effector implied by the language (e.g., the hand) matched the videos. These findings are signatures of the MNS.

  18. Gravity on a little warped space

    International Nuclear Information System (INIS)

    George, Damien P.; McDonald, Kristian L.

    2011-01-01

    We investigate the consistent inclusion of 4D Einstein gravity on a truncated slice of AdS 5 whose bulk-gravity and UV scales are much less than the 4D Planck scale, M * Pl . Such 'Little Warped Spaces' have found phenomenological utility and can be motivated by string realizations of the Randall-Sundrum framework. Using the interval approach to brane-world gravity, we show that the inclusion of a large UV-localized Einstein-Hilbert term allows one to consistently incorporate 4D Einstein gravity into the low-energy theory. We detail the spectrum of Kaluza-Klein metric fluctuations and, in particular, examine the coupling of the little radion to matter. Furthermore, we show that Goldberger-Wise stabilization can be successfully implemented on such spaces. Our results demonstrate that realistic low-energy effective theories can be constructed on these spaces, and have relevance for existing models in the literature.

  19. The WARP Code: Modeling High Intensity Ion Beams

    International Nuclear Information System (INIS)

    Grote, D P; Friedman, A; Vay, J L; Haber, I

    2004-01-01

    The Warp code, developed for heavy-ion driven inertial fusion energy studies, is used to model high intensity ion (and electron) beams. Significant capability has been incorporated in Warp, allowing nearly all sections of an accelerator to be modeled, beginning with the source. Warp has as its core an explicit, three-dimensional, particle-in-cell model. Alongside this is a rich set of tools for describing the applied fields of the accelerator lattice, and embedded conducting surfaces (which are captured at sub-grid resolution). Also incorporated are models with reduced dimensionality: an axisymmetric model and a transverse ''slice'' model. The code takes advantage of modern programming techniques, including object orientation, parallelism, and scripting (via Python). It is at the forefront in the use of the computational technique of adaptive mesh refinement, which has been particularly successful in the area of diode and injector modeling, both steady-state and time-dependent. In the presentation, some of the major aspects of Warp will be overviewed, especially those that could be useful in modeling ECR sources. Warp has been benchmarked against both theory and experiment. Recent results will be presented showing good agreement of Warp with experimental results from the STS500 injector test stand. Additional information can be found on the web page http://hif.lbl.gov/theory/WARP( ) summary.html

  20. Some examples of image warping for low vision prosthesis

    Science.gov (United States)

    Juday, Richard D.; Loshin, David S.

    1988-01-01

    NASA has developed an image processor, the Programmable Remapper, for certain functions in machine vision. The Remapper performs a highly arbitrary geometric warping of an image at video rate. It might ultimately be shrunk to a size and cost that could allow its use in a low-vision prosthesis. Coordinate warpings have been developed for retinitis pigmentosa (tunnel vision) and for maculapathy (loss of central field) that are intended to make best use of the patient's remaining viable retina. The rationales and mathematics are presented for some warpings that we will try in clinical studies using the Remapper's prototype.

  1. Closed timelike curves in asymmetrically warped brane universes

    Science.gov (United States)

    Päs, Heinrich; Pakvasa, Sandip; Dent, James; Weiler, Thomas J.

    2009-08-01

    In asymmetrically-warped spacetimes different warp factors are assigned to space and to time. We discuss causality properties of these warped brane universes and argue that scenarios with two extra dimensions may allow for timelike curves which can be closed via paths in the extra-dimensional bulk. In particular, necessary and sufficient conditions on the metric for the existence of closed timelike curves are presented. We find a six-dimensional warped metric which satisfies the CTC conditions, and where the null, weak and dominant energy conditions are satisfied on the brane (although only the former remains satisfied in the bulk). Such scenarios are interesting, since they open the possibility of experimentally testing the chronology protection conjecture by manipulating on our brane initial conditions of gravitons or hypothetical gauge-singlet fermions (“sterile neutrinos”) which then propagate in the extra dimensions.

  2. Namaste (counterbalancing) technique: Overcoming warping in costal cartilage.

    Science.gov (United States)

    Agrawal, Kapil S; Bachhav, Manoj; Shrotriya, Raghav

    2015-01-01

    Indian noses are broader and lack projection as compared to other populations, hence very often need augmentation, that too by large volume. Costal cartilage remains the material of choice in large volume augmentations and repair of complex primary and secondary nasal deformities. One major disadvantage of costal cartilage grafts (CCG) which offsets all other advantages is the tendency to warp and become distorted over a period of time. We propose a simple technique to overcome this menace of warping. We present the data of 51 patients of rhinoplasty done using CCG with counterbalancing technique over a period of 4 years. No evidence of warping was found in any patient up to a maximum follow-up period of 4 years. Counterbalancing is a useful technique to overcome the problem of warping. It gives liberty to utilize even unbalanced cartilage safely to provide desired shape and use the cartilage without any wastage.

  3. Namaste (counterbalancing technique: Overcoming warping in costal cartilage

    Directory of Open Access Journals (Sweden)

    Kapil S Agrawal

    2015-01-01

    Full Text Available Background: Indian noses are broader and lack projection as compared to other populations, hence very often need augmentation, that too by large volume. Costal cartilage remains the material of choice in large volume augmentations and repair of complex primary and secondary nasal deformities. One major disadvantage of costal cartilage grafts (CCG which offsets all other advantages is the tendency to warp and become distorted over a period of time. We propose a simple technique to overcome this menace of warping. Materials and Methods: We present the data of 51 patients of rhinoplasty done using CCG with counterbalancing technique over a period of 4 years. Results: No evidence of warping was found in any patient up to a maximum follow-up period of 4 years. Conclusion: Counterbalancing is a useful technique to overcome the problem of warping. It gives liberty to utilize even unbalanced cartilage safely to provide desired shape and use the cartilage without any wastage.

  4. Mechanical properties of 3D printed warped membranes

    Science.gov (United States)

    Kosmrlj, Andrej; Xiao, Kechao; Weaver, James C.; Vlassak, Joost J.; Nelson, David R.

    2015-03-01

    We explore how a frozen background metric affects the mechanical properties of solid planar membranes. Our focus is a special class of ``warped membranes'' with a preferred random height profile characterized by random Gaussian variables h (q) in Fourier space with zero mean and variance q-m . It has been shown theoretically that in the linear response regime, this quenched random disorder increases the effective bending rigidity, while the Young's and shear moduli are reduced. Compared to flat plates of the same thickness t, the bending rigidity of warped membranes is increased by a factor hv / t while the in-plane elastic moduli are reduced by t /hv , where hv =√{ } describes the frozen height fluctuations. Interestingly, hv is system size dependent for warped membranes characterized with m > 2 . We present experimental tests of these predictions, using warped membranes prepared via high resolution 3D printing.

  5. Time Warp Operating System, Version 2.5.1

    Science.gov (United States)

    Bellenot, Steven F.; Gieselman, John S.; Hawley, Lawrence R.; Peterson, Judy; Presley, Matthew T.; Reiher, Peter L.; Springer, Paul L.; Tupman, John R.; Wedel, John J., Jr.; Wieland, Frederick P.; hide

    1993-01-01

    Time Warp Operating System, TWOS, is special purpose computer program designed to support parallel simulation of discrete events. Complete implementation of Time Warp software mechanism, which implements distributed protocol for virtual synchronization based on rollback of processes and annihilation of messages. Supports simulations and other computations in which both virtual time and dynamic load balancing used. Program utilizes underlying resources of operating system. Written in C programming language.

  6. The WARP Code: Modeling High Intensity Ion Beams

    International Nuclear Information System (INIS)

    Grote, David P.; Friedman, Alex; Vay, Jean-Luc; Haber, Irving

    2005-01-01

    The Warp code, developed for heavy-ion driven inertial fusion energy studies, is used to model high intensity ion (and electron) beams. Significant capability has been incorporated in Warp, allowing nearly all sections of an accelerator to be modeled, beginning with the source. Warp has as its core an explicit, three-dimensional, particle-in-cell model. Alongside this is a rich set of tools for describing the applied fields of the accelerator lattice, and embedded conducting surfaces (which are captured at sub-grid resolution). Also incorporated are models with reduced dimensionality: an axisymmetric model and a transverse ''slice'' model. The code takes advantage of modern programming techniques, including object orientation, parallelism, and scripting (via Python). It is at the forefront in the use of the computational technique of adaptive mesh refinement, which has been particularly successful in the area of diode and injector modeling, both steady-state and time-dependent. In the presentation, some of the major aspects of Warp will be overviewed, especially those that could be useful in modeling ECR sources. Warp has been benchmarked against both theory and experiment. Recent results will be presented showing good agreement of Warp with experimental results from the STS500 injector test stand

  7. CERN LHC signals from warped extra dimensions

    International Nuclear Information System (INIS)

    Agashe, Kaustubh; Belyaev, Alexander; Krupovnickas, Tadas; Perez, Gilad; Virzi, Joseph

    2008-01-01

    We study production of Kaluza-Klein (KK) gluons at the Large Hadron Collider (LHC) in the framework of a warped extra dimension with the standard model fields propagating in the bulk. We show that the detection of the KK gluon is challenging since its production is suppressed by small couplings to the proton's constituents. Moreover, the KK gluon decays mostly to top pairs due to an enhanced coupling and hence is broad. Nevertheless, we demonstrate that for M KKG -1 of data at the LHC can provide discovery of the KK gluon. We utilize a sizable left-right polarization asymmetry from the KK gluon resonance to maximize the signal significance, and we explore the novel feature of extremely highly energetic 'top-jets'. We briefly discuss how the detection of electroweak gauge KK states (Z/W) faces a similar challenge since their leptonic decays (golden modes) are suppressed. Our analysis suggests that other frameworks, for example, little Higgs, which rely on UV completion via strong dynamics might face similar challenges, namely, (1) suppressed production rates for the new particles (such as Z ' ), due to their 'light-fermion-phobic' nature, and (2) difficulties in detection since the new particles are broad and decay predominantly to third generation quarks and longitudinal gauge bosons

  8. LHC Signals from Warped Extra Dimensions

    International Nuclear Information System (INIS)

    Agashe, K.; Belyaev, A.; Krupovnickas, T.; Perez, G.; Virzi, J.

    2006-01-01

    We study production of Kaluza-Klein gluons (KKG) at the Large Hadron Collider (LHC) in the framework of a warped extra dimension with the Standard Model (SM) fields propagating in the bulk. We show that the detection of KK gluon is challenging since its production is suppressed by small couplings to the proton's constituents. Moreover, the KK gluon decays mostly to top pairs due to an enhanced coupling and hence is broad. Nevertheless, we demonstrate that for MKKG < 4 TeV, 100 fb-1 of data at the LHC can provide discovery of the KK gluon. We utilize a sizeable left-right polarization asymmetry from the KK gluon resonance to maximize the signal significance, and we explore the novel feature of extremely highly energetic 'top-jets'. We briefly discuss how the detection of electroweak gauge KK states (Z/W) faces a similar challenge since their leptonic decays ('golden' modes) are suppressed. Our analysis suggests that other frameworks, for example little Higgs, which rely on UV completion via strong dynamics might face similar challenges, namely (1) Suppressed production rates for the new particles (such as Z'), due to their 'light fermion-phobic' nature, and (2) Difficulties in detection since the new particles are broad and decay predominantly to third generation quarks and longitudinal gauge bosons

  9. Unified flavor symmetry from warped dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Frank, Mariana, E-mail: mariana.frank@concordia.ca [Department of Physics, Concordia University, 7141 Sherbrooke St. West, Montreal, Quebec, H4B 1R6 (Canada); Hamzaoui, Cherif, E-mail: hamzaoui.cherif@uqam.ca [Groupe de Physique Théorique des Particules, Département des Sciences de la Terre et de L' Atmosphère, Université du Québec à Montréal, Case Postale 8888, Succ. Centre-Ville, Montréal, Québec, H3C 3P8 (Canada); Pourtolami, Nima, E-mail: n_pour@live.concordia.ca [Department of Physics, Concordia University, 7141 Sherbrooke St. West, Montreal, Quebec, H4B 1R6 (Canada); Toharia, Manuel, E-mail: mtoharia@physics.concordia.ca [Department of Physics, Concordia University, 7141 Sherbrooke St. West, Montreal, Quebec, H4B 1R6 (Canada)

    2015-03-06

    In a model of warped extra-dimensions with all matter fields in the bulk, we propose a scenario which explains all the masses and mixings of the SM fermions. In this scenario, the same flavor symmetric structure is imposed on all the fermions of the Standard Model (SM), including neutrinos. Due to the exponential sensitivity on bulk fermion masses, a small breaking of this symmetry can be greatly enhanced and produce seemingly un-symmetric hierarchical masses and small mixing angles among the charged fermion zero-modes (SM quarks and charged leptons), thus washing out visible effects of the symmetry. If the Dirac neutrinos are sufficiently localized towards the UV boundary, and the Higgs field leaking into the bulk, the neutrino mass hierarchy and flavor structure will still be largely dominated and reflect the fundamental flavor structure, whereas localization of the quark sector would reflect the effects of the flavor symmetry breaking sector. We explore these features in an example based on which a family permutation symmetry is imposed in both quark and lepton sectors.

  10. LHC Signals from Warped Extra Dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Agashe, K.; Belyaev, A.; Krupovnickas, T.; Perez, G.; Virzi, J.

    2006-12-06

    We study production of Kaluza-Klein gluons (KKG) at the Large Hadron Collider (LHC) in the framework of a warped extra dimension with the Standard Model (SM) fields propagating in the bulk. We show that the detection of KK gluon is challenging since its production is suppressed by small couplings to the proton's constituents. Moreover, the KK gluon decaysmostly to top pairs due to an enhanced coupling and hence is broad. Nevertheless, we demonstrate that for MKKG<~;; 4 TeV, 100 fb-1 of data at the LHC can provide discovery of the KK gluon. We utilize a sizeable left-right polarization asymmetry from the KK gluon resonance to maximize the signal significance, and we explore the novel feature of extremely highly energetic"top-jets." We briefly discuss how the detection of electroweak gauge KK states (Z/W) faces a similar challenge since their leptonic decays ("golden" modes) are suppressed. Our analysis suggests that other frameworks, for example little Higgs, which rely on UV completion via strong dynamics might face similar challenges, namely (1) Suppressed production rates for the new particles (such as Z'), due to their"lightfermion-phobic" nature, and (2) Difficulties in detection since the new particles are broad and decay predominantly to third generation quarks and longitudinal gauge bosons.

  11. Inflationary scenario from higher curvature warped spacetime

    International Nuclear Information System (INIS)

    Banerjee, Narayan; Paul, Tanmoy

    2017-01-01

    We consider a five dimensional warped spacetime, in presence of the higher curvature term like F(R) = R + αR 2 in the bulk, in the context of the two-brane model. Our universe is identified with the TeV scale brane and emerges as a four dimensional effective theory. From the perspective of this effective theory, we examine the possibility of ''inflationary scenario'' by considering the on-brane metric ansatz as an FRW one. Our results reveal that the higher curvature term in the five dimensional bulk spacetime generates a potential term for the radion field. Due to the presence of radion potential, the very early universe undergoes a stage of accelerated expansion and, moreover, the accelerating period of the universe terminates in a finite time. We also find the spectral index of curvature perturbation (n s ) and the tensor to scalar ratio (r) in the present context, which match with the observational results based on the observations of Planck (Astron. Astrophys. 594, A20, 2016). (orig.)

  12. Inflationary scenario from higher curvature warped spacetime

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Narayan [Indian Institute of Science Education and Research Kolkata, Department of Physical Sciences, Nadia, West Bengal (India); Paul, Tanmoy [Indian Association for the Cultivation of Science, Department of Theoretical Physics, Kolkata (India)

    2017-10-15

    We consider a five dimensional warped spacetime, in presence of the higher curvature term like F(R) = R + αR{sup 2} in the bulk, in the context of the two-brane model. Our universe is identified with the TeV scale brane and emerges as a four dimensional effective theory. From the perspective of this effective theory, we examine the possibility of ''inflationary scenario'' by considering the on-brane metric ansatz as an FRW one. Our results reveal that the higher curvature term in the five dimensional bulk spacetime generates a potential term for the radion field. Due to the presence of radion potential, the very early universe undergoes a stage of accelerated expansion and, moreover, the accelerating period of the universe terminates in a finite time. We also find the spectral index of curvature perturbation (n{sub s}) and the tensor to scalar ratio (r) in the present context, which match with the observational results based on the observations of Planck (Astron. Astrophys. 594, A20, 2016). (orig.)

  13. Flavor structure of warped extra dimension models

    International Nuclear Information System (INIS)

    Agashe, Kaustubh; Perez, Gilad; Soni, Amarjit

    2005-01-01

    We recently showed that warped extra-dimensional models with bulk custodial symmetry and few TeV Kaluza-Klein (KK) masses lead to striking signals at B factories. In this paper, using a spurion analysis, we systematically study the flavor structure of models that belong to the above class. In particular we find that the profiles of the zero modes, which are similar in all these models, essentially control the underlying flavor structure. This implies that our results are robust and model independent in this class of models. We discuss in detail the origin of the signals in B physics. We also briefly study other new physics signatures that arise in rare K decays (K→πνν), in rare top decays [t→cγ(Z,gluon)], and the possibility of CP asymmetries in D 0 decays to CP eigenstates such as K S π 0 and others. Finally we demonstrate that with light KK masses, ∼3 TeV, the above class of models with anarchic 5D Yukawas has a 'CP problem' since contributions to the neutron electric dipole moment are roughly 20 times larger than the current experimental bound. Using AdS/CFT correspondence, these extra-dimensional models are dual to a purely 4D strongly coupled conformal Higgs sector thus enhancing their appeal

  14. Flavor Structure of Warped Extra Dimension Models

    International Nuclear Information System (INIS)

    Agashe, Kaustubh; Perez, Gilad; Soni, Amarjit

    2004-01-01

    We recently showed, in HEP-PH--0406101, that warped extra dimensional models with bulk custodial symmetry and few TeV KK masses lead to striking signals at B-factories. In this paper, using a spurion analysis, we systematically study the flavor structure of models that belong to the above class. In particular we find that the profiles of the zero modes, which are similar in all these models, essentially control the underlying flavor structure. This implies that our results are robust and model independent in this class of models. We discuss in detail the origin of the signals in B-physics. We also briefly study other NP signatures that arise in rare K decays (K → πνν), in rare top decays [t → cγ(Z, gluon)] and the possibility of CP asymmetries in D 0 decays to CP eigenstates such as K s π 0 and others. Finally we demonstrate that with light KK masses, ∼ 3 TeV, the above class of models with anarchic 5D Yukawas has a ''CP problem'' since contributions to the neutron electric dipole moment are roughly 20 times larger than the current experimental bound. Using AdS/CFT correspondence, these extra-dimensional models are dual to a purely 4D strongly coupled conformal Higgs sector thus enhancing their appeal

  15. Extraordinary phenomenology from warped flavor triviality

    International Nuclear Information System (INIS)

    Delaunay, Cedric; Gedalia, Oram; Lee, Seung J.; Perez, Gilad; Ponton, Eduardo

    2011-01-01

    Anarchic warped extra dimensional models provide a solution to the hierarchy problem. They can also account for the observed flavor hierarchies, but only at the expense of little hierarchy and CP problems, which naturally require a Kaluza-Klein (KK) scale beyond the LHC reach. We have recently shown that when flavor issues are decoupled, and assumed to be solved by UV physics, the framework's parameter space greatly opens. Given the possibility of a lower KK scale and composite light quarks, this class of flavor triviality models enjoys a rather exceptional phenomenology, which is the focus of this Letter. We also revisit the anarchic RS EDM problem, which requires m KK ≥12 TeV, and show that it is solved within flavor triviality models. Interestingly, our framework can induce a sizable differential tt-bar forward-backward asymmetry, and leads to an excess of massive boosted di-jet events, which may be linked to the recent findings of the CDF Collaboration. This feature may be observed by looking at the corresponding planar flow distribution, which is presented here. Finally we point out that the celebrated standard model preference towards a light Higgs is significantly reduced within our framework.

  16. Galactic warps and the shape of heavy halos

    International Nuclear Information System (INIS)

    Sparke, L.S.

    1984-01-01

    The outer disks of many spiral galaxies are bent away from the plane of the inner disk; the abundance of these warps suggests that they are long-lived. Isolated galactic disks have long been thought to have no discrete modes of vertical oscillation under their own gravity, and so to be incapable of sustaining persistent warps. However, the visible disk contains only a fraction of the galactic mass; an invisible galactic halo makes up the rest. This paper presents an investigation of vertical warping modes in self-gravitating disks, in the imposed potential due to an axisymmetric unseen massive halo. If the halo matter is distributed so that the free precession rate of a test particle decreases with radius near the edge of the disk, then the disk has a discrete mode of vibration; oblate halos which become rapidly more flattened at large radii, and uniformly prolate halos, satisfy this requirement. Otherwise, the disk has no discrete modes and so cannot maintain a long-lived warp, unless the edge is sharply truncated. Computed mode shapes which resemble the observed warps can be found for halo masses consistent with those inferred from galactic rotation curves

  17. Between-domain relations of students' academic emotions and their judgments of school domain similarity

    Science.gov (United States)

    Goetz, Thomas; Haag, Ludwig; Lipnevich, Anastasiya A.; Keller, Melanie M.; Frenzel, Anne C.; Collier, Antonie P. M.

    2014-01-01

    With the aim to deepen our understanding of the between-domain relations of academic emotions, a series of three studies was conducted. We theorized that between-domain relations of trait (i.e., habitual) emotions reflected students' judgments of domain similarities, whereas between-domain relations of state (i.e., momentary) emotions did not. This supposition was based on the accessibility model of emotional self-report, according to which individuals' beliefs tend to strongly impact trait, but not state emotions. The aim of Study 1 (interviews; N = 40; 8th and 11th graders) was to gather salient characteristics of academic domains from students' perspective. In Study 2 (N = 1709; 8th and 11th graders) the 13 characteristics identified in Study 1 were assessed along with academic emotions in four different domains (mathematics, physics, German, and English) using a questionnaire-based trait assessment. With respect to the same domains, state emotions were assessed in Study 3 (N = 121; 8th and 11th graders) by employing an experience sampling approach. In line with our initial assumptions, between-domain relations of trait but not state academic emotions reflected between-domain relations of domain characteristics. Implications for research and practice are discussed. PMID:25374547

  18. Between-Domain Relations of Students’ Academic Emotions and Their Judgments of School Domain Similarity

    Directory of Open Access Journals (Sweden)

    Thomas eGoetz

    2014-10-01

    Full Text Available With the aim to deepen our understanding of the between-domain relations of academic emotions, a series of three studies was conducted. We theorized that between-domain relations of trait (i.e., habitual emotions reflected students’ judgments of domain similarities, whereas between-domain relations of state (i.e., momentary emotions did not. This supposition was based on the accessibility model of emotional self-report, according to which individuals’ beliefs tend to strongly impact trait, but not state emotions. The aim of Study 1 (interviews; N = 40; 8th and 11th graders was to gather salient characteristics of academic domains from students’ perspective. In Study 2 (N=1709; 8th and 11th graders the 13 characteristics identified in Study 1 were assessed along with academic emotions in four different domains (mathematics, physics, German, and English using a questionnaire-based trait assessment. With respect to the same domains, state emotions were assessed in Study 3 (N = 121; 8th and 11th graders by employing an experience sampling approach. In line with our initial assumptions, between-domain relations of trait but not state academic emotions reflected between-domain relations of domain characteristics. Implications for research and practice are discussed.

  19. Constraining the age of the NGC 4565 H I disk WARP: Determining the origin of gas WARPS

    Energy Technology Data Exchange (ETDEWEB)

    Radburn-Smith, David J.; Dalcanton, Julianne J.; Stilp, Adrienne M. [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); De Jong, Roelof S.; Streich, David [Leibniz-Institut für Astrophysik Potsdam, D-14482 Potsdam (Germany); Bell, Eric F.; Monachesi, Antonela [Department of Astronomy, University of Michigan, Ann Arbor, MI 48109 (United States); Dolphin, Andrew E. [Raytheon, 1151 East Hermans Road, Tucson, AZ 85756 (United States); Holwerda, Benne W. [European Space Agency, ESTEC, 2200 AG Noordwijk (Netherlands); Bailin, Jeremy [Department of Physics and Astronomy, University of Alabama, Tuscaloosa, AL 35487 (United States)

    2014-01-01

    We have mapped the distribution of young and old stars in the gaseous H I warp of NGC 4565. We find a clear correlation of young stars (<600 Myr) with the warp but no coincident old stars (>1 Gyr), which places an upper limit on the age of the structure. The formation rate of the young stars, which increased ∼300 Myr ago relative to the surrounding regions, is (6.3{sub −1.5}{sup +2.5})×10{sup −5} M {sub ☉} yr{sup –1} kpc{sup –2}. This implies a ∼60 ± 20 Gyr depletion time of the H I warp, similar to the timescales calculated for the outer H I disks of nearby spiral galaxies. While some stars associated with the warp fall into the asymptotic giant branch (AGB) region of the color-magnitude diagram, where stars could be as old as 1 Gyr, further investigation suggests that they may be interlopers rather than real AGB stars. We discuss the implications of these age constraints for the formation of H I warps and the gas fueling of disk galaxies.

  20. Modulus stabilization in a non-flat warped braneworld scenario

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Indrani [S.N. Bose National Centre for Basic Sciences, Department of Astrophysics and Cosmology, Kolkata (India); SenGupta, Soumitra [Indian Association for the Cultivation of Science, Department of Theoretical Physics, Kolkata (India)

    2017-05-15

    The stability of the modular field in a warped brane world scenario has been a subject of interest for a long time. Goldberger and Wise (GW) proposed a mechanism to achieve this by invoking a massive scalar field in the bulk space-time neglecting the back-reaction. In this work, we examine the possibility of stabilizing the modulus without bringing about any external scalar field. We show that instead of flat 3-branes as considered in Randall-Sundrum (RS) warped braneworld model, if one considers a more generalized version of warped geometry with de Sitter 3-brane, then the brane vacuum energy automatically leads to a modulus potential with a metastable minimum. Our result further reveals that in this scenario the gauge hierarchy problem can also be resolved for an appropriate choice of the brane's cosmological constant. (orig.)

  1. Aspects of warped AdS3/CFT2 correspondence

    Science.gov (United States)

    Chen, Bin; Zhang, Jia-Ju; Zhang, Jian-Dong; Zhong, De-Liang

    2013-04-01

    In this paper we apply the thermodynamics method to investigate the holographic pictures for the BTZ black hole, the spacelike and the null warped black holes in three-dimensional topologically massive gravity (TMG) and new massive gravity (NMG). Even though there are higher derivative terms in these theories, the thermodynamics method is still effective. It gives consistent results with the ones obtained by using asymptotical symmetry group (ASG) analysis. In doing the ASG analysis we develop a brute-force realization of the Barnich-Brandt-Compere formalism with Mathematica code, which also allows us to calculate the masses and the angular momenta of the black holes. In particular, we propose the warped AdS3/CFT2 correspondence in the new massive gravity, which states that quantum gravity in the warped spacetime could holographically dual to a two-dimensional CFT with {c_R}={c_L}=24 /{Gm{β^2√{{2( {21-4{β^2}} )}}}}.

  2. Human low vision image warping - Channel matching considerations

    Science.gov (United States)

    Juday, Richard D.; Smith, Alan T.; Loshin, David S.

    1992-01-01

    We are investigating the possibility that a video image may productively be warped prior to presentation to a low vision patient. This could form part of a prosthesis for certain field defects. We have done preliminary quantitative studies on some notions that may be valid in calculating the image warpings. We hope the results will help make best use of time to be spent with human subjects, by guiding the selection of parameters and their range to be investigated. We liken a warping optimization to opening the largest number of spatial channels between the pixels of an input imager and resolution cells in the visual system. Some important effects are not quantified that will require human evaluation, such as local 'squashing' of the image, taken as the ratio of eigenvalues of the Jacobian of the transformation. The results indicate that the method shows quantitative promise. These results have identified some geometric transformations to evaluate further with human subjects.

  3. Design of a reading test for low vision image warping

    Science.gov (United States)

    Loshin, David S.; Wensveen, Janice; Juday, Richard D.; Barton, R. S.

    1993-01-01

    NASA and the University of Houston College of Optometry are examining the efficacy of image warping as a possible prosthesis for at least two forms of low vision - maculopathy and retinitis pigmentosa. Before incurring the expense of reducing the concept to practice, one would wish to have confidence that a worthwhile improvement in visual function would result. NASA's Programmable Remapper (PR) can warp an input image onto arbitrary geometric coordinate systems at full video rate, and it has recently been upgraded to accept computer-generated video text. We have integrated the Remapper with an SRI eye tracker to simulate visual malfunction in normal observers. A reading performance test has been developed to determine if the proposed warpings yield an increase in visual function; i.e., reading speed. We will describe the preliminary experimental results of this reading test with a simulated central field defect with and without remapped images.

  4. Arbitrary Phase Vocoders by means of Warping

    Directory of Open Access Journals (Sweden)

    Gianpaolo Evangelista

    2013-08-01

    Full Text Available The Phase Vocoder plays a central role in sound analysis and synthesis, allowing us to represent a sound signal in both time and frequency, similar to a music score – but possibly at much finer time and frequency scales – describing the evolution of sound events. According to the uncertainty principle, time and frequency are not independent variables so that any time-frequency representation is the result of a compromise between time and frequency resolutions, the product of which cannot be smaller than a given constant. Therefore, finer frequency resolution can only be achieved with coarser time resolution and, similarly, finer time resolution results in coarser frequency resolution.While most of the conventional methods for time-frequency representations are based on uniform time and uniform frequency resolutions, perception and physical characteristics of sound signals suggest the need for nonuniform analysis and synthesis. As the results of psycho-acoustic research show, human hearing is naturally organized in nonuniform frequency bands. On the physical side, the sounds of percussive instruments as well as piano in the low register, show partials whose frequencies are not uniformly spaced, as opposed to the uniformly spaced partial frequencies found in harmonic sounds. Moreover, the different characteristics of sound signals at the onset transients with respect to stationary segments suggest the need for nonuniform time resolution. In the effort to exploit the time-frequency resolution compromise at its best, a tight time-frequency suit should be tailored to snuggly fit the sound body.In this paper we overview flexible design methods for phase vocoders with nonuniform resolutions. The methods are based on remapping the time or the frequency axis, or both, by employing suitable functions acting as warping maps, which locally change the characteristics of the time-frequency plane. As a result, the sliding windows may have time dependent

  5. Majorana neutrinos in a warped 5D standard model

    International Nuclear Information System (INIS)

    Huber, S.J.; Shafi, Q.

    2002-05-01

    We consider neutrino oscillations and neutrinoless double beta decay in a five dimensional standard model with warped geometry. Although the see-saw mechanism in its simplest form cannot be implemented because of the warped geometry, the bulk standard model neutrinos can acquire the desired (Majorana) masses from dimension five interactions. We discuss how large mixings can arise, why the large mixing angle MSW solution for solar neutrinos is favored, and provide estimates for the mixing angle U e3 . Implications for neutrinoless double beta decay are also discussed. (orig.)

  6. Thermodynamic stability of warped AdS3 black holes

    International Nuclear Information System (INIS)

    Birmingham, Danny; Mokhtari, Susan

    2011-01-01

    We study the thermodynamic stability of warped black holes in three-dimensional topologically massive gravity. The spacelike stretched black hole is parametrized by its mass and angular momentum. We determine the local and global stability properties in the canonical and grand canonical ensembles. The presence of a Hawking-Page type transition is established, and the critical temperature is determined. The thermodynamic metric of Ruppeiner is computed, and the curvature is shown to diverge in the extremal limit. The consequences of these results for the classical stability properties of warped black holes are discussed within the context of the correlated stability conjecture.

  7. Text Processing of Domain-Related Information for Individuals with High and Low Domain Knowledge.

    Science.gov (United States)

    Spilich, George J.; And Others

    1979-01-01

    The way in which previously acquired knowledge affects the processing on new domain-related information was investigated. Text processing was studied in two groups differing in knowledge of the domain of baseball. A knowledge structure for the domain was constructed, and text propositions were classified. (SW)

  8. Warped Extra-Dimensional Opportunities and Signatures (1/3)

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    I plan to discuss ways of searching for warped geometry and other extra-dimensional scenarios, with emphasis on the general lessons for search strategies. We will consider RS geometry on the brane and in the bulk, as well as possible black hole or quantum gravity signatures. If time permits, we will also consider fermion masses and/or precision Higgs measurements.

  9. Warped Extra-Dimensional Opportunities and Signatures (3/3)

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    I plan to discuss ways of searching for warped geometry and other extra-dimensional scenarios, with emphasis on the general lessons for search strategies. We will consider RS geometry on the brane and in the bulk, as well as possible black hole or quantum gravity signatures. If time permits, we will also consider fermion masses and/or precision Higgs measurements.

  10. Warped Extra-Dimensional Opportunities and Signatures (2/3)

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    I plan to discuss ways of searching for warped geometry and other extra-dimensional scenarios, with emphasis on the general lessons for search strategies. We will consider RS geometry on the brane and in the bulk, as well as possible black hole or quantum gravity signatures. If time permits, we will also consider fermion masses and/or precision Higgs measurements.

  11. Sinuous oscillations and steady warps of polytropic disks

    International Nuclear Information System (INIS)

    Balmforth, N.J.; Spiegel, E.A.

    1995-05-01

    In an asymptotic development of the equations governing the equilibria and linear stability of rapidly rotating polytropes we employed the slender aspect of these objects to reduce the three-dimensional partial differential equations to a somewhat simpler, ordinary integro-differential form. The earlier calculations dealt with isolated objects that were in centrifugal balance, that is the centrifugal acceleration of the configuration was balanced largely by self gravity with small contributions from the pressure gradient. Another interesting situation is that in which the polytrope rotates subject to externally imposed gravitational fields. In astrophysics, this is common in the theory of galactic dynamics because disks are unlikely to be isolated objects. The dark halos associated with disks also provide one possible explanation of the apparent warping of many galaxies. If the axis of the highly flattened disk is not aligned with that of the much less flattened halo, then the resultant torque of the halo gravity on the disk might provide a nonaxisymmetric distortion or disk warp. Motivated by these possibilities we shall here build models of polytropic disks of small but finite thickness which are subjected to prescribed, external gravitational fields. First we estimate how a symmetrical potential distorts the structure of the disk, then we examine its sinuous oscillations to confirm that they freely decay, hence suggesting that a warp must be externally forced. Finally, we consider steady warps of the disk plane when the axis of the disk does not coincide with that of the halo

  12. Acoustic analysis of warp potential of green ponderosa pine lumber

    Science.gov (United States)

    Xiping Wang; William T. Simpson

    2005-01-01

    This study evaluated the potential of acoustic analysis as presorting criteria to identify warp-prone boards before kiln drying. Dimension lumber, 38 by 89 mm (nominal 2 by 4 in.) and 2.44 m (8 ft) long, sawn from open-grown small-diameter ponderosa pine trees, was acoustically tested lengthwise at green condition. Three acoustic properties (acoustic speed, rate of...

  13. WARP: a double phase argon programme for dark matter detection

    International Nuclear Information System (INIS)

    Ferrari, N

    2006-01-01

    WARP (Wimp ARgon Programme) is a double phase Argon detector for Dark Matter search under construction at Laboratori Nazionali del Gran Sasso. We present recent results obtained operating a prototype with a sensitive mass of 2.3 litres deep underground

  14. A controlled method to flatten warped wooden panels

    NARCIS (Netherlands)

    Van Gerven, G.; Ankersmit, B.; van Duin, P.H.J.C.; Jorissen, A.J.M.; Schellen, H.L.

    2016-01-01

    This article describes the research and subsequent treatment to flatten the warped wooden doors of a seventeenth-century cabinet. The aim was to flatten the veneered panels, in very strict climatic conditions and without lifting any veneer or damaging the surface finish of the exterior. In this

  15. Interactions between massive dark halos and warped disks

    NARCIS (Netherlands)

    Kuijken, K; Persic, M; Salucci, P

    1997-01-01

    The normal mode theory for warping of galaxy disks, in which disks are assumed to be tilted with respect to the equator of a massive, flattened dark halo, assumes a rigid, fixed halo. However, consideration of the back-reaction by a misaligned disk on a massive particle halo shows there to be strong

  16. International note: between-domain relations of Chinese high school students' academic achievements.

    Science.gov (United States)

    Yangyang, Liu

    2012-08-01

    The present study examined the between-domain relations of Chinese high school students' academic achievements. In a sample of 1870 Chinese 10th grade students, the results indicated that Chinese high school students' academic achievements were correlated across nine subjects. In line with the previous Western findings, the findings suggested that academic achievement was largely domain-general in nature. Copyright © 2012 The Foundation for Professionals in Services for Adolescents. Published by Elsevier Ltd. All rights reserved.

  17. Dynamically warped theory space and collective supersymmetry breaking

    International Nuclear Information System (INIS)

    Carone, Christopher D.; Erlich, Joshua; Glover, Brian

    2005-01-01

    We study deconstructed gauge theories in which a warp factor emerges dynamically. We present nonsupersymmetric models in which the potential for the link fields has translational invariance, broken only by boundary effects that trigger an exponential profile of vacuum expectation values. The spectrum of physical states deviates exponentially from that of the continuum for large masses; we discuss the effects of such exponential towers on gauge coupling unification. We also present a supersymmetric example in which a warp factor is driven by Fayet-Iliopoulos terms. The model is peculiar in that it possesses a global supersymmetry that remains unbroken despite nonvanishing D-terms. Inclusion of gravity and/or additional messenger fields leads to the collective breaking of supersymmetry and to unusual phenomenology

  18. Little Randall-Sundrum model and a multiply warped spacetime

    International Nuclear Information System (INIS)

    McDonald, Kristian L.

    2008-01-01

    A recent work has investigated the possibility that the mass scale for the ultraviolet (UV) brane in the Randall-Sundrum (RS) model is of the order 10 3 TeV. In this so called 'little Randall-Sundrum' (LRS) model the bounds on the gauge sector are less severe, permitting a lower Kaluza-Klein scale and cleaner discovery channels. However employing a low UV scale nullifies one major appeal of the RS model, namely, the elegant explanation of the hierarchy between the Planck and weak scales. In this work we show that by localizing the gauge, fermion, and scalar sector of the LRS model on a five dimensional slice of a doubly warped spacetime one may obtain the low UV brane scale employed in the LRS model and motivate the weak-Planck hierarchy. We also consider the generalization to an n-warped spacetime

  19. Gauge and moduli hierarchy in a multiply warped braneworld scenario

    International Nuclear Information System (INIS)

    Das, Ashmita; SenGupta, Soumitra

    2013-01-01

    Discovery of Higgs-like boson near the mass scale ∼126 Gev generates renewed interest to the gauge hierarchy problem in the standard model related to the stabilisation of the Higgs mass within Tev scale without any unnatural fine tuning. One of the successful attempts to resolve this problem has been the Randall–Sundrum warped geometry model. Subsequently this 5-dimensional model was extended to a doubly warped 6-dimensional (or higher) model which can offer a geometric explanation of the fermion mass hierarchy in the standard model of elementary particles (D. Choudhury and S. SenGupta, 2007 [1]). In an attempt to address the dark energy issue, we in this work extend such 6-dimensional warped braneworld model to include non-flat 3-branes at the orbifold fixed points such that a small but non-vanishing brane cosmological constant is induced in our observable brane. We show that the requirements of a Planck to Tev scale warping along with a vanishingly small but non-zero cosmological constant on the visible brane with non-hierarchical moduli, each with scale close to Planck length, lead to a scenario where the 3-branes can have energy scales either close to Tev or close to Planck scale. Such a scenario can address both the gauge hierarchy as well as fermion mass hierarchy problem in standard model without introducing hierarchical scales between the two moduli. Thus simultaneous resolutions to the gauge hierarchy problem, fermion mass hierarchy problem and non-hierarchical moduli problem are closely linked with the near flatness condition of our universe.

  20. Namaste (counterbalancing) technique: Overcoming warping in costal cartilage

    OpenAIRE

    Kapil S Agrawal; Manoj Bachhav; Raghav Shrotriya

    2015-01-01

    Background: Indian noses are broader and lack projection as compared to other populations, hence very often need augmentation, that too by large volume. Costal cartilage remains the material of choice in large volume augmentations and repair of complex primary and secondary nasal deformities. One major disadvantage of costal cartilage grafts (CCG) which offsets all other advantages is the tendency to warp and become distorted over a period of time. We propose a simple technique to overcome th...

  1. Warps, grids and curvature in triple vector bundles

    Science.gov (United States)

    Flari, Magdalini K.; Mackenzie, Kirill

    2018-06-01

    A triple vector bundle is a cube of vector bundle structures which commute in the (strict) categorical sense. A grid in a triple vector bundle is a collection of sections of each bundle structure with certain linearity properties. A grid provides two routes around each face of the triple vector bundle, and six routes from the base manifold to the total manifold; the warps measure the lack of commutativity of these routes. In this paper we first prove that the sum of the warps in a triple vector bundle is zero. The proof we give is intrinsic and, we believe, clearer than the proof using decompositions given earlier by one of us. We apply this result to the triple tangent bundle T^3M of a manifold and deduce (as earlier) the Jacobi identity. We further apply the result to the triple vector bundle T^2A for a vector bundle A using a connection in A to define a grid in T^2A . In this case the curvature emerges from the warp theorem.

  2. Explicit Supersymmetry Breaking on Boundaries of Warped Extra Dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Hall, Lawrence J.; Nomura, Yasunori; Okui, Takemichi; Oliver, Steven J.

    2003-02-25

    Explicit supersymmetry breaking is studied in higher dimensional theories by having boundaries respect only a subgroup of the bulk symmetry. If the boundary symmetry is the maximal subgroup allowed by the boundary conditions imposed on the fields, then the symmetry can be consistently gauged; otherwise gauging leads to an inconsistent theory. In a warped fifth dimension, an explicit breaking of all bulk supersymmetries by the boundaries is found to be inconsistent with gauging; unlike the case of flat 5D, complete supersymmetry breaking by boundary conditions is not consistent with supergravity. Despite this result, the low energy effective theory resulting from boundary supersymmetry breaking becomes consistent in the limit where gravity decouples, and such models are explored in the hope that some way of successfully incorporating gravity can be found. A warped constrained standard model leads to a theory with one Higgs boson with mass expected close to the experimental limit. A unified theory in a warped fifth dimension is studied with boundary breaking of both SU(5) gauge symmetry and supersymmetry. The usual supersymmetric predictionfor gauge coupling unification holds even though the TeV spectrum is quite unlike the MSSM. Such a theory may unify matter and Higgs in the same SU(5) hypermultiplet.

  3. Evaluation of the Intel iWarp parallel processor for space flight applications

    Science.gov (United States)

    Hine, Butler P., III; Fong, Terrence W.

    1993-01-01

    The potential of a DARPA-sponsored advanced processor, the Intel iWarp, for use in future SSF Data Management Systems (DMS) upgrades is evaluated through integration into the Ames DMS testbed and applications testing. The iWarp is a distributed, parallel computing system well suited for high performance computing applications such as matrix operations and image processing. The system architecture is modular, supports systolic and message-based computation, and is capable of providing massive computational power in a low-cost, low-power package. As a consequence, the iWarp offers significant potential for advanced space-based computing. This research seeks to determine the iWarp's suitability as a processing device for space missions. In particular, the project focuses on evaluating the ease of integrating the iWarp into the SSF DMS baseline architecture and the iWarp's ability to support computationally stressing applications representative of SSF tasks.

  4. Communication and Jamming BDA of OFDMA Communication Systems Using the Software Defined Radio Platform WARP

    Science.gov (United States)

    2015-03-01

    COMMUNICATION AND JAMMING BDA OF OFDMA COMMUNICATION SYSTEMS USING THE SOFTWARE DEFINED RADIO PLATFORM WARP THESIS Kate J. Yaxley, FLTLT, Royal... BDA OF OFDMA COMMUNICATION SYSTEMS USING THE SOFTWARE DEFINED RADIO PLATFORM WARP THESIS Presented to the Faculty Department of Electrical and...COMMUNICATION AND JAMMING BDA OF OFDMA COMMUNICATION SYSTEMS USING THE SOFTWARE DEFINED RADIO PLATFORM WARP THESIS Kate J. Yaxley, B.E. (Elec) Hons Div II

  5. Watershed regressions for pesticides (warp) models for predicting atrazine concentrations in Corn Belt streams

    Science.gov (United States)

    Stone, Wesley W.; Gilliom, Robert J.

    2012-01-01

    Watershed Regressions for Pesticides (WARP) models, previously developed for atrazine at the national scale, are improved for application to the United States (U.S.) Corn Belt region by developing region-specific models that include watershed characteristics that are influential in predicting atrazine concentration statistics within the Corn Belt. WARP models for the Corn Belt (WARP-CB) were developed for annual maximum moving-average (14-, 21-, 30-, 60-, and 90-day durations) and annual 95th-percentile atrazine concentrations in streams of the Corn Belt region. The WARP-CB models accounted for 53 to 62% of the variability in the various concentration statistics among the model-development sites. Model predictions were within a factor of 5 of the observed concentration statistic for over 90% of the model-development sites. The WARP-CB residuals and uncertainty are lower than those of the National WARP model for the same sites. Although atrazine-use intensity is the most important explanatory variable in the National WARP models, it is not a significant variable in the WARP-CB models. The WARP-CB models provide improved predictions for Corn Belt streams draining watersheds with atrazine-use intensities of 17 kg/km2 of watershed area or greater.

  6. Traces of warping subsided tectonic blocks on Miranda, Enceladus, Titan

    Science.gov (United States)

    Kochemasov, G.

    2007-08-01

    Icy satellites of the outer Solar system have very large range of sizes - from kilometers to thousands of kilometers. Bodies less than 400-500 km across have normally irregular shapes , often presenting simple Plato's polyhedrons woven by standing inertiagravity waves (see an accompanying abstract of Kochemasov). Larger bodies with enhanced gravity normally are rounded off and have globular shapes but far from ideal spheres. This is due to warping action of inertia-gravity waves of various wavelengths origin of which is related to body movements in elliptical keplerian orbits with periodically changing accelerations (alternating accelerations cause periodically changing forces acting upon a body what means oscillations of its spheres in form of standing warping waves). The fundamental wave 1 and its first overtone wave 2 produce ubiquitous tectonic dichotomy - two segmental structure and tectonic sectoring superimposed on this dichotomy. Two kinds of tectonic blocks (segments and sectors) are formed: uplifted (+) and subsided (-). Uplifting means increasing planetary radius of blocks, subsiding - decreasing radius (as a sequence subsiding blocks diminishing their surfaces must be warped, folded, wrinkled; uplifting blocks increasing their surfaces tend to be deeply cracked, fallen apart). To level changing angular momenta of blocks subsided areas are filled with denser material than uplifted ones (one of the best examples is Earth with its oceanic basins filled with dense basalts and uplifted continents built of less dense on average andesitic material). Icy satellites follow the same rule. Their warped surfaces show differing chemistries or structures of constructive materials. Uplifted blocks are normally built with light (by color and density) water ice. Subsided blocks - depressions, "seas', "lakes", coronas - by somewhat denser material differing in color from water ice (very sharply - Iapetus, moderately - Europa, slightly - many saturnian satellites). A very

  7. Differential RF MEMS interwoven capacitor immune to residual stress warping

    KAUST Repository

    Elshurafa, Amro M.; Salama, Khaled N.

    2012-01-01

    A RF MEMS capacitor with an interwoven structure is designed, fabricated in the PolyMUMPS process and tested in an effort to address fabrication challenges usually faced in MEMS processes. The interwoven structure was found to offer several advantages over the typical MEMS parallel-plate design including eliminating the warping caused by residual stress, eliminating the need for etching holes, suppressing stiction, reducing parasitics and providing differential capability. The quality factor of the proposed capacitor was higher than five throughout a 2–10 GHz range and the resonant frequency was in excess of 20 GHz.

  8. A time warping approach to multiple sequence alignment.

    Science.gov (United States)

    Arribas-Gil, Ana; Matias, Catherine

    2017-04-25

    We propose an approach for multiple sequence alignment (MSA) derived from the dynamic time warping viewpoint and recent techniques of curve synchronization developed in the context of functional data analysis. Starting from pairwise alignments of all the sequences (viewed as paths in a certain space), we construct a median path that represents the MSA we are looking for. We establish a proof of concept that our method could be an interesting ingredient to include into refined MSA techniques. We present a simple synthetic experiment as well as the study of a benchmark dataset, together with comparisons with 2 widely used MSA softwares.

  9. Cosmological evolution in a two-brane warped geometry model

    Directory of Open Access Journals (Sweden)

    Sumit Kumar

    2015-07-01

    Full Text Available We study an effective 4-dimensional scalar–tensor field theory, originated from an underlying brane–bulk warped geometry, to explore the scenario of inflation. It is shown that the inflaton potential naturally emerges from the radion energy–momentum tensor which in turn results in an inflationary model of the Universe on the visible brane that is consistent with the recent results from the Planck's experiment. The dynamics of modulus stabilization from the inflaton rolling condition is demonstrated. The implications of our results in the context of recent BICEP2 results are also discussed.

  10. Differential RF MEMS interwoven capacitor immune to residual stress warping

    KAUST Repository

    Elshurafa, Amro M.

    2012-07-27

    A RF MEMS capacitor with an interwoven structure is designed, fabricated in the PolyMUMPS process and tested in an effort to address fabrication challenges usually faced in MEMS processes. The interwoven structure was found to offer several advantages over the typical MEMS parallel-plate design including eliminating the warping caused by residual stress, eliminating the need for etching holes, suppressing stiction, reducing parasitics and providing differential capability. The quality factor of the proposed capacitor was higher than five throughout a 2–10 GHz range and the resonant frequency was in excess of 20 GHz.

  11. 6D supergravity. Warped solution and gravity mediated supersymmetry breaking

    Energy Technology Data Exchange (ETDEWEB)

    Luedeling, C

    2006-07-15

    We consider compactified six-dimensional gauged supergravity and find the general warped solution with four-dimensional maximal symmetry. Important features of the solution such as the number and position of singularities are determined by a free holomorphic function. Furthermore, in a particular torus compactification we derive the supergravity coupling of brane fields by the Noether procedure and investigate gravity-mediated supersymmetry breaking. The effective Kaehler potential is not sequestered, yet tree level gravity mediation is absent as long as the superpotential is independent of the radius modulus. (orig.)

  12. 6D supergravity. Warped solution and gravity mediated supersymmetry breaking

    International Nuclear Information System (INIS)

    Luedeling, C.

    2006-07-01

    We consider compactified six-dimensional gauged supergravity and find the general warped solution with four-dimensional maximal symmetry. Important features of the solution such as the number and position of singularities are determined by a free holomorphic function. Furthermore, in a particular torus compactification we derive the supergravity coupling of brane fields by the Noether procedure and investigate gravity-mediated supersymmetry breaking. The effective Kaehler potential is not sequestered, yet tree level gravity mediation is absent as long as the superpotential is independent of the radius modulus. (orig.)

  13. TWOS - TIME WARP OPERATING SYSTEM, VERSION 2.5.1

    Science.gov (United States)

    Bellenot, S. F.

    1994-01-01

    The Time Warp Operating System (TWOS) is a special-purpose operating system designed to support parallel discrete-event simulation. TWOS is a complete implementation of the Time Warp mechanism, a distributed protocol for virtual time synchronization based on process rollback and message annihilation. Version 2.5.1 supports simulations and other computations using both virtual time and dynamic load balancing; it does not support general time-sharing or multi-process jobs using conventional message synchronization and communication. The program utilizes the underlying operating system's resources. TWOS runs a single simulation at a time, executing it concurrently on as many processors of a distributed system as are allocated. The simulation needs only to be decomposed into objects (logical processes) that interact through time-stamped messages. TWOS provides transparent synchronization. The user does not have to add any more special logic to aid in synchronization, nor give any synchronization advice, nor even understand much about how the Time Warp mechanism works. The Time Warp Simulator (TWSIM) subdirectory contains a sequential simulation engine that is interface compatible with TWOS. This means that an application designer and programmer who wish to use TWOS can prototype code on TWSIM on a single processor and/or workstation before having to deal with the complexity of working on a distributed system. TWSIM also provides statistics about the application which may be helpful for determining the correctness of an application and for achieving good performance on TWOS. Version 2.5.1 has an updated interface that is not compatible with 2.0. The program's user manual assists the simulation programmer in the design, coding, and implementation of discrete-event simulations running on TWOS. The manual also includes a practical user's guide to the TWOS application benchmark, Colliding Pucks. TWOS supports simulations written in the C programming language. It is designed

  14. Selecting local constraint for alignment of batch process data with dynamic time warping

    DEFF Research Database (Denmark)

    Spooner, Max Peter; Kold, David; Kulahci, Murat

    2017-01-01

    ” may be interpreted as a progress signature of the batch which may be appended to the aligned data for further analysis. For the warping function to be a realistic reflection of the progress of a batch, it is necessary to impose some constraints on the dynamic time warping algorithm, to avoid...

  15. Asymptotically spacelike warped anti-de Sitter spacetimes in generalized minimal massive gravity

    International Nuclear Information System (INIS)

    Setare, M R; Adami, H

    2017-01-01

    In this paper we show that warped AdS 3 black hole spacetime is a solution of the generalized minimal massive gravity (GMMG) and introduce suitable boundary conditions for asymptotically warped AdS 3 spacetimes. Then we find the Killing vector fields such that transformations generated by them preserve the considered boundary conditions. We calculate the conserved charges which correspond to the obtained Killing vector fields and show that the algebra of the asymptotic conserved charges is given as the semi direct product of the Virasoro algebra with U (1) current algebra. We use a particular Sugawara construction to reconstruct the conformal algebra. Thus, we are allowed to use the Cardy formula to calculate the entropy of the warped black hole. We demonstrate that the gravitational entropy of the warped black hole exactly coincides with what we obtain via Cardy’s formula. As we expect, the warped Cardy formula also gives us exactly the same result as we obtain from the usual Cardy’s formula. We calculate mass and angular momentum of the warped black hole and then check that obtained mass, angular momentum and entropy to satisfy the first law of the black hole mechanics. According to the results of this paper we believe that the dual theory of the warped AdS 3 black hole solution of GMMG is a warped CFT. (paper)

  16. Four-flux and warped heterotic M-theory compactifications

    International Nuclear Information System (INIS)

    Curio, Gottfried; Krause, Axel

    2001-01-01

    In the framework of heterotic M-theory compactified on a Calabi-Yau threefold 'times' an interval, the relation between geometry and four-flux is derived beyond first order. Besides the case with general flux which cannot be described by a warped geometry one is naturally led to consider two special types of four-flux in detail. One choice shows how the M-theory relation between warped geometry and flux reproduces the analogous one of the weakly coupled heterotic string with torsion. The other one leads to a quadratic dependence of the Calabi-Yau volume with respect to the orbifold direction which avoids the problem with negative volume of the first order approximation. As in the first order analysis we still find that Newton's constant is bounded from below at just the phenomenologically relevant value. However, the bound does not require an ad hoc truncation of the orbifold-size any longer. Finally we demonstrate explicitly that to leading order in κ 2/3 no Cosmological constant is induced in the four-dimensional low-energy action. This is in accord with what one can expect from supersymmetry

  17. Warped conformal field theory as lower spin gravity

    Science.gov (United States)

    Hofman, Diego M.; Rollier, Blaise

    2015-08-01

    Two dimensional Warped Conformal Field Theories (WCFTs) may represent the simplest examples of field theories without Lorentz invariance that can be described holographically. As such they constitute a natural window into holography in non-AdS space-times, including the near horizon geometry of generic extremal black holes. It is shown in this paper that WCFTs posses a type of boost symmetry. Using this insight, we discuss how to couple these theories to background geometry. This geometry is not Riemannian. We call it Warped Geometry and it turns out to be a variant of a Newton-Cartan structure with additional scaling symmetries. With this formalism the equivalent of Weyl invariance in these theories is presented and we write two explicit examples of WCFTs. These are free fermionic theories. Lastly we present a systematic description of the holographic duals of WCFTs. It is argued that the minimal setup is not Einstein gravity but an SL (2, R) × U (1) Chern-Simons Theory, which we call Lower Spin Gravity. This point of view makes manifest the definition of boundary for these non-AdS geometries. This case represents the first step towards understanding a fully invariant formalism for WN field theories and their holographic duals.

  18. Modifications to holographic entanglement entropy in warped CFT

    Energy Technology Data Exchange (ETDEWEB)

    Song, Wei; Wen, Qiang; Xu, Jianfei [Yau Mathematical Sciences Center, Tsinghua University,Beijing 100084 (China)

    2017-02-13

    In https://www.doi.org/10.1103/PhysRevLett.117.011602 it was observed that asymptotic boundary conditions play an important role in the study of holographic entanglement beyond AdS/CFT. In particular, the Ryu-Takayanagi proposal must be modified for warped AdS{sub 3} (WAdS{sub 3}) with Dirichlet boundary conditions. In this paper, we consider AdS{sub 3} and WAdS{sub 3} with Dirichlet-Neumann boundary conditions. The conjectured holographic duals are warped conformal field theories (WCFTs), featuring a Virasoro-Kac-Moody algebra. We provide a holographic calculation of the entanglement entropy and Rényi entropy using AdS{sub 3}/WCFT and WAdS{sub 3}/WCFT dualities. Our bulk results are consistent with the WCFT results derived by Castro-Hofman-Iqbal using the Rindler method. Comparing with https://www.doi.org/10.1103/PhysRevLett.117.011602, we explicitly show that the holographic entanglement entropy is indeed affected by boundary conditions. Both results differ from the Ryu-Takayanagi proposal, indicating new relations between spacetime geometry and quantum entanglement for holographic dualities beyond AdS/CFT.

  19. Time warp operating system version 2.7 internals manual

    Science.gov (United States)

    1992-01-01

    The Time Warp Operating System (TWOS) is an implementation of the Time Warp synchronization method proposed by David Jefferson. In addition, it serves as an actual platform for running discrete event simulations. The code comprising TWOS can be divided into several different sections. TWOS typically relies on an existing operating system to furnish some very basic services. This existing operating system is referred to as the Base OS. The existing operating system varies depending on the hardware TWOS is running on. It is Unix on the Sun workstations, Chrysalis or Mach on the Butterfly, and Mercury on the Mark 3 Hypercube. The base OS could be an entirely new operating system, written to meet the special needs of TWOS, but, to this point, existing systems have been used instead. The base OS's used for TWOS on various platforms are not discussed in detail in this manual, as they are well covered in their own manuals. Appendix G discusses the interface between one such OS, Mach, and TWOS.

  20. Gravitational quantum corrections in warped supersymmetric brane worlds

    International Nuclear Information System (INIS)

    Gregoire, T.; Rattazzi, R.; Scrucca, C.A.; Strumia, A.; Trincherini, E.

    2005-01-01

    We study gravitational quantum corrections in supersymmetric theories with warped extra dimensions. We develop for this a superfield formalism for linearized gauged supergravity. We show that the 1-loop effective Kahler potential is a simple functional of the KK spectrum in the presence of generic localized kinetic terms at the two branes. We also present a simple understanding of our results by showing that the leading matter effects are equivalent to suitable displacements of the branes. We then apply this general result to compute the gravity-mediated universal soft mass m 0 2 in models where the visible and the hidden sectors are sequestered at the two branes. We find that the contributions coming from radion mediation and brane-to-brane mediation are both negative in the minimal set-up, but the former can become positive if the gravitational kinetic term localized at the hidden brane has a sizable coefficient. We then compare the features of the two extreme cases of flat and very warped geometry, and give an outlook on the building of viable models

  1. Warped Dipole Completed, with a Tower of Higgs Bosons

    CERN Document Server

    Agashe, Kaustubh; Cui, Yanou; Randall, Lisa; Son, Minho

    2015-01-01

    In the context of warped extra-dimensional models which address both the Planck-weak- and flavor-hierarchies of the Standard Model (SM), it has been argued that certain observables can be calculated within the 5D effective field theory only with the Higgs field propagating in the bulk of the extra dimension, just like other SM fields. The related studies also suggested an interesting form of decoupling of the heavy Kaluza-Klein (KK) fermion states in the warped 5D SM in the limit where the profile of the SM Higgs approaches the IR brane. We demonstrate that a similar phenomenon occurs when we include the mandatory KK excitations of the SM Higgs in loop diagrams giving dipole operators for SM fermions, where the earlier work only considered the SM Higgs (zero mode). In particular, in the limit of a quasi IR-localized SM Higgs, the effect from summing over KK Higgs modes is unsuppressed (yet finite), in contrast to the naive expectation that KK Higgs modes decouple as their masses become large. In this case, a ...

  2. Scales and hierarchies in warped compactifications and brane worlds

    International Nuclear Information System (INIS)

    DeWolfe, Oliver; Giddings, Steven B.

    2003-01-01

    Warped compactifications with branes provide a new approach to the hierarchy problem and generate a diversity of four-dimensional thresholds. We investigate the relationships between these scales, which fall into two classes. Geometrical scales, such as thresholds for Kaluza-Klein, excited string, and black hole production, are generically determined solely by the spacetime geometry. Dynamical scales, notably the scale of supersymmetry breaking and moduli masses, depend on other details of the model. We illustrate these relationships in a class of solutions of type IIB string theory with imaginary self-dual fluxes. After identifying the geometrical scales and the resulting hierarchy, we determine the gravitino and moduli masses through explicit dimensional reduction, and estimate their value to be near the four-dimensional Planck scale. In the process we obtain expressions for the superpotential and Kaehler potential, including the effects of warping. We identify matter living on certain branes to be effectively sequestered from the supersymmetry breaking fluxes: specifically, such 'visible sector' fields receive no tree-level masses from the supersymmetry breaking. However, loop corrections are expected to generate masses, at the phenomenologically viable TeV scale

  3. Warped conformal field theory as lower spin gravity

    Directory of Open Access Journals (Sweden)

    Diego M. Hofman

    2015-08-01

    Full Text Available Two dimensional Warped Conformal Field Theories (WCFTs may represent the simplest examples of field theories without Lorentz invariance that can be described holographically. As such they constitute a natural window into holography in non-AdS space–times, including the near horizon geometry of generic extremal black holes. It is shown in this paper that WCFTs posses a type of boost symmetry. Using this insight, we discuss how to couple these theories to background geometry. This geometry is not Riemannian. We call it Warped Geometry and it turns out to be a variant of a Newton–Cartan structure with additional scaling symmetries. With this formalism the equivalent of Weyl invariance in these theories is presented and we write two explicit examples of WCFTs. These are free fermionic theories. Lastly we present a systematic description of the holographic duals of WCFTs. It is argued that the minimal setup is not Einstein gravity but an SL(2,R×U(1 Chern–Simons Theory, which we call Lower Spin Gravity. This point of view makes manifest the definition of boundary for these non-AdS geometries. This case represents the first step towards understanding a fully invariant formalism for WN field theories and their holographic duals.

  4. Watershed regressions for pesticides (WARP) for predicting atrazine concentration in Corn Belt streams

    Science.gov (United States)

    Stone, Wesley W.; Gilliom, Robert J.

    2011-01-01

    Watershed Regressions for Pesticides (WARP) models, previously developed for atrazine at the national scale, can be improved for application to the U.S. Corn Belt region by developing region-specific models that include important watershed characteristics that are influential in predicting atrazine concentration statistics within the Corn Belt. WARP models for the Corn Belt (WARP-CB) were developed for predicting annual maximum moving-average (14-, 21-, 30-, 60-, and 90-day durations) and annual 95th-percentile atrazine concentrations in streams of the Corn Belt region. All streams used in development of WARP-CB models drain watersheds with atrazine use intensity greater than 17 kilograms per square kilometer (kg/km2). The WARP-CB models accounted for 53 to 62 percent of the variability in the various concentration statistics among the model-development sites.

  5. Nonlinear Gravitational Waves as Dark Energy in Warped Spacetimes

    Directory of Open Access Journals (Sweden)

    Reinoud Jan Slagter

    2017-02-01

    Full Text Available We find an azimuthal-angle dependent approximate wave like solution to second order on a warped five-dimensional manifold with a self-gravitating U(1 scalar gauge field (cosmic string on the brane using the multiple-scale method. The spectrum of the several orders of approximation show maxima of the energy distribution dependent on the azimuthal-angle and the winding numbers of the subsequent orders of the scalar field. This breakup of the quantized flux quanta does not lead to instability of the asymptotic wavelike solution due to the suppression of the n-dependency in the energy momentum tensor components by the warp factor. This effect is triggered by the contribution of the five dimensional Weyl tensor on the brane. This contribution can be understood as dark energy and can trigger the self-acceleration of the universe without the need of a cosmological constant. There is a striking relation between the symmetry breaking of the Higgs field described by the winding number and the SO(2 breaking of the axially symmetric configuration into a discrete subgroup of rotations of about 180 ∘ . The discrete sequence of non-axially symmetric deviations, cancelled by the emission of gravitational waves in order to restore the SO(2 symmetry, triggers the pressure T z z for discrete values of the azimuthal-angle. There could be a possible relation between the recently discovered angle-preferences of polarization axes of quasars on large scales and our theoretical predicted angle-dependency and this could be evidence for the existence of cosmic strings. Careful comparison of this spectrum of extremal values of the first and second order φ-dependency and the distribution of the alignment of the quasar polarizations is necessary. This can be accomplished when more observational data become available. It turns out that, for late time, the vacuum 5D spacetime is conformally invariant if the warp factor fulfils the equation of a vibrating

  6. Supersymmetric warped AdS in extended topologically massive supergravity

    International Nuclear Information System (INIS)

    Deger, N.S.; Kaya, A.; Samtleben, H.; Sezgin, E.

    2014-01-01

    We determine the most general form of off-shell N=(1,1) supergravity field configurations in three dimensions by requiring that at least one off-shell Killing spinor exists. We then impose the field equations of the topologically massive off-shell supergravity and find a class of solutions whose properties crucially depend on the norm of the auxiliary vector field. These are spacelike-squashed and timelike-stretched AdS 3 for the spacelike and timelike norms, respectively. At the transition point where the norm vanishes, the solution is null warped AdS 3 . This occurs when the coefficient of the Lorentz–Chern–Simons term is related to the AdS radius by μℓ=2. We find that the spacelike-squashed AdS 3 can be modded out by a suitable discrete subgroup of the isometry group, yielding an extremal black hole solution which avoids closed timelike curves

  7. Generating a normalized geometric liver model with warping

    International Nuclear Information System (INIS)

    Boes, J.L.; Weymouth, T.E.; Meyer, C.R.; Quint, L.E.; Bland, P.H.; Bookstein, F.L.

    1990-01-01

    This paper reports on the automated determination of the liver surface in abdominal CT scans for radiation treatment, surgery planning, and anatomic visualization. The normalized geometric model of the liver is generated by averaging registered outlines from a set of 15 studies of normal liver. The outlines have been registered with the use of thin-plate spline warping based on a set of five homologous landmarks. Thus, the model consists of an average of the surface and a set of five anatomic landmarks. The accuracy of the model is measured against both the set of studies used in model generation and an alternate set of 15 normal studies with use of, as an error measure, the ratio of nonoverlapping model and study volume to total model volume

  8. PRESENTATION OF AN ARCHITECTURAL OBJECT DESIGNED BY WARPED SURFACES

    Directory of Open Access Journals (Sweden)

    VELJKOVIĆ Milica

    2015-06-01

    Full Text Available Due to the importance of good functional solutions and aesthetic appearance of an object, modeling in architecture is the subject of this study. Application of more modern materials in architecture allows us to perform various geometric surfaces in the production of facade and roof structures. With such complex objects, it is necessary to create detailed three-dimensional models, using some of the modern software package for modeling. This paper provides an example of creating a 3D model of a modern building in whose exterior we can recognize nondevelopmental (becoming warped line-generated surfaces, primarily cylindroids and conoids. The entire process of modeling and presenting an object using augmented reality was carried out using the modern software package for visualization in architecture.

  9. Non-minimally coupled tachyonic inflation in warped string background

    International Nuclear Information System (INIS)

    Chingangbam, Pravabati; Panda, Sudhakar; Deshamukhya, Atri

    2005-01-01

    We show that the non-minimal coupling of tachyon field to the scalar curvature, as proposed by Piao et al, with the chosen coupling parameter does not produce the effective potential where the tachyon field can roll down from T=0 to large T along the slope of the potential. We find a correct choice of the parameters which ensures this requirement and support slow-roll inflation. However, we find that the cosmological parameter found from the analysis of the theory are not in the range obtained from observations. We then invoke warped compactification and varying dilaton field over the compact manifold, as proposed by Raeymaekers, to show that in such a setup the observed parameter space can be ensured. (author)

  10. Effective theories and black hole production in warped compactifications

    International Nuclear Information System (INIS)

    Giddings, Steven B.; Katz, Emanuel

    2001-01-01

    We investigate aspects of the four-dimensional (4D) effective description of brane world scenarios based on warped compactification on anti-de Sitter space. The low-energy dynamics is described by visible matter gravitationally coupled to a ''dark'' conformal field theory. We give the linearized description of the 4D stress tensor corresponding to an arbitrary 5D matter distribution. In particular a 5D falling particle corresponds to a 4D expanding shell, giving a 4D interpretation of a trajectory that misses a black hole only by moving in the fifth dimension. Breakdown of the effective description occurs when either five-dimensional physics or strong gravity becomes important. In scenarios with a TeV brane, the latter can happen through the production of black holes near the TeV scale. This could provide an interesting experimental window on quantum black hole dynamics

  11. Point-based warping with optimized weighting factors of displacement vectors

    Science.gov (United States)

    Pielot, Ranier; Scholz, Michael; Obermayer, Klaus; Gundelfinger, Eckart D.; Hess, Andreas

    2000-06-01

    The accurate comparison of inter-individual 3D image brain datasets requires non-affine transformation techniques (warping) to reduce geometric variations. Constrained by the biological prerequisites we use in this study a landmark-based warping method with weighted sums of displacement vectors, which is enhanced by an optimization process. Furthermore, we investigate fast automatic procedures for determining landmarks to improve the practicability of 3D warping. This combined approach was tested on 3D autoradiographs of Gerbil brains. The autoradiographs were obtained after injecting a non-metabolized radioactive glucose derivative into the Gerbil thereby visualizing neuronal activity in the brain. Afterwards the brain was processed with standard autoradiographical methods. The landmark-generator computes corresponding reference points simultaneously within a given number of datasets by Monte-Carlo-techniques. The warping function is a distance weighted exponential function with a landmark- specific weighting factor. These weighting factors are optimized by a computational evolution strategy. The warping quality is quantified by several coefficients (correlation coefficient, overlap-index, and registration error). The described approach combines a highly suitable procedure to automatically detect landmarks in autoradiographical brain images and an enhanced point-based warping technique, optimizing the local weighting factors. This optimization process significantly improves the similarity between the warped and the target dataset.

  12. Moduli effective action in warped brane-world compactifications

    International Nuclear Information System (INIS)

    Garriga, Jaume; Pujolas, Oriol; Tanaka, Takahiro

    2003-01-01

    We consider a class of 5D brane-world solutions with a power-law warp factor a(y)∝y q , and bulk dilaton with profile phi∝lny, where y is the proper distance in the extra dimension. This class includes the heterotic M-theory brane-world of [Phys. Rev. D 59 (1999) 086001, and] and the Randall-Sundrum (RS) model as a limiting case. In general, there are two moduli fields y ± , corresponding to the 'positions' of two branes (which live at the fixed points of an orbifold compactification). Classically, the moduli are massless, due to a scaling symmetry of the action. However, in the absence of supersymmetry, they develop an effective potential at one loop. Local terms proportional to K ± 4 , where K ± =q/y ± is the local curvature scale at the location of the corresponding brane, are needed in order to remove the divergences in the effective potential. Such terms break the scaling symmetry and hence they may act as stabilizers for the moduli. When the branes are very close to each other, the effective potential induced by massless bulk fields behaves like V∼d -4 , where d is the separation between branes. When the branes are widely separated, the potentials for each one of the moduli generically develop a 'Coleman-Weinberg'-type behaviour of the form a 4 (y ± )K ± 4 ln(K ± /μ ± ), where μ ± are renormalization scales. In the RS case, the bulk geometry is AdS and K ± are equal to a constant, independent of the position of the branes, so these terms do not contribute to the mass of the moduli. However, for generic warp factor, they provide a simple stabilization mechanism. For q > or approx. 10, the observed hierarchy can be naturally generated by this potential, giving the lightest modulus a mass of order m - < or approx. TeV

  13. Innovative monitoring of 3D warp interlock fabric during forming process

    Science.gov (United States)

    Dufour, C.; Jerkovic, I.; Wang, P.; Boussu, F.; Koncar, V.; Soulat, D.; Grancaric, A. M.; Pineau, P.

    2017-10-01

    The final geometry of 3D warp interlock fabric needs to be check during the 3D forming step to ensure the right locations of warp and weft yarns inside the final structure. Thus, a new monitoring approach has been proposed based on sensor yarns located in the fabric thickness. To ensure the accuracy of measurements, the observation of the surface deformation of the 3D warp interlock fabric has been joined to the sensor yarns measurements. At the end, it has been revealed a good correlation between strain measurement done globally by camera and locally performed by sensor yarns.

  14. Quantum tunneling and quasinormal modes in the spacetime of the Alcubierre warp drive

    Science.gov (United States)

    Jusufi, Kimet; Sakallı, İzzet; Övgün, Ali

    2018-01-01

    In a seminal paper, Alcubierre showed that Einstein's theory of general relativity appears to allow a super-luminal motion. In the present study, we use a recent eternal-warp-drive solution found by Alcubierre to study the effect of Hawking radiation upon an observer located within the warp drive in the framework of the quantum tunneling method. We find the same expression for the Hawking temperatures associated with the tunneling of both massive vector and scalar particles, and show this expression to be proportional to the velocity of the warp drive. On the other hand, since the discovery of gravitational waves, the quasinormal modes (QNMs) of black holes have also been extensively studied. With this purpose in mind, we perform a QNM analysis of massive scalar field perturbations in the background of the eternal-Alcubierre-warp-drive spacetime. Our analytical analysis shows that massive scalar perturbations lead to stable QNMs.

  15. Asymptotically warped anti-de Sitter spacetimes in topologically massive gravity

    International Nuclear Information System (INIS)

    Henneaux, Marc; Martinez, Cristian; Troncoso, Ricardo

    2011-01-01

    Asymptotically warped AdS spacetimes in topologically massive gravity with negative cosmological constant are considered in the case of spacelike stretched warping, where black holes have been shown to exist. We provide a set of asymptotic conditions that accommodate solutions in which the local degree of freedom (the ''massive graviton'') is switched on. An exact solution with this property is explicitly exhibited and possesses a slower falloff than the warped AdS black hole. The boundary conditions are invariant under the semidirect product of the Virasoro algebra with a u(1) current algebra. We show that the canonical generators are integrable and finite. When the graviton is not excited, our analysis is compared and contrasted with earlier results obtained through the covariant approach to conserved charges. In particular, we find agreement with the conserved charges of the warped AdS black holes as well as with the central charges in the algebra.

  16. Warping similarity space in category learning by human subjects: the role of task difficulty

    OpenAIRE

    Pevtzow, Rachel; Harnad, Stevan

    1997-01-01

    In innate Categorical Perception (CP) (e.g., colour perception), similarity space is "warped," with regions of increased within-category similarity (compression) and regions of reduced between-category similarity (separation) enh ancing the category boundaries and making categorisation reliable and all-or-none rather than graded. We show that category learning can likewise warp similarity space, resolving uncertainty near category boundaries. Two Hard and two Easy texture learning tasks were ...

  17. Characterization of GCR-lightlike warped product of indefinite Sasakian manifolds

    Directory of Open Access Journals (Sweden)

    Rakesh Kumar

    2014-07-01

    Full Text Available In this paper we prove that there do not exist warped product GCR-lightlike submanifolds in the form M = N⊥ × λNT such that N⊥ is an anti-invariant submanifold tangent to V and NT an invariant submanifold of M‾, other than GCR-lightlike product in an indefinite Sasakian manifold. We also obtain characterization theorems for a GCR-lightlike submanifold to be locally a GCR-lightlike warped product.

  18. Moduli effective action in warped brane-world compactifications

    Energy Technology Data Exchange (ETDEWEB)

    Garriga, Jaume E-mail: garriga@ifae.es; Pujolas, Oriol; Tanaka, Takahiro

    2003-04-07

    We consider a class of 5D brane-world solutions with a power-law warp factor a(y){proportional_to}y{sup q}, and bulk dilaton with profile phi{proportional_to}lny, where y is the proper distance in the extra dimension. This class includes the heterotic M-theory brane-world of [Phys. Rev. D 59 (1999) 086001, and] and the Randall-Sundrum (RS) model as a limiting case. In general, there are two moduli fields y{sub {+-}}, corresponding to the 'positions' of two branes (which live at the fixed points of an orbifold compactification). Classically, the moduli are massless, due to a scaling symmetry of the action. However, in the absence of supersymmetry, they develop an effective potential at one loop. Local terms proportional to K{sub {+-}}{sup 4}, where K{sub {+-}}=q/y{sub {+-}} is the local curvature scale at the location of the corresponding brane, are needed in order to remove the divergences in the effective potential. Such terms break the scaling symmetry and hence they may act as stabilizers for the moduli. When the branes are very close to each other, the effective potential induced by massless bulk fields behaves like V{approx}d{sup -4}, where d is the separation between branes. When the branes are widely separated, the potentials for each one of the moduli generically develop a 'Coleman-Weinberg'-type behaviour of the form a{sup 4}(y{sub {+-}})K{sub {+-}}{sup 4}ln(K{sub {+-}}/{mu}{sub {+-}}), where {mu}{sub {+-}} are renormalization scales. In the RS case, the bulk geometry is AdS and K{sub {+-}} are equal to a constant, independent of the position of the branes, so these terms do not contribute to the mass of the moduli. However, for generic warp factor, they provide a simple stabilization mechanism. For q > or approx. 10, the observed hierarchy can be naturally generated by this potential, giving the lightest modulus a mass of order m{sub -} < or approx. TeV.

  19. Overcoming the Educational Time Warp: Anticipating a Different Future

    Directory of Open Access Journals (Sweden)

    Garry Jacobs

    2015-10-01

    Full Text Available Education abridges the time required for individual and social progress by preserving and propagating the essence of human experience. It delivers to youth the accumulated knowledge of countless past generations in an organized and abridged form, so that future generations can start off with all the capacities acquired by their predecessors. However, today education confronts a serious dilemma. We are living in an educational time warp. There is a growing gap between contemporary human experience and what is taught in our educational system and that gap is widening rapidly with each passing year. Today humanity confronts challenges of unprecedented scope, magnitude and intensity. The incremental development of educational content and pedagogy in recent decades has not kept with the ever-accelerating pace of technological and social evolution. Education is also subject to a generational time warp resulting from the fact that many of today’s teachers were educated decades ago during very different times and based on different values and perspectives. The challenge of preparing youth for the future is exasperated by the fact that the future for which we are educating youth does not yet exist and to a large extent is unknown or unknowable. The resulting gap between the content of education and societal needs inhibits our capacity to anticipate and effectively respond to social problems. All these factors argue for a major reorientation of educational content and pedagogy from transmission of acquired knowledge based on past experience to development of the knowledge, skills and capacities of personality needed in a future we cannot clearly envision. We may not be able to anticipate the precise nature of the future, but we can provide an education based on the understanding that it will be very different from the present. In terms of content, the emphasis needs to shift from facts regarding the actual state of affairs in the past, present and

  20. Evaluation of oil biodegradation using time warping and PCA

    International Nuclear Information System (INIS)

    Christensen, J.H.; Hansen, A.B.; Andersen, O.

    2005-01-01

    The effects of biodegradation on the composition of stranded oil after the Baltic Carrier oil spill in March 2001 was evaluated using a newly developed multivariate statistical methodology. Gas chromatography and mass spectrometry provided data on the oil compounds and oil biodegradation was determined by applying weighted least square principal component analysis to the preprocessed chromatograms of methylphenanthrenes and methyldibenzothiophenes. One principal component explained 46 per cent of the variation in the complete data set. Samples collected immediately after the spill and 2.5 months after the spill did not exhibit changes in isomer composition. However, the isomer patterns changed in samples collected between 6.5 and 16.5 months after the spill. Samples collected after 8.5 months were the most greatly affected. An evaluation of the degradation patterns suggest that time warping and multivariate statistical methods can successfully identify links between spill samples and can determine how chemical composition will respond to biodegradation processes. 27 refs., 1 tab., 3 figs

  1. Evaluation of oil biodegradation using time warping and PCA

    Energy Technology Data Exchange (ETDEWEB)

    Christensen, J.H. [Royal Veterinary and Agricultural Univ., Thorvaldsensvej (Denmark). Dept. of Natural Sciences; Hansen, A.B. [National Environmental Research Inst., Roskilde (Denmark). Dept. of Environmental Chemistry and Microbiology; Andersen, O. [Roskilde Univ., Roskilde (Denmark). Dept. of Life Sciences and Chemistry

    2005-07-01

    The effects of biodegradation on the composition of stranded oil after the Baltic Carrier oil spill in March 2001 was evaluated using a newly developed multivariate statistical methodology. Gas chromatography and mass spectrometry provided data on the oil compounds and oil biodegradation was determined by applying weighted least square principal component analysis to the preprocessed chromatograms of methylphenanthrenes and methyldibenzothiophenes. One principal component explained 46 per cent of the variation in the complete data set. Samples collected immediately after the spill and 2.5 months after the spill did not exhibit changes in isomer composition. However, the isomer patterns changed in samples collected between 6.5 and 16.5 months after the spill. Samples collected after 8.5 months were the most greatly affected. An evaluation of the degradation patterns suggest that time warping and multivariate statistical methods can successfully identify links between spill samples and can determine how chemical composition will respond to biodegradation processes. 27 refs., 1 tab., 3 figs.

  2. On Closed Timelike Curves and Warped Brane World Models

    Directory of Open Access Journals (Sweden)

    Slagter Reinoud Jan

    2013-09-01

    Full Text Available At first glance, it seems possible to construct in general relativity theory causality violating solutions. The most striking one is the Gott spacetime. Two cosmic strings, approaching each other with high velocity, could produce closed timelike curves. It was quickly recognized that this solution violates physical boundary conditions. The effective one particle generator becomes hyperbolic, so the center of mass is tachyonic. On a 5-dimensional warped spacetime, it seems possible to get an elliptic generator, so no obstruction is encountered and the velocity of the center of mass of the effective particle has an overlap with the Gott region. So a CTC could, in principle, be constructed. However, from the effective 4D field equations on the brane, which are influenced by the projection of the bulk Weyl tensor on the brane, it follows that no asymptotic conical space time is found, so no angle deficit as in the 4D counterpart model. This could also explain why we do not observe cosmic strings.

  3. Self-accelerated brane Universe with warped extra dimension

    CERN Document Server

    Gorbunov, D S

    2008-01-01

    We propose a cosmological model which exhibits the phenomenon of self-acceleration: the Universe is attracted to the phase of accelerated expansion at late times even in the absence of the cosmological constant. The self-acceleration is inevitable in the sense that it cannot be neutralized by any negative explicit cosmological constant. The model is formulated in the framework of brane-world theories with a warped extra dimension. The key ingredient of the model is the brane-bulk energy transfer which is carried by bulk vector fields with a sigma-model-like boundary condition on the brane. We explicitly find the 5-dimensional metric corresponding to the late-time de Sitter expansion on the brane; this metric describes an AdS_5 black hole with growing mass. The present value of the Hubble parameter implies the scale of new physics of order 1 TeV, where the proposed model has to be replaced by putative UV-completion. The mechanism leading to the self-acceleration has AdS/CFT interpretation as occurring due to s...

  4. Time-warp invariant pattern detection with bursting neurons

    International Nuclear Information System (INIS)

    Gollisch, Tim

    2008-01-01

    Sound patterns are defined by the temporal relations of their constituents, individual acoustic cues. Auditory systems need to extract these temporal relations to detect or classify sounds. In various cases, ranging from human speech to communication signals of grasshoppers, this pattern detection has been found to display invariance to temporal stretching or compression of the sound signal ('linear time-warp invariance'). In this work, a four-neuron network model is introduced, designed to solve such a detection task for the example of grasshopper courtship songs. As an essential ingredient, the network contains neurons with intrinsic bursting dynamics, which allow them to encode durations between acoustic events in short, rapid sequences of spikes. As shown by analytical calculations and computer simulations, these neuronal dynamics result in a powerful mechanism for temporal integration. Finally, the network reads out the encoded temporal information by detecting equal activity of two such bursting neurons. This leads to the recognition of rhythmic patterns independent of temporal stretching or compression

  5. Axion monodromy inflation with warped KK-modes

    Energy Technology Data Exchange (ETDEWEB)

    Hebecker, Arthur; Moritz, Jakob; Witkowski, Lukas T. [Heidelberg Univ. (Germany). Inst. for Theoretical Physics; Westphal, Alexander [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2015-12-15

    We present a particularly simple model of axion monodromy inflation: Our axion is the lowest-lying KK-mode of the RR-2-form-potential C{sub 2} in the standard Klebanov-Strassler throat. One can think of this inflaton candidate as being defined by the integral of C{sub 2} over the S{sup 2} cycle of the throat. It obtains an exponentially small mass from the IR-region in which the S{sup 2} shrinks to zero size. Crucially, the S{sup 2} cycle has to be shared between two throats, such that the second locus where the S{sup 2} shrinks is also in a warped region. Well-known problems like the potentially dangerous back-reaction of brane/antibrane pairs and explicit supersymmetry breaking are not present in our scenario. The inflaton back-reaction on the geometry turns out to be controlled by the string coupling g{sub s}. We hope that our setting is simple enough for many critical consistency issues of large-field inflation in string theory to be addressed at a quantitative level.

  6. Higgsless theory of electroweak symmetry breaking from warped space

    International Nuclear Information System (INIS)

    Nomura, Yasunori

    2003-01-01

    We study a theory of electroweak symmetry breaking without a Higgs boson, recently suggested by Csaki et al. The theory is formulated in 5D warped space with the gauge bosons and matter fields propagating in the bulk. In the 4D dual picture, the theory appears as the standard model without a Higgs field, but with an extra gauge group G which becomes strong at the TeV scale. The strong dynamics of G breaks the electroweak symmetry, giving the masses for the W and Z bosons and the quarks and leptons. We study corrections in 5D which are logarithmically enhanced by the large mass ratio between the Planck and weak scales, and show that they do not destroy the structure of the electroweak gauge sector at the leading order. We introduce a new parameter, the ratio between the two bulk gauge couplings, into the theory and find that it allows us to control the scale of new physics. We also present a potentially realistic theory accommodating quarks and leptons and discuss its implications, including the violation of universality in the W and Z boson couplings to matter and the spectrum of the Kaluza-Klein excitations of the gauge bosons. The theory reproduces many successful features of the standard model, although some cancellations may still be needed to satisfy constraints from the precision electroweak data. (author)

  7. Axion monodromy inflation with warped KK-modes

    International Nuclear Information System (INIS)

    Hebecker, Arthur; Moritz, Jakob; Witkowski, Lukas T.

    2015-12-01

    We present a particularly simple model of axion monodromy inflation: Our axion is the lowest-lying KK-mode of the RR-2-form-potential C 2 in the standard Klebanov-Strassler throat. One can think of this inflaton candidate as being defined by the integral of C 2 over the S 2 cycle of the throat. It obtains an exponentially small mass from the IR-region in which the S 2 shrinks to zero size. Crucially, the S 2 cycle has to be shared between two throats, such that the second locus where the S 2 shrinks is also in a warped region. Well-known problems like the potentially dangerous back-reaction of brane/antibrane pairs and explicit supersymmetry breaking are not present in our scenario. The inflaton back-reaction on the geometry turns out to be controlled by the string coupling g s . We hope that our setting is simple enough for many critical consistency issues of large-field inflation in string theory to be addressed at a quantitative level.

  8. Axion monodromy inflation with warped KK-modes

    Science.gov (United States)

    Hebecker, Arthur; Moritz, Jakob; Westphal, Alexander; Witkowski, Lukas T.

    2016-03-01

    We present a particularly simple model of axion monodromy inflation: Our axion is the lowest-lying KK-mode of the RR-2-form-potential C2 in the standard Klebanov-Strassler throat. One can think of this inflaton candidate as being defined by the integral of C2 over the S2 cycle of the throat. It obtains an exponentially small mass from the IR-region in which the S2 shrinks to zero size. Crucially, the S2 cycle has to be shared between two throats, such that the second locus where the S2 shrinks is also in a warped region. Well-known problems like the potentially dangerous back-reaction of brane/antibrane pairs and explicit supersymmetry breaking are not present in our scenario. The inflaton back-reaction on the geometry turns out to be controlled by the string coupling gs. We hope that our setting is simple enough for many critical consistency issues of large-field inflation in string theory to be addressed at a quantitative level.

  9. Induced cosmological constant in braneworlds with warped internal spaces

    International Nuclear Information System (INIS)

    Saharian, Aram A.

    2006-01-01

    We investigate the vacuum energy density induced by quantum fluctuations of a bulk scalar field with general curvature coupling parameter on two codimension one parallel branes in a (D + 1)-dimensional background spacetime AdS D1+1 x Σ with a warped internal space Σ. It is assumed that on the branes the field obeys Robin boundary conditions. Using the generalized zeta function technique in combination with contour integral representations, the surface energies on the branes are presented in the form of the sums of single brane and second brane induced parts. For the geometry of a single brane both regions, on the left (L-region) and on the right (R-region), of the brane are considered. The surface densities for separate L- and R-regions contain pole and finite contributions. For an infinitely thin brane taking these regions together, in odd spatial dimensions the pole parts cancel and the total surface energy is finite. The parts in the surface densities generated by the presence of the second brane are finite for all nonzero values of the interbrane separation. The contribution of the Kaluza-Klein modes along Σ is investigated in various limiting cases. It is shown that for large distances between the branes the induced surface densities give rise to an exponentially suppressed cosmological constant on the brane. In the higher dimensional generalization of the Randall-Sundrum braneworld model, for the interbrane distances solving the hierarchy problem, the cosmological constant generated on the visible brane is of the right order of magnitude with the value suggested by the cosmological observations. (author)

  10. Non-linear dynamics in galactic disks: the spiral-warps connection

    International Nuclear Information System (INIS)

    Masset, Frederic

    1997-01-01

    After a recall on warp theories and on warp waves, this research thesis reports a linear study of warp waves with an assessment of the role of gas compressibility when taking the galactic disk thickness into account. Then, the author reports an analytical study of the non-linear coupling between warp waves and density waves, in order to calculate coupling efficiency, to identify areas of the galactic disk in which it is efficient, and to discuss concurrent physical processes (such as Landau absorption) and the validity of assumptions made to perform the calculations. The next part reports numerical simulations which have been performed to check the coupling mechanism. The author notably comments evolutions brought to existing codes, and finally presents the three-dimensional version of the developed code, and discusses choices made for this code (presence of gas, choice of hydrodynamics algorithms and of gas mesh geometry, and so on). Numerical results are then presented and discussed: they actually show the existence of a coupling between density waves and warp waves [fr

  11. Experimental Investigation About Stamping Behaviour of 3D Warp Interlock Composite Preforms

    Science.gov (United States)

    Dufour, Clément; Wang, Peng; Boussu, François; Soulat, Damien

    2014-10-01

    Forming of continuous fibre reinforcements and thermoplastic resin commingled prepregs can be performed at room temperature due to its similar textile structure. The "cool" forming stage is better controlled and more economical. The increase of temperature and the resin consolidation phases after the forming can be carried out under the isothermal condition thanks to a closed system. It can avoid the manufacturing defects easily experienced in the non-isothermal thermoforming, in particular the wrinkling [1]. Glass/Polypropylene commingled yarns have been woven inside different three-dimensional (3D) warp interlock fabrics and then formed using a double-curved shape stamping tool. The present study investigates the in-plane and through-thickness behaviour of the 3D warp interlock fibrous reinforcements during forming with a hemispherical punch. Experimental data allow analysing the forming behaviour in the warp and weft directions and on the influence of warp interlock architectures. The results point out that the layer to layer warp interlock preform has a better stamping behaviour, in particular no forming defects and good homogeneity in thickness.

  12. Warped Discrete Cosine Transform-Based Low Bit-Rate Block Coding Using Image Downsampling

    Directory of Open Access Journals (Sweden)

    Ertürk Sarp

    2007-01-01

    Full Text Available This paper presents warped discrete cosine transform (WDCT-based low bit-rate block coding using image downsampling. While WDCT aims to improve the performance of conventional DCT by frequency warping, the WDCT has only been applicable to high bit-rate coding applications because of the overhead required to define the parameters of the warping filter. Recently, low bit-rate block coding based on image downsampling prior to block coding followed by upsampling after the decoding process is proposed to improve the compression performance for low bit-rate block coders. This paper demonstrates that a superior performance can be achieved if WDCT is used in conjunction with image downsampling-based block coding for low bit-rate applications.

  13. Trigonal warping and photo-induced effects on zone boundary phonon in monolayer graphene

    Science.gov (United States)

    Akay, D.

    2018-05-01

    We have reported the electronic band structure of monolayer graphene when the combined effects arising from the trigonal warp and highest zone-boundary phonons having A1 g symmetry with Haldane interaction which induced photo-irradiation effect. On the basis of our model, we have introduced a diagonalization to solve the associated Fröhlich Hamiltonian. We have examined that, a trigonal warping effect is introduced on the K and K ' points, leading to a dynamical band gap in the graphene electronic band spectrum due to the electron-A1 g phonon interaction and Haldane mass interaction. Additionally, the bands exhibited an anisotropy at this point. It is also found that, photo-irradiation effect is quite smaller than the trigonal warp effects in the graphene electronic band spectrum. In spite of this, controllability of the photo induced effects by the Haldane mass will have extensive implications in the graphene.

  14. Stability of warped AdS3 vacua of topologically massive gravity

    International Nuclear Information System (INIS)

    Anninos, Dionysios; Esole, Mboyo; Guica, Monica

    2009-01-01

    AdS 3 vacua of topologically massive gravity (TMG) have been shown to be perturbatively unstable for all values of the coupling constant except the chiral point μl = 1. We study the possibility that the warped vacua of TMG, which exist for all values of μ, are stable under linearized perturbations. In this paper, we show that spacelike warped AdS 3 vacua with Compere-Detournay boundary conditions are indeed stable in the range μl>3. This is precisely the range in which black hole solutions arise as discrete identifications of the warped AdS 3 vacuum. The situation somewhat resembles chiral gravity: although negative energy modes do exist, they are all excluded by the boundary conditions, and the perturbative spectrum solely consists of boundary (pure large gauge) gravitons.

  15. Computer-Aided Design Method of Warp-Knitted Jacquard Spacer Fabrics

    Directory of Open Access Journals (Sweden)

    Li Xinxin

    2016-06-01

    Full Text Available Based on a further study on knitting and jacquard principles, this paper presents a mathematical design model to make computer-aided design of warp-knitted jacquard spacer fabrics more efficient. The mathematical model with matrix method employs three essential elements of chain notation, threading and Jacquard designing. With this model, the processing to design warp-knitted jacquard spacer fabrics with CAD software is also introduced. In this study, the sports shoes which have separated functional areas according to the feet structure and characteristics of movement are analysed. The results show the different patterns on Jacquard spacer fabrics that are seamlessly stitched with jacquard technics. The computer-aided design method of warp-knitted jacquard spacer fabrics is efficient and simple.

  16. Surface charge conductivity of a topological insulator in a magnetic field: The effect of hexagonal warping

    Science.gov (United States)

    Akzyanov, R. S.; Rakhmanov, A. L.

    2018-02-01

    We investigate the influence of hexagonal warping on the transport properties of topological insulators. We study the charge conductivity within Kubo formalism in the first Born approximation using low-energy expansion of the Hamiltonian near the Dirac point. The effects of disorder, magnetic field, and chemical-potential value are analyzed in detail. We find that the presence of hexagonal warping significantly affects the conductivity of the topological insulator. In particular, it gives rise to the growth of the longitudinal conductivity with the increase of the disorder and anisotropic anomalous in-plane magnetoresistance. Hexagonal warping also affects the quantum anomalous Hall effect and anomalous out-of-plane magnetoresistance. The obtained results are consistent with the experimental data.

  17. Recycling of warp size materials and comparison of yarn mechanical properties sized with recycled materials and virgin materials

    NARCIS (Netherlands)

    Maqsood, Muhammad

    2017-01-01

    Warp sizing is an established method for improving the weaveability of textile yarns by coating or impregnating warp yarns with a polymer that improves the efficiency of the weaving operation. Despite its high cost, polyvinyl alcohol (PVA) normally shows better adhesion to fibers than other sizing

  18. Application of dynamical system methods to galactic dynamics : from warps to double bars

    OpenAIRE

    Sánchez Martín, Patricia

    2015-01-01

    Most galaxies have a warped shape when they are seen from an edge-on point of view. In this work we apply dynamical system methods to find an explanation of this phenomenon that agrees with its abundance among galaxies, its persistence in time and the angular size of observed warps. Starting from a simple, but realistic, 3D galaxy model formed by a bar and a flat disc, we study the effect produced by a small misalignment between the angular momentum of the system and its angular velocity. ...

  19. Warped Linear Prediction of Physical Model Excitations with Applications in Audio Compression and Instrument Synthesis

    Science.gov (United States)

    Glass, Alexis; Fukudome, Kimitoshi

    2004-12-01

    A sound recording of a plucked string instrument is encoded and resynthesized using two stages of prediction. In the first stage of prediction, a simple physical model of a plucked string is estimated and the instrument excitation is obtained. The second stage of prediction compensates for the simplicity of the model in the first stage by encoding either the instrument excitation or the model error using warped linear prediction. These two methods of compensation are compared with each other, and to the case of single-stage warped linear prediction, adjustments are introduced, and their applications to instrument synthesis and MPEG4's audio compression within the structured audio format are discussed.

  20. Technical Note: The impact of deformable image registration methods on dose warping.

    Science.gov (United States)

    Qin, An; Liang, Jian; Han, Xiao; O'Connell, Nicolette; Yan, Di

    2018-03-01

    The purpose of this study was to investigate the clinical-relevant discrepancy between doses warped by pure image based deformable image registration (IM-DIR) and by biomechanical model based DIR (BM-DIR) on intensity-homogeneous organs. Ten patients (5Head&Neck, 5Prostate) were included. A research DIR tool (ADMRIE_v1.12) was utilized for IM-DIR. After IM-DIR, BM-DIR was carried out for organs (parotids, bladder, and rectum) which often encompass sharp dose gradient. Briefly, high-quality tetrahedron meshes were generated and deformable vector fields (DVF) from IM-DIR were interpolated to the surface nodes of the volume meshes as boundary condition. Then, a FEM solver (ABAQUS_v6.14) was used to simulate the displacement of internal nodes, which were then interpolated to image-voxel grids to get the more physically plausible DVF. Both geometrical and subsequent dose warping discrepancies were quantified between the two DIR methods. Target registration discrepancy(TRD) was evaluated to show the geometry difference. The re-calculated doses on second CT were warped to the pre-treatment CT via two DIR. Clinical-relevant dose parameters and γ passing rate were compared between two types of warped dose. The correlation was evaluated between parotid shrinkage and TRD/dose discrepancy. The parotid shrunk to 75.7% ± 9% of its pre-treatment volume and the percentage of volume with TRD>1.5 mm) was 6.5% ± 4.7%. The normalized mean-dose difference (NMDD) of IM-DIR and BM-DIR was -0.8% ± 1.5%, with range (-4.7% to 1.5%). 2 mm/2% passing rate was 99.0% ± 1.4%. A moderate correlation was found between parotid shrinkage and TRD and NMDD. The bladder had a NMDD of -9.9% ± 9.7%, with BM-DIR warped dose systematically higher. Only minor deviation was observed for rectum NMDD (0.5% ± 1.1%). Impact of DIR method on treatment dose warping is patient and organ-specific. Generally, intensity-homogeneous organs, which undergo larger deformation/shrinkage during

  1. Thermodynamic stability of warped AdS{sub 3} black holes

    Energy Technology Data Exchange (ETDEWEB)

    Birmingham, Danny, E-mail: dbirmingham@pacific.ed [Department of Physics, University of the Pacific, Stockton, CA 95211 (United States); Mokhtari, Susan, E-mail: susan@science.csustan.ed [Department of Physics, California State University Stanislaus, Turlock, CA 95382 (United States)

    2011-02-21

    We study the thermodynamic stability of warped black holes in three-dimensional topologically massive gravity. The spacelike stretched black hole is parametrized by its mass and angular momentum. We determine the local and global stability properties in the canonical and grand canonical ensembles. The presence of a Hawking-Page type transition is established, and the critical temperature is determined. The thermodynamic metric of Ruppeiner is computed, and the curvature is shown to diverge in the extremal limit. The consequences of these results for the classical stability properties of warped black holes are discussed within the context of the correlated stability conjecture.

  2. Guide for 3D WARP simulations of hollow electron beam lenses. Practical explanation on basis of Tevatron electron lens test stand

    Energy Technology Data Exchange (ETDEWEB)

    Moens, Vince [Ecole Polytechnique Federale de Lausanne (EPFL) (Switzerland)

    2014-06-08

    The purpose of this guide is to help successive students handle WARP. It outlines the installation of WARP on personal computers as well as super-computers and clusters. It furthermore teaches the reader how to handle the WARP environment and run basic scripts. Lastly it outlines how to execute the current Hollow Electron Beam Lens scripts.

  3. An image-warping architecture for VR : low latency versus image quality

    NARCIS (Netherlands)

    Smit, F.A.; Liere, van R.; Beck, S.; Fröhlich, B.; Steed, A.; Reiners, D.; Lindeman, R.W.

    2009-01-01

    Designing low end-to-end latency system architectures for virtual reality is still an open and challenging problem. We describe the design, implementation and evaluation of a client-server depth-image warping architecture that updates and displays the scene graph at the refresh rate of the display.

  4. Development of seersucker fabrics using single warp beam and modelling of their stretch-recovery behaviour

    NARCIS (Netherlands)

    Maqsood, Muhammad

    2014-01-01

    Seersucker is a thin and puckered fabric used to make clothing for spring. Due to its specific structure, this fabric is held away from the skin when worn, facilitating heat dissipation and air circulation. Seersucker is produced by slack tension weaving using two warp beams. Due to the use of two

  5. Resistance of i-beams in warping torsion with account for the development of plasticdeformations

    Directory of Open Access Journals (Sweden)

    Tusnin Aleksandr Romanovich

    2014-01-01

    Full Text Available Torsion of thin-walled open-section beams due to restrained warping displacements of cross-section is causing additional stresses, which make a significant contribution to the total stress. Due to plastic deformation there are certain reserves of bearing capacity, identification of which is of significant practical interest. The existing normative documents for the design of steel structures in Russia do not include design factor taking into account the development of plastic deformation during warping torsion. The analysis of thin-walled open-section members with plastic deformation will more accurately determine their load-bearing capacity and requires further research. Reserves of the beams bearing capacity due to the development of plastic deformations are revealed when beams are influenced by bending, as well as tension and compression. The existing methodology of determining these reserves and the plastic shape factor in bending was reviewed. This has allowed understanding how it was possible to solve this problem for warping torsion members and outline possible ways of theoretical studies of the bearing capacity in warping torsion. The authors used theoretical approach in determining this factor for the symmetric I-section beam under the action of bimoment and gave recommendations for the design of torsion members including improved value of plastic shape factor.

  6. Remarks on the high-energy behavior of string scattering amplitudes in warped spacetimes. II

    International Nuclear Information System (INIS)

    Andreev, Oleg

    2005-01-01

    We study the Regge limit of string amplitudes within the model of Polchinski-Strassler for string scattering in warped spacetimes. We also present some numerical estimations of the Regge slopes and intercepts. It is quite remarkable that the real values of those are inside a range of ours

  7. Parallel translation in warped product spaces: application to the Reissner-Nordstroem spacetime

    International Nuclear Information System (INIS)

    Raposo, A P; Del Riego, L

    2005-01-01

    A formal treatment of the parallel translation transformations in warped product manifolds is presented and related to those parallel translation transformations in each of the factor manifolds. A straightforward application to the Schwarzschild and Reissner-Nordstroem geometries, considered here as particular examples, explains some apparently surprising properties of the holonomy in these manifolds

  8. A Concurrent Implementation of the Cascade-Correlation Algorithm, Using the Time Warp Operating System

    Science.gov (United States)

    Springer, P.

    1993-01-01

    This paper discusses the method in which the Cascade-Correlation algorithm was parallelized in such a way that it could be run using the Time Warp Operating System (TWOS). TWOS is a special purpose operating system designed to run parellel discrete event simulations with maximum efficiency on parallel or distributed computers.

  9. Gravitons in multiply warped scenarios: At 750 GeV and beyond

    Indian Academy of Sciences (India)

    Mathew Thomas Arun

    2017-06-05

    Jun 5, 2017 ... the parameter space that can be probed at the 14 TeV run of the LHC. We also ... attempted a RS-graviton interpretation (in a later update, ... The remainder of this paper is organized as follows: ... Six dimensions, four branes and nested warping ..... problem at hand, the construction presented below is.

  10. Cotton/polyester and cotton/nylon warp knitted terry cloth: Why ...

    African Journals Online (AJOL)

    Administrator

    1994:68) and has the added advantage of enhanced durability because of the synthetic component that can be incorporated into the structure (Kadolph &. Langford, 2002:41). In practice, the ground yarns of warp knitted terry cloth fabrics often differ in composi- tion to the yarns of the pile (Miller, 1992:109, Wooten,. 1979).

  11. Low-scale gravity mediation in warped extra dimension and collider ...

    Indian Academy of Sciences (India)

    We propose a new scenario of gravity-mediated supersymmetry breaking (gravity mediation) in a supersymmetric Randall-Sundrum model, where the gravity mediation takes place at a low scale due to the warped metric. We investigate collider phenomenology involving the hidden sector field, and find a possibility that the ...

  12. The Stars and Gas in Outer Parts of Galaxy Disks : Extended or Truncated, Flat or Warped?

    NARCIS (Netherlands)

    van der Kruit, P. C.; Funes, JG; Corsini, EM

    2008-01-01

    I review observations of truncations of stellar disks and models for their origin, compare observations of truncations in moderately inclined galaxies to those in edge-on systems and discuss the relation between truncations and H I-warps and their systematics and origin. Truncations are a common

  13. Similarities and Differences Between Warped Linear Prediction and Laguerre Linear Prediction

    NARCIS (Netherlands)

    Brinker, Albertus C. den; Krishnamoorthi, Harish; Verbitskiy, Evgeny A.

    2011-01-01

    Linear prediction has been successfully applied in many speech and audio processing systems. This paper presents the similarities and differences between two classes of linear prediction schemes, namely, Warped Linear Prediction (WLP) and Laguerre Linear Prediction (LLP). It is shown that both

  14. Osserman and conformally Osserman manifolds with warped and twisted product structure

    OpenAIRE

    Brozos-Vazquez, M.; Garcia-Rio, E.; Vazquez-Lorenzo, R.

    2008-01-01

    We characterize Osserman and conformally Osserman Riemannian manifolds with the local structure of a warped product. By means of this approach we analyze the twisted product structure and obtain, as a consequence, that the only Osserman manifolds which can be written as a twisted product are those of constant curvature.

  15. Transverse Slicing of the Sixth-Seventh Costal Cartilaginous Junction: A Novel Technique to Prevent Warping in Nasal Surgery.

    Science.gov (United States)

    Teshima, Tara Lynn; Cheng, Homan; Pakdel, Amir; Kiss, Alex; Fialkov, Jeffrey A

    2016-01-01

    Costal cartilage is an important reconstructive tissue for correcting nasal deformities. Warping of costal cartilage, a recognized complication, can lead to significant functional and aesthetic problems. The authors present a technique to prevent warping that involves transverse slicing of the sixth-seventh costal cartilaginous junction, that when sliced perpendicular to the long axis of the rib, provides multiple long, narrow, clinically useful grafts with balanced cross-sections. The aim was to measure differences in cartilage warp between this technique (TJS) and traditional carving techniques. Costal cartilage was obtained from human subjects and cut to clinically relevant dimensions using a custom cutting jig. The sixth-seventh costal cartilaginous junction was sliced transversely leaving the outer surface intact. The adjacent sixth rib cartilage was carved concentrically and eccentrically. The samples were incubated and standardized serial photography was performed over time up to 4 weeks. Warp was quantified by measuring nonlinearity of the grafts using least-squares regression and compared between carving techniques. TJS grafts (n = 10) resulted in significantly less warp than both eccentrically (n = 3) and concentrically carved grafts (n = 3) (P < 0.0001). Warp was significantly higher with eccentric carving compared with concentric carving (P < 0.0001). Warp increased significantly with time for both eccentric (P = 0002) and concentric (P = 0.0007) techniques while TJS warp did not (P = 0.56). The technique of transverse slicing costal cartilage from the sixth-seventh junction minimizes warp compared with traditional carving methods providing ample grafts of adequate length and versatility for reconstructive requirements.

  16. Status report on the 'Merging' of the Electron-Cloud Code POSINST with the 3-D Accelerator PIC CODE WARP

    International Nuclear Information System (INIS)

    Vay, J.-L.; Furman, M.A.; Azevedo, A.W.; Cohen, R.H.; Friedman, A.; Grote, D.P.; Stoltz, P.H.

    2004-01-01

    We have integrated the electron-cloud code POSINST [1] with WARP [2]--a 3-D parallel Particle-In-Cell accelerator code developed for Heavy Ion Inertial Fusion--so that the two can interoperate. Both codes are run in the same process, communicate through a Python interpreter (already used in WARP), and share certain key arrays (so far, particle positions and velocities). Currently, POSINST provides primary and secondary sources of electrons, beam bunch kicks, a particle mover, and diagnostics. WARP provides the field solvers and diagnostics. Secondary emission routines are provided by the Tech-X package CMEE

  17. Moisture Comfort and Antibacterial Properties of Elastic Warp-Knitted Fabrics

    Directory of Open Access Journals (Sweden)

    Yu Zhi-Cai

    2015-03-01

    Full Text Available Multifunction elastic warp-knitted fabrics were fabricated on a crochet machine with the use of metal composite yarns/viscose yarn and bamboo polyester/ crisscross-section polyester hybrid yarns as the front face and back face of the knitted fabric structure, respectively. We investigated the effect of the blend ratio of bamboo charcoal/ crisscross-section polyester multiply yarns on the fabric's moisture comfort properties, such as water vapour transmission (WVT, water evaporation rate (WER, and water absorbency. The results showed that blending ratio significantly influenced WVT and WER. Moreover, antibacterial activity of the elastic warp- knitted fabric was tested against Staphylococcus aureus and Escherichia coli in accordance with AATCC 90-2011. Finally, the extension- stress value curves were used to analyse the elastic stretching property, and the fabric exhibited greater breaking elongation and lower stress value in the walewise than in the weft direction.

  18. Object-based warping: an illusory distortion of space within objects.

    Science.gov (United States)

    Vickery, Timothy J; Chun, Marvin M

    2010-12-01

    Visual objects are high-level primitives that are fundamental to numerous perceptual functions, such as guidance of attention. We report that objects warp visual perception of space in such a way that spatial distances within objects appear to be larger than spatial distances in ground regions. When two dots were placed inside a rectangular object, they appeared farther apart from one another than two dots with identical spacing outside of the object. To investigate whether this effect was object based, we measured the distortion while manipulating the structure surrounding the dots. Object displays were constructed with a single object, multiple objects, a partially occluded object, and an illusory object. Nonobject displays were constructed to be comparable to object displays in low-level visual attributes. In all cases, the object displays resulted in a more powerful distortion of spatial perception than comparable non-object-based displays. These results suggest that perception of space within objects is warped.

  19. Research on the relationship between viscoelasticity and shock isolation performance of warp knitted spacer fabrics

    Directory of Open Access Journals (Sweden)

    Jin JIANG

    2016-04-01

    Full Text Available Warp-knitted spacer fabric which is commonly used in impact protection is selected as test materials to study the relationship between viscoelasticity and the performance of shock isolation. A damping test platform is built to test different specifications of warp-knitted spacer fabric including compression elastic modulus, damping ratio and the residual impact load under different impact speed. Experimental results show that there is no clear correlation between the shock isolation performance and the viscidity or the elasticity. Accordingly, viscosity-to-elasticity ratio is proposed to characterize the relationship between viscoelasticity and shock isolation performance, and it is found that appropriate viscosity-to-elasticity ratio within a certain range can help to achieve better shock isolation performance.

  20. Is it sensible to “deform” dose? 3D experimental validation of dose-warping

    International Nuclear Information System (INIS)

    Yeo, U. J.; Taylor, M. L.; Supple, J. R.; Smith, R. L.; Dunn, L.; Kron, T.; Franich, R. D.

    2012-01-01

    Purpose: Strategies for dose accumulation in deforming anatomy are of interest in radiotherapy. Algorithms exist for the deformation of dose based on patient image sets, though these are sometimes contentious because not all such image calculations are constrained by physical laws. While tumor and organ motion has been a key area of study for a considerable amount of time, deformation is of increasing interest. In this work, we demonstrate a full 3D experimental validation of results from a range of dose deformation algorithms available in the public domain. Methods: We recently developed the first tissue-equivalent, full 3D deformable dosimetric phantom—“DEFGEL.” To assess the accuracy of dose-warping based on deformable image registration (DIR), we have measured doses in undeformed and deformed states of the DEFGEL dosimeter and compared these to planned doses and warped doses. In this way we have directly evaluated the accuracy of dose-warping calculations for 11 different algorithms. We have done this for a range of stereotactic irradiation schemes and types and magnitudes of deformation. Results: The original Horn and Schunck algorithm is shown to be the best performing of the 11 algorithms trialled. Comparing measured and dose-warped calculations for this method, it is found that for a 10 × 10 mm 2 square field, γ 3%/3mm = 99.9%; for a 20 × 20 mm 2 cross-shaped field, γ 3%/3mm = 99.1%; and for a multiple dynamic arc (0.413 cm 3 PTV) treatment adapted from a patient treatment plan, γ 3%/3mm = 95%. In each case, the agreement is comparable to—but consistently ∼1% less than—comparison between measured and calculated (planned) dose distributions in the absence of deformation. The magnitude of the deformation, as measured by the largest displacement experienced by any voxel in the volume, has the greatest influence on the accuracy of the warped dose distribution. Considering the square field case, the smallest deformation (∼9 mm) yields

  1. PRACTICAL CONTRIBUTIONS TO THE STUDY OF RESISTANCE ASSEMBLIES MADE WITH WARP KNITS

    OpenAIRE

    OANA Ioan-Pavel; OANA Dorina

    2014-01-01

    Based on the principle that a body to be obtained by sewing the material to provide resistance and the like in the stitching assembly, the experimental study of which developed resistance is compared with the resistance materials to effectively assembled by the assembly line. The experimental values resistance for assemblies were obtained in the testing for resistance to sliding stitch ASTM D 434 using Tinius Olsen HK5T test type machine. The assembly strength was determined for warp knit...

  2. A non-minimally coupled quintom dark energy model on the warped DGP brane

    International Nuclear Information System (INIS)

    Nozari, K; Azizi, T; Setare, M R; Behrouz, N

    2009-01-01

    We construct a quintom dark energy model with two non-minimally coupled scalar fields, one quintessence and the other phantom field, confined to the warped Dvali-Gabadadze-Porrati (DGP) brane. We show that this model accounts for crossing of the phantom divide line in appropriate subspaces of the model parameter space. This crossing occurs for both normal and self-accelerating branches of this DGP-inspired setup.

  3. Valley polarization due to trigonal warping on tunneling electrons in graphene

    International Nuclear Information System (INIS)

    Pereira Jr, J M; Peeters, F M; Costa Filho, R N; Farias, G A

    2009-01-01

    The effect of trigonal warping on the transmission of electrons tunneling through potential barriers in graphene is investigated. We present calculations of the transmission coefficient for single and double barriers as a function of energy, incidence angle and barrier heights. The results show remarkable valley-dependent directional effects for barriers oriented parallel to the armchair or parallel to the zigzag direction. These results indicate that electrostatic gates can be used as valley filters in graphene-based devices.

  4. Two-step flash light sintering of copper nanoparticle ink to remove substrate warping

    Energy Technology Data Exchange (ETDEWEB)

    Ryu, Chung-Hyeon; Joo, Sung-Jun [Department of Mechanical Convergence Engineering, Hanyang University, Haengdang-dong, Seongdong-gu, Seoul 133-791 (Korea, Republic of); Kim, Hak-Sung, E-mail: kima@hanyang.ac.kr [Department of Mechanical Convergence Engineering, Hanyang University, Haengdang-dong, Seongdong-gu, Seoul 133-791 (Korea, Republic of); Institute of Nano Science and Technology, Hanyang University, Seoul, 133-791 (Korea, Republic of)

    2016-10-30

    Highlights: • We performed the two-step flash light sintering for copper nanoparticle ink to remove substrate warping. • 12 J/cm{sup 2} of preheating and 7 J/cm{sup 2} of main sintering energies were determined as optimum conditions to sinter the copper nanoparticle ink. • The resistivity of two-step sintered copper nanoparticle ink was 3.81 μΩ cm with 5B adhesion level, 2.3 times greater than that of bulk copper. • The two-step sintered case showed a high conductivity without any substrate warping. - Abstract: A two-step flash light sintering process was devised to reduce the warping of polymer substrates during the sintering of copper nanoparticle ink. To determine the optimum sintering conditions of the copper nanoparticle ink, the flash light irradiation conditions (pulse power, pulse number, on-time, and off-time) were varied and optimized. In order to monitor the flash light sintering process, in situ resistance and temperature monitoring of copper nanoink were conducted during the flash light sintering process. Also, a transient heat transfer analysis was performed by using the finite-element program ABAQUS to predict the temperature changes of copper nanoink and polymer substrate. The microstructures of the sintered copper nanoink films were analyzed by scanning electron microscopy. Additionally, an X-ray diffraction and Fourier transform infrared spectroscopy were used to characterize the crystal phase change of the sintered copper nanoparticles. The resulting two-step flash light sintered copper nanoink films exhibited a low resistivity (3.81 μΩ cm, 2.3 times of that of bulk copper) and 5B level of adhesion strength without warping of the polymer substrate.

  5. Low-scale gravity mediation in warped extra dimension and collider phenomenology on hidden sector

    International Nuclear Information System (INIS)

    Itoh, H.; Okada, N.; Yamashita, T.

    2007-01-01

    We propose a new scenario of gravity-mediated supersymmetry breaking (gravity mediation) in a supersymmetric Randall-Sundrum model, where the gravity mediation takes place at a low scale due to the warped metric. We investigate collider phenomenology involving the hidden sector field, and find a possibility that the hidden sector field can be produced at the LHC and the ILC. The hidden sector may no longer be hidden. (author)

  6. A Study on Efficient Robust Speech Recognition with Stochastic Dynamic Time Warping

    OpenAIRE

    孫, 喜浩

    2014-01-01

    In recent years, great progress has been made in automatic speech recognition (ASR) system. The hidden Markov model (HMM) and dynamic time warping (DTW) are the two main algorithms which have been widely applied to ASR system. Although, HMM technique achieves higher recognition accuracy in clear speech environment and noisy environment. It needs large-set of words and realizes the algorithm more complexly.Thus, more and more researchers have focused on DTW-based ASR system.Dynamic time warpin...

  7. STRONG FIELD EFFECTS ON EMISSION LINE PROFILES: KERR BLACK HOLES AND WARPED ACCRETION DISKS

    International Nuclear Information System (INIS)

    Wang Yan; Li Xiangdong

    2012-01-01

    If an accretion disk around a black hole is illuminated by hard X-rays from non-thermal coronae, fluorescent iron lines will be emitted from the inner region of the accretion disk. The emission line profiles will show a variety of strong field effects, which may be used as a probe of the spin parameter of the black hole and the structure of the accretion disk. In this paper, we generalize the previous relativistic line profile models by including both the black hole spinning effects and the non-axisymmetries of warped accretion disks. Our results show different features from the conventional calculations for either a flat disk around a Kerr black hole or a warped disk around a Schwarzschild black hole by presenting, at the same time, multiple peaks, rather long red tails, and time variations of line profiles with the precession of the disk. We show disk images as seen by a distant observer, which are distorted by the strong gravity. Although we are primarily concerned with the iron K-shell lines in this paper, the calculation is general and is valid for any emission lines produced from a warped accretion disk around a black hole.

  8. Warped, anisotropic wormhole/soliton configurations in vacuum 5D gravity

    International Nuclear Information System (INIS)

    Vacaru, Sergiu I; Singleton, D

    2002-01-01

    In this paper we apply the anholonomic frames method developed in previous work to construct and study anisotropic vacuum field configurations in 5D gravity. Starting with an off-diagonal 5D metric, parametrized in terms of several ansatz functions, we show that using anholonomic frames greatly simplifies the resulting Einstein field equations. These simplified equations contain an interesting freedom in that one can choose one of the ansatz functions and then determine the remaining ansatz functions in terms of this choice. As examples we take one of the ansatz functions to be a solitonic solution of either the Kadomtsev-Petviashvili equation or the sine-Gordon equation. There are several interesting physical consequences of these solutions. First, a certain subclass of the solutions discussed in this paper has an exponential warp factor similar to that of the Randall-Sundrum model. However, the warp factor depends on more than just the fifth coordinate. In addition the warp factor arises from anisotropic vacuum solutions rather than from any explicit matter. Second, the solitonic character of these solutions might allow them to be interpreted either as gravitational models for particles (i.e. analogous to the 't Hooft-Polyakov monopole, but in the context of gravity), or as nonlinear, anisotropic gravitational waves

  9. Particle collisions near a three-dimensional warped AdS black hole

    Science.gov (United States)

    Bécar, Ramón; González, P. A.; Vásquez, Yerko

    2018-04-01

    In this paper we consider the warped AdS3 black hole solution of topologically massive gravity with a negative cosmological constant, and we study the possibility that it acts as a particle accelerator by analyzing the energy in the center of mass (CM) frame of two colliding particles in the vicinity of its horizon, which is known as the Bañnados, Silk and West (BSW) process. Mainly, we show that the critical angular momentum (L_c) of the particle decreases when the warping parameter(ν ) increases. Also, we show that despite the particle with L_c being able to exist for certain values of the conserved energy outside the horizon, it will never reach the event horizon; therefore, the black hole cannot act as a particle accelerator with arbitrarily high CM energy on the event horizon. However, such a particle could also exist inside the outer horizon, with the BSW process being possible on the inner horizon. On the other hand, for the extremal warped AdS3 black hole, the particle with L_c and energy E could exist outside the event horizon and, the CM energy blows up on the event horizon if its conserved energy fulfills the condition E2>(ν 2+3)l2/3(ν ^{2-1)}, with the BSW process being possible.

  10. The analysis of thin walled composite laminated helicopter rotor with hierarchical warping functions and finite element method

    Science.gov (United States)

    Zhu, Dechao; Deng, Zhongmin; Wang, Xingwei

    2001-08-01

    In the present paper, a series of hierarchical warping functions is developed to analyze the static and dynamic problems of thin walled composite laminated helicopter rotors composed of several layers with single closed cell. This method is the development and extension of the traditional constrained warping theory of thin walled metallic beams, which had been proved very successful since 1940s. The warping distribution along the perimeter of each layer is expanded into a series of successively corrective warping functions with the traditional warping function caused by free torsion or free bending as the first term, and is assumed to be piecewise linear along the thickness direction of layers. The governing equations are derived based upon the variational principle of minimum potential energy for static analysis and Rayleigh Quotient for free vibration analysis. Then the hierarchical finite element method is introduced to form a numerical algorithm. Both static and natural vibration problems of sample box beams are analyzed with the present method to show the main mechanical behavior of the thin walled composite laminated helicopter rotor.

  11. Properties on the edge: graphene edge energies, edge stresses, edge warping, and the Wulff shape of graphene flakes

    International Nuclear Information System (INIS)

    Branicio, Paulo S; Jhon, Mark H; Gan, Chee Kwan; Srolovitz, David J

    2011-01-01

    It has been shown that the broken bonds of an unreconstructed graphene edge generate compressive edge stresses leading to edge warping. Here, we investigate edge energies and edge stresses of graphene nanoribbons with arbitrary orientations from armchair to zigzag, considering both flat and warped edge shapes in the presence and absence of hydrogen. We use the second generation reactive empirical bond order potential to calculate the edge energies and stresses for clean and hydrogenated edges. Using these energies, we perform a Wulff construction to determine the equilibrium shapes of flat graphene flakes as a function of hydrogen chemical potential. While edge stresses for clean, flat edges are compressive, they become tensile if allowed to warp. Conversely, we find that edge energies change little (∼1%) with edge warping. Hydrogenation of the edges virtually eliminates both the edge energy and edge stresses. For warped edges an approximately linear relationship is found between amplitudes and wavelengths. The equilibrium shape of a graphene flake is determined by the value of the hydrogen chemical potential. For very small (and large) values of it the flakes have a nearly hexagonal (dodecagon) shape with zigzag oriented edges, while for intermediate values graphene flakes are found with complex shapes

  12. 3D temporal subtraction on multislice CT images using nonlinear warping technique

    Science.gov (United States)

    Ishida, Takayuki; Katsuragawa, Shigehiko; Kawashita, Ikuo; Kim, Hyounseop; Itai, Yoshinori; Awai, Kazuo; Li, Qiang; Doi, Kunio

    2007-03-01

    The detection of very subtle lesions and/or lesions overlapped with vessels on CT images is a time consuming and difficult task for radiologists. In this study, we have developed a 3D temporal subtraction method to enhance interval changes between previous and current multislice CT images based on a nonlinear image warping technique. Our method provides a subtraction CT image which is obtained by subtraction of a previous CT image from a current CT image. Reduction of misregistration artifacts is important in the temporal subtraction method. Therefore, our computerized method includes global and local image matching techniques for accurate registration of current and previous CT images. For global image matching, we selected the corresponding previous section image for each current section image by using 2D cross-correlation between a blurred low-resolution current CT image and a blurred previous CT image. For local image matching, we applied the 3D template matching technique with translation and rotation of volumes of interests (VOIs) which were selected in the current and the previous CT images. The local shift vector for each VOI pair was determined when the cross-correlation value became the maximum in the 3D template matching. The local shift vectors at all voxels were determined by interpolation of shift vectors of VOIs, and then the previous CT image was nonlinearly warped according to the shift vector for each voxel. Finally, the warped previous CT image was subtracted from the current CT image. The 3D temporal subtraction method was applied to 19 clinical cases. The normal background structures such as vessels, ribs, and heart were removed without large misregistration artifacts. Thus, interval changes due to lung diseases were clearly enhanced as white shadows on subtraction CT images.

  13. Registration of prone and supine CT colonography scans using correlation optimized warping and canonical correlation analysis

    International Nuclear Information System (INIS)

    Wang Shijun; Yao Jianhua; Liu Jiamin; Petrick, Nicholas; Van Uitert, Robert L.; Periaswamy, Senthil; Summers, Ronald M.

    2009-01-01

    Purpose: In computed tomographic colonography (CTC), a patient will be scanned twice--Once supine and once prone--to improve the sensitivity for polyp detection. To assist radiologists in CTC reading, in this paper we propose an automated method for colon registration from supine and prone CTC scans. Methods: We propose a new colon centerline registration method for prone and supine CTC scans using correlation optimized warping (COW) and canonical correlation analysis (CCA) based on the anatomical structure of the colon. Four anatomical salient points on the colon are first automatically distinguished. Then correlation optimized warping is applied to the segments defined by the anatomical landmarks to improve the global registration based on local correlation of segments. The COW method was modified by embedding canonical correlation analysis to allow multiple features along the colon centerline to be used in our implementation. Results: We tested the COW algorithm on a CTC data set of 39 patients with 39 polyps (19 training and 20 test cases) to verify the effectiveness of the proposed COW registration method. Experimental results on the test set show that the COW method significantly reduces the average estimation error in a polyp location between supine and prone scans by 67.6%, from 46.27±52.97 to 14.98 mm±11.41 mm, compared to the normalized distance along the colon centerline algorithm (p<0.01). Conclusions: The proposed COW algorithm is more accurate for the colon centerline registration compared to the normalized distance along the colon centerline method and the dynamic time warping method. Comparison results showed that the feature combination of z-coordinate and curvature achieved lowest registration error compared to the other feature combinations used by COW. The proposed method is tolerant to centerline errors because anatomical landmarks help prevent the propagation of errors across the entire colon centerline.

  14. Three dimensional PIC simulation of heavy ion fusion beams: Recent improvements to and applications of WARP

    International Nuclear Information System (INIS)

    Grote, D.P.; Friedman, A.; Haber, I.

    1993-01-01

    The multi-dimensional particle simulation code WARP is used to study the transport and acceleration of space-charge dominated ion beams in present-day and near-term experiments, and in fusion drivers. The algorithms employed in the 3d package and a number of applications have recently been described. In this paper the authors review the general features and major applications of the code. They then present recent developments in both code capabilities and applications. Most notable is modeling of the planned ESQ injector for ILSE, which uses the code's newest features, including subgrid-scale placement of internal conductor boundaries

  15. Time-dependent gravitating solitons in five dimensional warped space-times

    CERN Document Server

    Giovannini, Massimo

    2007-01-01

    Time-dependent soliton solutions are explicitly derived in a five-dimensional theory endowed with one (warped) extra-dimension. Some of the obtained geometries, everywhere well defined and technically regular, smoothly interpolate between two five-dimensional anti-de Sitter space-times for fixed value of the conformal time coordinate. Time dependent solutions containing both topological and non-topological sectors are also obtained. Supplementary degrees of freedom can be also included and, in this case, the resulting multi-soliton solutions may describe time-dependent kink-antikink systems.

  16. A joint multi-view plus depth image coding scheme based on 3D-warping

    DEFF Research Database (Denmark)

    Zamarin, Marco; Zanuttigh, Pietro; Milani, Simone

    2011-01-01

    on the scene structure that can be effectively exploited to improve the performance of multi-view coding schemes. In this paper we introduce a novel coding architecture that replaces the inter-view motion prediction operation with a 3D warping approach based on depth information to improve the coding......Free viewpoint video applications and autostereoscopic displays require the transmission of multiple views of a scene together with depth maps. Current compression and transmission solutions just handle these two data streams as separate entities. However, depth maps contain key information...

  17. Study of Confinement/Deconfinement Transition in AdS/QCD with Generalized Warp Factors

    Directory of Open Access Journals (Sweden)

    Shobhit Sachan

    2014-01-01

    Full Text Available We study analytical solutions of charged black holes and thermally charged AdS with generalized warped factors in Einstein-Maxwell-Dilaton system. We calculate Euclidean action for charged AdS and thermally charged AdS. The actions in both backgrounds are regularized by the method of background subtraction. The study of phase transition between charged black hole and thermally charged AdS gives an insight into the confinement/deconfinement transition. The plots of grand potential versus temperature and chemical potential versus transition temperature are obtained.

  18. The impact of emerging technology on nursing care: warp speed ahead.

    Science.gov (United States)

    Huston, Carol

    2013-05-31

    While myriad forces are changing the face of contemporary healthcare, one could argue that nothing will change the way nursing is practiced more than current advances in technology. Indeed, technology is changing the world at warp speed and nowhere is this more evident than in healthcare settings. This article identifies seven emerging technologies that will change the practice of nursing; three skill sets nurses will need to develop to acquire, use, and integrate these emerging technologies; and four challenges nurse leaders will face in integrating this new technology.

  19. Dynamic Time Warping Distance Method for Similarity Test of Multipoint Ground Motion Field

    Directory of Open Access Journals (Sweden)

    Yingmin Li

    2010-01-01

    Full Text Available The reasonability of artificial multi-point ground motions and the identification of abnormal records in seismic array observations, are two important issues in application and analysis of multi-point ground motion fields. Based on the dynamic time warping (DTW distance method, this paper discusses the application of similarity measurement in the similarity analysis of simulated multi-point ground motions and the actual seismic array records. Analysis results show that the DTW distance method not only can quantitatively reflect the similarity of simulated ground motion field, but also offers advantages in clustering analysis and singularity recognition of actual multi-point ground motion field.

  20. Cough Recognition Based on Mel Frequency Cepstral Coefficients and Dynamic Time Warping

    Science.gov (United States)

    Zhu, Chunmei; Liu, Baojun; Li, Ping

    Cough recognition provides important clinical information for the treatment of many respiratory diseases, but the assessment of cough frequency over a long period of time remains unsatisfied for either clinical or research purpose. In this paper, according to the advantage of dynamic time warping (DTW) and the characteristic of cough recognition, an attempt is made to adapt DTW as the recognition algorithm for cough recognition. The process of cough recognition based on mel frequency cepstral coefficients (MFCC) and DTW is introduced. Experiment results of testing samples from 3 subjects show that acceptable performances of cough recognition are obtained by DTW with a small training set.

  1. Higgs Production and Decay in Models of a Warped Extra Dimension with a Bulk Higgs

    OpenAIRE

    Archer, Paul R.; Carena, Marcela; Carmona, Adrian; Neubert, Matthias

    2014-01-01

    Warped extra-dimension models in which the Higgs boson is allowed to propagate in the bulk of a compact AdS$_5$ space are conjectured to be dual to models featuring a partially composite Higgs boson. They offer a framework with which to investigate the implications of changing the scaling dimension of the Higgs operator, which can be used to reduce the constraints from electroweak precision data. In the context of such models, we calculate the cross section for Higgs production in gluon fusio...

  2. Modeling laser-driven electron acceleration using WARP with Fourier decomposition

    Energy Technology Data Exchange (ETDEWEB)

    Lee, P., E-mail: patrick.lee@u-psud.fr [LPGP, CNRS, Univ. Paris-Sud, Université Paris-Saclay, 91405 Orsay (France); Audet, T.L. [LPGP, CNRS, Univ. Paris-Sud, Université Paris-Saclay, 91405 Orsay (France); Lehe, R.; Vay, J.-L. [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Maynard, G.; Cros, B. [LPGP, CNRS, Univ. Paris-Sud, Université Paris-Saclay, 91405 Orsay (France)

    2016-09-01

    WARP is used with the recent implementation of the Fourier decomposition algorithm to model laser-driven electron acceleration in plasmas. Simulations were carried out to analyze the experimental results obtained on ionization-induced injection in a gas cell. The simulated results are in good agreement with the experimental ones, confirming the ability of the code to take into account the physics of electron injection and reduce calculation time. We present a detailed analysis of the laser propagation, the plasma wave generation and the electron beam dynamics.

  3. A Natural Extension of Standard Warped Higher-Dimensional Compactifications: Theory and Phenomenology

    Science.gov (United States)

    Hong, Sungwoo

    Warped higher-dimensional compactifications with "bulk'' standard model, or their AdS/CFT dual as the purely 4D scenario of Higgs compositeness and partial compositeness, offer an elegant approach to resolving the electroweak hierarchy problem as well as the origins of flavor structure. However, low-energy electroweak/flavor/CP constraints and the absence of non-standard physics at LHC Run 1 suggest that a "little hierarchy problem'' remains, and that the new physics underlying naturalness may lie out of LHC reach. Assuming this to be the case, we show that there is a simple and natural extension of the minimal warped model in the Randall-Sundrum framework, in which matter, gauge and gravitational fields propagate modestly different degrees into the IR of the warped dimension, resulting in rich and striking consequences for the LHC (and beyond). The LHC-accessible part of the new physics is AdS/CFT dual to the mechanism of "vectorlike confinement'', with TeV-scale Kaluza-Klein excitations of the gauge and gravitational fields dual to spin-0,1,2 composites. Unlike the minimal warped model, these low-lying excitations have predominantly flavor-blind and flavor/CP-safe interactions with the standard model. In addition, the usual leading decay modes of the lightest KK gauge bosons into top and Higgs bosons are suppressed. This effect permits erstwhile subdominant channels to become significant. These include flavor-universal decays to all pairs of SM fermions, and a novel channel--decay to a radion and a SM gauge boson, followed by radion decay to a pair of SM gauge bosons. We present a detailed phenomenological study of the latter cascade decay processes. Remarkably, this scenario also predicts small deviations from flavor-blindness originating from virtual effects of Higgs/top compositeness at O(10) TeV, with subdominant resonance decays into a pair of Higgs/top-rich final states, giving the LHC an early "preview'' of the nature of the resolution of the hierarchy

  4. InterFace: A software package for face image warping, averaging, and principal components analysis.

    Science.gov (United States)

    Kramer, Robin S S; Jenkins, Rob; Burton, A Mike

    2017-12-01

    We describe InterFace, a software package for research in face recognition. The package supports image warping, reshaping, averaging of multiple face images, and morphing between faces. It also supports principal components analysis (PCA) of face images, along with tools for exploring the "face space" produced by PCA. The package uses a simple graphical user interface, allowing users to perform these sophisticated image manipulations without any need for programming knowledge. The program is available for download in the form of an app, which requires that users also have access to the (freely available) MATLAB Runtime environment.

  5. Technical guidance for the development of a solid state image sensor for human low vision image warping

    Science.gov (United States)

    Vanderspiegel, Jan

    1994-01-01

    This report surveys different technologies and approaches to realize sensors for image warping. The goal is to study the feasibility, technical aspects, and limitations of making an electronic camera with special geometries which implements certain transformations for image warping. This work was inspired by the research done by Dr. Juday at NASA Johnson Space Center on image warping. The study has looked into different solid-state technologies to fabricate image sensors. It is found that among the available technologies, CMOS is preferred over CCD technology. CMOS provides more flexibility to design different functions into the sensor, is more widely available, and is a lower cost solution. By using an architecture with row and column decoders one has the added flexibility of addressing the pixels at random, or read out only part of the image.

  6. The effect of tooling design parameters on web-warping in the flexible roll forming of UHSS

    International Nuclear Information System (INIS)

    Jiao, Jingsi; Weiss, Matthias; Rolfe, Bernard; Mendiguren, Joseba; Galdos, Lander

    2013-01-01

    To reduce weight and improve passenger safety there is an increased need in the automotive industry to use Ultra High Strength Steels (UHSS) for structural and crash components. However, the application of UHSS is restricted by their limited formability and the difficulty of forming them in conventional processes. An alternative method of manufacturing structural auto body parts from UHSS is the flexible roll forming process which can accommodate materials with high strength and limited ductility in the production of complex and weight-optimised components. However, one major concern in the flexible roll forming is web-warping, which is the height deviation of the profile web area. This paper investigates, using a numerical model, the effect on web-warping with respect to various forming methods. The results demonstrate that different forming methods lead to different amount of web-warping in terms of forming the product with identical geometry

  7. The effect of tooling design parameters on web-warping in the flexible roll forming of UHSS

    Science.gov (United States)

    Jiao, Jingsi; Rolfe, Bernard; Mendiguren, Joseba; Galdos, Lander; Weiss, Matthias

    2013-12-01

    To reduce weight and improve passenger safety there is an increased need in the automotive industry to use Ultra High Strength Steels (UHSS) for structural and crash components. However, the application of UHSS is restricted by their limited formability and the difficulty of forming them in conventional processes. An alternative method of manufacturing structural auto body parts from UHSS is the flexible roll forming process which can accommodate materials with high strength and limited ductility in the production of complex and weight-optimised components. However, one major concern in the flexible roll forming is web-warping, which is the height deviation of the profile web area. This paper investigates, using a numerical model, the effect on web-warping with respect to various forming methods. The results demonstrate that different forming methods lead to different amount of web-warping in terms of forming the product with identical geometry.

  8. Illumination Tolerance for Visual Navigation with the Holistic Min-Warping Method

    Directory of Open Access Journals (Sweden)

    Ralf Möller

    2014-02-01

    Full Text Available Holistic visual navigation methods are an emerging alternative to the ubiquitous feature-based methods. Holistic methods match entire images pixel-wise instead of extracting and comparing local feature descriptors. In this paper we investigate which pixel-wise distance measures are most suitable for the holistic min-warping method with respect to illumination invariance. Two novel approaches are presented: tunable distance measures—weighted combinations of illumination-invariant and illumination-sensitive terms—and two novel forms of “sequential” correlation which are only invariant against intensity shifts but not against multiplicative changes. Navigation experiments on indoor image databases collected at the same locations but under different conditions of illumination demonstrate that tunable distance measures perform optimally by mixing their two portions instead of using the illumination-invariant term alone. Sequential correlation performs best among all tested methods, and as well but much faster in an approximated form. Mixing with an additional illumination-sensitive term is not necessary for sequential correlation. We show that min-warping with approximated sequential correlation can successfully be applied to visual navigation of cleaning robots.

  9. Implementation of an iteractive matching scheme for the Kapchinskij-Vladimirskij equations in the WARP code

    International Nuclear Information System (INIS)

    Chilton, Sven H.

    2008-01-01

    The WARP code is a robust electrostatic particle-in-cell simulation package used to model charged particle beams with strong space-charge forces. A fundamental operation associated with seeding detailed simulations of a beam transport channel is to generate initial conditions where the beam distribution is matched to the structure of a periodic focusing lattice. This is done by solving for periodic, matched solutions to a coupled set of ODEs called the Kapchinskij-Vladimirskij (KV) envelope equations, which describe the evolution of low-order beam moments subject to applied lattice focusing, space-charge defocusing, and thermal defocusing forces. Recently, an iterative numerical method was developed (Lund, Chilton, and Lee, Efficient computation of matched solutions to the KV envelope equations for periodic focusing lattices, Physical Review Special Topics-Accelerators and Beams 9, 064201 2006) to generate matching conditions in a highly flexible, convergent, and fail-safe manner. This method is extended and implemented in the WARP code as a Python package to vastly ease the setup of detailed simulations. In particular, the Python package accommodates any linear applied lattice focusing functions without skew coupling, and a more general set of beam parameter specifications than its predecessor. Lattice strength iteration tools were added to facilitate the implementation of problems with specific applied focusing strengths

  10. Mechanical Properties Of 3D-Structure Composites Based On Warp-Knitted Spacer Fabrics

    Directory of Open Access Journals (Sweden)

    Chen Si

    2015-06-01

    Full Text Available In this paper, the mechanical properties (compression and impact behaviours of three-dimension structure (3D-structure composites based on warp-knitted spacer fabrics have been thoroughly investigated. In order to discuss the effect of fabric structural parameters on the mechanical performance of composites, six different types of warp-knitted spacer fabrics having different structural parameters (such as outer layer structure, diameter of spacer yarn, spacer yarn inclination angle and thickness were involved for comparison study. The 3D-structure composites were fabricated based on a flexible polyurethane foam. The produced composites were characterised for compression and impact properties. The findings obtained indicate that the fabric structural parameters have strong influence on the compression and impact responses of 3D-structure composites. Additionally, the impact test carried out on the 3D-structure composites shows that the impact loads do not affect the integrity of composite structure. All the results reveal that the product exhibits promising mechanical performance and its service life can be sustained.

  11. Warped frequency transform analysis of ultrasonic guided waves in long bones

    Science.gov (United States)

    De Marchi, L.; Baravelli, E.; Xu, K.; Ta, D.; Speciale, N.; Marzani, A.; Viola, E.

    2010-03-01

    Long bones can be seen as irregular hollow tubes, in which, for a given excitation frequency, many ultrasonic Guided Waves (GWs) can propagate. The analysis of GWs is potential to reflect more information on both geometry and material properties of the bone than any other method (such as dual-energy X-ray absorptiometry, or quantitative computed tomography), and can be used in the assessment of osteoporosis and in the evaluation of fracture healing. In this study, time frequency representations (TFRs) were used to gain insights into the expected behavior of GWs in bones. To this aim, we implemented a dedicated Warped Frequency Transform (WFT) which decomposes the spectrotemporal components of the different propagating modes by selecting an appropriate warping map to reshape the frequency axis. The map can be designed once the GWs group velocity dispersion curves can be predicted. To this purpose, the bone is considered as a hollow cylinder with inner and outer diameter of 16.6 and 24.7 mm, respectively, and linear poroelastic material properties in agreement with the low level of stresses induced by the waves. Timetransient events obtained experimentally, via a piezoelectric ultrasonic set-up applied to bovine tibiae, are analyzed. The results show that WFT limits interference patterns which appear with others TFRs (such as scalograms or warpograms) and produces a sparse representation suitable for characterization purposes. In particular, the mode-frequency combinations propagating with minimal losses are identified.

  12. Heterotic M-theory, warped geometry and the cosmological constant problem

    International Nuclear Information System (INIS)

    Krause, A.

    2001-01-01

    The first part of this thesis analyzes whether a locally flat background represents a stable vacuum for the proposed heterotic M-theory. A calculation of the leading order supergravity exchange diagrams leads to the conclusion that the locally flat vacuum cannot be stable. Afterwards a comparison with the corresponding weakly coupled heterotic string amplitudes is made. Next, we consider compactifications of heterotic M-theory on a Calabi-Yau threefold, including a non-vanishing G-flux. The ensuing warped-geometry is determined completely and used to show that the variation of the Calabi-Yau volume along the orbifold direction varies quadratically with distance instead linearly as suggested by an earlier first order approximation. In the second part of this thesis we propose a mechanism for obtaining a small cosmological constant. This mechanism consists of the separation of two domain-walls, which together constitute our world, up to a distance 2l ≅1/M GUT . The resulting warped-geometry leads to an exponential suppression of the cosmological constant, which thereby can obtain its observed value without introducing a large hierarchy. An embedding of this set-up into IIB string-theory entails an SU(6) grand unified theory with a natural explanation of the Higgs doublet-triplet splitting. Finally, we examine to what extent the string-theory T-duality can influence curvature. To this aim we derive the full transformation of the curvature-tensor under T-duality. (orig.)

  13. FPGA Implementation of the Coupled Filtering Method and the Affine Warping Method.

    Science.gov (United States)

    Zhang, Chen; Liang, Tianzhu; Mok, Philip K T; Yu, Weichuan

    2017-07-01

    In ultrasound image analysis, the speckle tracking methods are widely applied to study the elasticity of body tissue. However, "feature-motion decorrelation" still remains as a challenge for the speckle tracking methods. Recently, a coupled filtering method and an affine warping method were proposed to accurately estimate strain values, when the tissue deformation is large. The major drawback of these methods is the high computational complexity. Even the graphics processing unit (GPU)-based program requires a long time to finish the analysis. In this paper, we propose field-programmable gate array (FPGA)-based implementations of both methods for further acceleration. The capability of FPGAs on handling different image processing components in these methods is discussed. A fast and memory-saving image warping approach is proposed. The algorithms are reformulated to build a highly efficient pipeline on FPGA. The final implementations on a Xilinx Virtex-7 FPGA are at least 13 times faster than the GPU implementation on the NVIDIA graphic card (GeForce GTX 580).

  14. Novel methods in the Particle-In-Cell accelerator Code-Framework Warp

    Energy Technology Data Exchange (ETDEWEB)

    Vay, J-L [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Grote, D. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cohen, R. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Friedman, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2012-12-26

    The Particle-In-Cell (PIC) Code-Framework Warp is being developed by the Heavy Ion Fusion Science Virtual National Laboratory (HIFS-VNL) to guide the development of accelerators that can deliver beams suitable for high-energy density experiments and implosion of inertial fusion capsules. It is also applied in various areas outside the Heavy Ion Fusion program to the study and design of existing and next-generation high-energy accelerators, including the study of electron cloud effects and laser wakefield acceleration for example. This study presents an overview of Warp's capabilities, summarizing recent original numerical methods that were developed by the HIFS-VNL (including PIC with adaptive mesh refinement, a large-timestep 'drift-Lorentz' mover for arbitrarily magnetized species, a relativistic Lorentz invariant leapfrog particle pusher, simulations in Lorentz-boosted frames, an electromagnetic solver with tunable numerical dispersion and efficient stride-based digital filtering), with special emphasis on the description of the mesh refinement capability. In addition, selected examples of the applications of the methods to the abovementioned fields are given.

  15. Improved Riccati Transfer Matrix Method for Free Vibration of Non-Cylindrical Helical Springs Including Warping

    Directory of Open Access Journals (Sweden)

    A.M. Yu

    2012-01-01

    Full Text Available Free vibration equations for non-cylindrical (conical, barrel, and hyperboloidal types helical springs with noncircular cross-sections, which consist of 14 first-order ordinary differential equations with variable coefficients, are theoretically derived using spatially curved beam theory. In the formulation, the warping effect upon natural frequencies and vibrating mode shapes is first studied in addition to including the rotary inertia, the shear and axial deformation influences. The natural frequencies of the springs are determined by the use of improved Riccati transfer matrix method. The element transfer matrix used in the solution is calculated using the Scaling and Squaring method and Pad'e approximations. Three examples are presented for three types of springs with different cross-sectional shapes under clamped-clamped boundary condition. The accuracy of the proposed method has been compared with the FEM results using three-dimensional solid elements (Solid 45 in ANSYS code. Numerical results reveal that the warping effect is more pronounced in the case of non-cylindrical helical springs than that of cylindrical helical springs, which should be taken into consideration in the free vibration analysis of such springs.

  16. Sistem Gesture Accelerometer dengan Metode Fast Dynamic Time Warping (FastDTW

    Directory of Open Access Journals (Sweden)

    Sam Farisa Chaerul Haviana

    2016-01-01

    Full Text Available In the modern environment, the interaction between humans and computers require a more natural form of interaction. Therefore, it is important to be able to build a system that can meet these demands, such as by building a hand gesture recognition system or gesture to create a more natural form of interaction. This study aims to design a smartphone’s accelerometer gesture system as human computer interaction interfaces using FastDTW (Fast Dynamic Time Warping.The result of this study is form of gesture interaction which implemented in a system that can make the process of recognition of the human hand movements based on a smartphone accelerometer which generates a command to run the media player application functions as a case study. FastDTW as the development of Dynamic Time Warping method (DTW is able to compute faster than DTW and have an accuracy approaching DTW. From the test results, FastDTW show a fairly high degree of accuracy reached 86% and showed a better computing speed compared to DTW   Keywords: Human and Computer Interaction, Accelerometer-based gesture, FastDTW, Media player application function

  17. Implementation of an iterative matching scheme for the Kapchinskij-Vladimirskij equations in the WARP code

    International Nuclear Information System (INIS)

    Chilton, Sven; Chilton, Sven H.

    2008-01-01

    The WARP code is a robust electrostatic particle-in-cell simulation package used to model charged particle beams with strong space-charge forces. A fundamental operation associated with seeding detailed simulations of a beam transport channel is to generate initial conditions where the beam distribution is matched to the structure of a periodic focusing lattice. This is done by solving for periodic, matched solutions to a coupled set of ODEs called the Kapchinskij-Vladimirskij (KV) envelope equations, which describe the evolution of low-order beam moments subject to applied lattice focusing, space-charge defocusing, and thermal defocusing forces. Recently, an iterative numerical method was developed (Lund, Chilton, and Lee, Efficient computation of matched solutions to the KV envelope equations for periodic focusing lattices, Physical Review Special Topics-Accelerators and Beams 9, 064201 2006) to generate matching conditions in a highly flexible, convergent, and fail-safe manner. This method is extended and implemented in the WARP code as a Python package to vastly ease the setup of detailed simulations. In particular, the Python package accommodates any linear applied lattice focusing functions without skew coupling, and a more general set of beam parameter specifications than its predecessor. Lattice strength iteration tools were added to facilitate the implementation of problems with specific applied focusing strengths

  18. The effective action of warped M-theory reductions with higher derivative terms — part I

    Energy Technology Data Exchange (ETDEWEB)

    Grimm, Thomas W.; Pugh, Tom G.; Weissenbacher, Matthias [Max Planck Institute for Physics,Föhringer Ring 6, 80805 Munich (Germany)

    2016-01-25

    M-theory accessed via eleven-dimensional supergravity admits globally consistent warped solutions with eight-dimensional compact spaces if background fluxes and higher derivative terms are considered. The internal background is conformally Kähler with vanishing first Chern class. We perturb these solutions including a finite number of Kähler deformations of the metric and vector deformations of the M-theory three-form. Special emphasis is given to the field-dependence of the warp-factor and the higher-derivative terms. We show that the three-dimensional two-derivative effective action takes a surprisingly simple form in terms of a single higher-curvature building block due to numerous non-trivial cancellations. Both the ansatz and the effective action admit a moduli dependent scaling symmetry of the internal metric. Furthermore, we find that the required departure from Ricci-flatness and harmonicity of the zero-mode eigenforms does not alter the effective theory.

  19. Low scale gravity mediation with warped extra dimension and collider phenomenology on the hidden sector

    International Nuclear Information System (INIS)

    Itoh, Hideo; Okada, Nobuchika; Yamashita, Toshifumi

    2006-01-01

    We propose a scenario of gravity mediated supersymmetry breaking (gravity mediation) in a supersymmetric Randall-Sundrum model. In our setup, both the visible sector and the hidden sector coexist on the infrared (IR) brane. We introduce the Polonyi model as a simple hidden sector. Because of the warped metric, the effective cutoff scale on the IR brane is 'warped down', so that the gravity mediation occurs at a low scale. As a result, the gravitino is naturally the lightest superpartner (LSP) and contact interactions between the hidden and the visible sector fields become stronger. We address phenomenologies for various IR cutoff scales. In particular, we investigate collider phenomenology involving a scalar field (Polonyi field) in the hidden sector for the case with the IR cutoff around 10 TeV. We find a possibility that the hidden sector scalar can be produced at the LHC and the international linear collider (ILC). Interestingly, the scalar behaves like the Higgs boson of the standard model in the production process, while its decay process is quite different and, once produced, it will provide us with a very clean signature. The hidden sector may be no longer hidden

  20. The Effect of Knitting Parameter and Finishing on Elastic Property of PET/PBT Warp Knitted Fabric

    Directory of Open Access Journals (Sweden)

    Chen Qing

    2017-12-01

    Full Text Available This study investigated the elastic elongation and elastic recovery of the elastic warp knittedfabric made of PET( polyethylene terephthalate and PBT(polybutylene terephthalate filament. Using 50/24F PET and 50D/24F PBT in two threadingbars, the tricot, locknit and satin warp knitted fabrics were produced on the E28 tricot warpknitting machine. The knitting parameters influencing the elastic elongation under 100N wereanalyzed in terms of fabric structure, yarn run-in speed and drawing density set on machine.Besides, dyeing temperature and heat setting temperature/time were also examined in order toretain proper elastic elongation and elastic recovery. The relationship between elastic elongationand knitting parameter and finishing parameter were analyzed. Finally, the elastic recovery ofPET/PBT warp knitted fabric was examined to demonstrate the elastic property of final finishedfabric. This study could help us to further exploit the use of PET/PBT warp knitted fabric in thedevelopment of elastic garment in future.

  1. Mass spectrum in 5D Warped Einstein Universe and El Naschie's quantum golden field theory

    International Nuclear Information System (INIS)

    Dariescu, Marina-Aura; Dariescu, Ciprian; Pirghie, Ana-Camelia

    2009-01-01

    The present paper deals with the massive bosons evolving in a 5D manifold, where the four-dimensional slices are the S 3 xR spacetime. By solving the Einstein equations with a perfect fluid source, we find the expression of the warp factor and write down the corresponding Gordon equation in the bulk, near one of the degenerated vacua of an effective potential with a spontaneously broken Z 2 -symmetry. We obtain the general form of the wave functions and analyze how the Kaluza-Klein-type spectrum is affecting the mass of the scalar on the brane. By inspecting the mass spectrum, we point out a connection with the golden mean based El Naschie's field theory.

  2. Time travel and warp drives a scientific guide to shortcuts through time and space

    CERN Document Server

    Everett, Allen

    2012-01-01

    Sci-fi makes it look so easy. Receive a distress call from Alpha Centauri? No problem: punch the warp drive and you're there in minutes. Facing a catastrophe that can't be averted? Just pop back in the timestream and stop it before it starts. But for those of us not lucky enough to live in a science-fictional universe, are these ideas merely flights of fancy—or could it really be possible to travel through time or take shortcuts between stars?Cutting-edge physics may not be able to answer those questions yet, but it does offer up some tantalizing possibilities. In Time Travel and W

  3. Systematics of multi-field effects at the end of warped brane inflation

    CERN Document Server

    Chen, Heng-Yu; Shiu, Gary

    2008-01-01

    We investigate in the context of brane inflation the possibility of additional light scalar fields generating significant power spectrum and non-Gaussianities at the end of inflation affecting the CMB scale observations. We consider the specific mechanism outlined by Lyth and describe the necessary criteria for it to be potentially important in a warped throat. We also discuss different mechanisms for uplifting the vacuum energy which can lead to different dominant contributions of the inflaton potential near the end of inflation. We then apply such criteria to one of the most detailed brane inflation models to date, and show that inflation can persist towards the tip of the throat, however for the specific stable inflationary trajectory, the light residual isometry direction becomes degenerate. We also estimate the effects for other inflationary trajectories with non-degenerate residual isometries.

  4. IMPLEMETASI OFFLINE PENGENALAN SISTEM ISYARAT BAHASA INDONESIA MENGGUNAKAN METODE DYNAMIC TIME WARPING PADA PERANGKAT ANDROID

    Directory of Open Access Journals (Sweden)

    Mohammad Iqbal

    2015-11-01

    Full Text Available ABSTRAK Algoritma Dynamic Time Warping (DTW digunakan secara luas untuk berbagai penelitian, salah satunya di bidang bahasa isyarat. DTW adalah algoritma pencocokan pola (template matching untuk mengukur kemiripan dua data sekuensial (time series temporal yang berbeda waktu dan kecepatan. Pada penelitian ini disajikan implementasi algoritma DTW untuk pengenalan bahasa isyarat Indonesia (Sistem Isyarat Bahasa Indonesia SIBI secara offline. Dataset yang digunakan dalam penelitian ini sebanyak 900 data untuk dengan jumlah kelas 50 kata isyarat, yaitu dengan rincian untuk masing-masing kelas adalah 3 data sebagai data template dan 15 data sebagai data testing. Hasil pengujian menunjukkan bahwa tingkat pengenalan atau nilai accuracy adalah 89,73%. Waktu rata-rata yang dibutuhkan adalah 654.59 milidetik untuk proses pengenalan satu data testing dengan menggunakan template sebanyak 3 data per kelas atau total template 150 data. Kata kunci: pengenalan, offline, SIBI, bahasa isyarat Indonesia, android.

  5. A Dynamic Time Warping Approach to Real-Time Activity Recognition for Food Preparation

    Science.gov (United States)

    Pham, Cuong; Plötz, Thomas; Olivier, Patrick

    We present a dynamic time warping based activity recognition system for the analysis of low-level food preparation activities. Accelerometers embedded into kitchen utensils provide continuous sensor data streams while people are using them for cooking. The recognition framework analyzes frames of contiguous sensor readings in real-time with low latency. It thereby adapts to the idiosyncrasies of utensil use by automatically maintaining a template database. We demonstrate the effectiveness of the classification approach by a number of real-world practical experiments on a publically available dataset. The adaptive system shows superior performance compared to a static recognizer. Furthermore, we demonstrate the generalization capabilities of the system by gradually reducing the amount of training samples. The system achieves excellent classification results even if only a small number of training samples is available, which is especially relevant for real-world scenarios.

  6. Prediction of regulatory gene pairs using dynamic time warping and gene ontology.

    Science.gov (United States)

    Yang, Andy C; Hsu, Hui-Huang; Lu, Ming-Da; Tseng, Vincent S; Shih, Timothy K

    2014-01-01

    Selecting informative genes is the most important task for data analysis on microarray gene expression data. In this work, we aim at identifying regulatory gene pairs from microarray gene expression data. However, microarray data often contain multiple missing expression values. Missing value imputation is thus needed before further processing for regulatory gene pairs becomes possible. We develop a novel approach to first impute missing values in microarray time series data by combining k-Nearest Neighbour (KNN), Dynamic Time Warping (DTW) and Gene Ontology (GO). After missing values are imputed, we then perform gene regulation prediction based on our proposed DTW-GO distance measurement of gene pairs. Experimental results show that our approach is more accurate when compared with existing missing value imputation methods on real microarray data sets. Furthermore, our approach can also discover more regulatory gene pairs that are known in the literature than other methods.

  7. Observation of antiphase coherent phonons in the warped Dirac cone of Bi2Te3

    Science.gov (United States)

    Golias, E.; Sánchez-Barriga, J.

    2016-10-01

    In this Rapid Communication we investigate the coupling between excited electrons and phonons in the highly anisotropic electronic structure of the prototypical topological insulator Bi2Te3 . Using time- and angle-resolved photoemission spectroscopy we are able to identify the emergence and ultrafast temporal evolution of the longitudinal-optical A1 g coherent-phonon mode in Bi2Te3 . We observe an antiphase behavior in the onset of the coherent-phonon oscillations between the Γ K ¯ and the Γ M ¯ high-symmetry directions that is consistent with warping. The qualitative agreement between our density-functional theory calculations and the experimental results reveals the critical role of the anisotropic coupling between Dirac fermions and phonon modes in the topological insulator Bi2Te3 .

  8. Uncertainty evaluation of thickness and warp of a silicon wafer measured by a spectrally resolved interferometer

    Science.gov (United States)

    Praba Drijarkara, Agustinus; Gergiso Gebrie, Tadesse; Lee, Jae Yong; Kang, Chu-Shik

    2018-06-01

    Evaluation of uncertainty of thickness and gravity-compensated warp of a silicon wafer measured by a spectrally resolved interferometer is presented. The evaluation is performed in a rigorous manner, by analysing the propagation of uncertainty from the input quantities through all the steps of measurement functions, in accordance with the ISO Guide to the Expression of Uncertainty in Measurement. In the evaluation, correlation between input quantities as well as uncertainty attributed to thermal effect, which were not included in earlier publications, are taken into account. The temperature dependence of the group refractive index of silicon was found to be nonlinear and varies widely within a wafer and also between different wafers. The uncertainty evaluation described here can be applied to other spectral interferometry applications based on similar principles.

  9. Beam Dynamics in an Electron Lens with the Warp Particle-in-cell Code

    CERN Document Server

    Stancari, Giulio; Redaelli, Stefano

    2014-01-01

    Electron lenses are a mature technique for beam manipulation in colliders and storage rings. In an electron lens, a pulsed, magnetically confined electron beam with a given current-density profile interacts with the circulating beam to obtain the desired effect. Electron lenses were used in the Fermilab Tevatron collider for beam-beam compensation, for abort-gap clearing, and for halo scraping. They will be used in RHIC at BNL for head-on beam-beam compensation, and their application to the Large Hadron Collider for halo control is under development. At Fermilab, electron lenses will be implemented as lattice elements for nonlinear integrable optics. The design of electron lenses requires tools to calculate the kicks and wakefields experienced by the circulating beam. We use the Warp particle-in-cell code to study generation, transport, and evolution of the electron beam. For the first time, a fully 3-dimensional code is used for this purpose.

  10. Tensorial dynamic time warping with articulation index representation for efficient audio-template learning.

    Science.gov (United States)

    Le, Long N; Jones, Douglas L

    2018-03-01

    Audio classification techniques often depend on the availability of a large labeled training dataset for successful performance. However, in many application domains of audio classification (e.g., wildlife monitoring), obtaining labeled data is still a costly and laborious process. Motivated by this observation, a technique is proposed to efficiently learn a clean template from a few labeled, but likely corrupted (by noise and interferences), data samples. This learning can be done efficiently via tensorial dynamic time warping on the articulation index-based time-frequency representations of audio data. The learned template can then be used in audio classification following the standard template-based approach. Experimental results show that the proposed approach outperforms both (1) the recurrent neural network approach and (2) the state-of-the-art in the template-based approach on a wildlife detection application with few training samples.

  11. The use of cross-section warping functions in composite rotor blade analysis

    Science.gov (United States)

    Kosmatka, J. B.

    1992-01-01

    During the contracted period, our research was concentrated into three areas. The first was the development of an accurate and a computationally efficient method for predicting the cross-section warping functions in an arbitrary cross-section composed of isotropic and/or anisotropic materials. The second area of research was the development of a general higher-order one-dimensional theory for anisotropic beams. The third area of research was the development of an analytical model for assessing the extension-bend-twist coupling behavior of nonhomogeneous anisotropic beams with initial twist. In the remaining six chapters of this report, the three different research areas and associated sub-research areas are covered independently including separate introductions, theoretical developments, numerical results, and references.

  12. Canonical structure of BHT massive gravity in warped AdS3 sector

    Directory of Open Access Journals (Sweden)

    Davood Mahdavian Yekta

    2016-08-01

    Full Text Available We investigate the asymptotic structure of the three dimensional Warped Anti-de Sitter (WAdS3 black holes in the Bergshoeff–Hohm–Townsend (BHT massive gravity using the canonical Hamiltonian formalism. We define the canonical asymptotic gauge generators, which produce the conserved charges and the asymptotic symmetry group for the WAdS3 black holes. The attained symmetry group is described by a semi-direct sum of a Virasoro and a Kač–Moody algebra. Using the Sugawara construction, we obtain a direct sum of two Virasoro algebras. We show that not only the asymptotic conserved charges satisfy the first law of black hole thermodynamics, but also they lead to the expected Smarr formula for the WAdS3 black holes. We also show that the black hole's entropy obeys the Cardy formula of the dual conformal field theory (CFT.

  13. Canonical structure of BHT massive gravity in warped AdS{sub 3} sector

    Energy Technology Data Exchange (ETDEWEB)

    Mahdavian Yekta, Davood, E-mail: d.mahdavian@hsu.ac.ir

    2016-08-10

    We investigate the asymptotic structure of the three dimensional Warped Anti-de Sitter (WAdS{sub 3}) black holes in the Bergshoeff–Hohm–Townsend (BHT) massive gravity using the canonical Hamiltonian formalism. We define the canonical asymptotic gauge generators, which produce the conserved charges and the asymptotic symmetry group for the WAdS{sub 3} black holes. The attained symmetry group is described by a semi-direct sum of a Virasoro and a Kač–Moody algebra. Using the Sugawara construction, we obtain a direct sum of two Virasoro algebras. We show that not only the asymptotic conserved charges satisfy the first law of black hole thermodynamics, but also they lead to the expected Smarr formula for the WAdS{sub 3} black holes. We also show that the black hole's entropy obeys the Cardy formula of the dual conformal field theory (CFT).

  14. Modified Friedmann equation and inflation in a warped codimension-two braneworld

    International Nuclear Information System (INIS)

    Chen Fang; Cline, James M.; Kanno, Sugumi

    2008-01-01

    We study the Friedmann equation for the warped codimension-two braneworld background which most closely resembles the Randall-Sundrum model. Extra matter on the (Planck) 4-brane, with equation of state p θ =(α-1)ρ for the azimuthal pressure, is required to satisfy the junction conditions. For 1 5 the model is intrinsically stable, without the need for a GW field, and in this case we show that inflationary predictions can be modified by the nonstandard Friedmann equation; in particular, it is possible to get an upper limit on the spectral index, large deviations from the consistency condition between the tensor spectrum and ratio r, and large running of the spectral index even though the slow-roll parameters remain small.

  15. Solid waste bin detection and classification using Dynamic Time Warping and MLP classifier

    Energy Technology Data Exchange (ETDEWEB)

    Islam, Md. Shafiqul, E-mail: shafique@eng.ukm.my [Dept. of Electrical, Electronic and Systems Engineering, Universiti Kebangsaan Malaysia, Bangi 43600, Selangore (Malaysia); Hannan, M.A., E-mail: hannan@eng.ukm.my [Dept. of Electrical, Electronic and Systems Engineering, Universiti Kebangsaan Malaysia, Bangi 43600, Selangore (Malaysia); Basri, Hassan [Dept. of Civil and Structural Engineering, Universiti Kebangsaan Malaysia, Bangi 43600, Selangore (Malaysia); Hussain, Aini; Arebey, Maher [Dept. of Electrical, Electronic and Systems Engineering, Universiti Kebangsaan Malaysia, Bangi 43600, Selangore (Malaysia)

    2014-02-15

    Highlights: • Solid waste bin level detection using Dynamic Time Warping (DTW). • Gabor wavelet filter is used to extract the solid waste image features. • Multi-Layer Perceptron classifier network is used for bin image classification. • The classification performance evaluated by ROC curve analysis. - Abstract: The increasing requirement for Solid Waste Management (SWM) has become a significant challenge for municipal authorities. A number of integrated systems and methods have introduced to overcome this challenge. Many researchers have aimed to develop an ideal SWM system, including approaches involving software-based routing, Geographic Information Systems (GIS), Radio-frequency Identification (RFID), or sensor intelligent bins. Image processing solutions for the Solid Waste (SW) collection have also been developed; however, during capturing the bin image, it is challenging to position the camera for getting a bin area centralized image. As yet, there is no ideal system which can correctly estimate the amount of SW. This paper briefly discusses an efficient image processing solution to overcome these problems. Dynamic Time Warping (DTW) was used for detecting and cropping the bin area and Gabor wavelet (GW) was introduced for feature extraction of the waste bin image. Image features were used to train the classifier. A Multi-Layer Perceptron (MLP) classifier was used to classify the waste bin level and estimate the amount of waste inside the bin. The area under the Receiver Operating Characteristic (ROC) curves was used to statistically evaluate classifier performance. The results of this developed system are comparable to previous image processing based system. The system demonstration using DTW with GW for feature extraction and an MLP classifier led to promising results with respect to the accuracy of waste level estimation (98.50%). The application can be used to optimize the routing of waste collection based on the estimated bin level.

  16. Analysis of warping deformation modes using higher order ANCF beam element

    Science.gov (United States)

    Orzechowski, Grzegorz; Shabana, Ahmed A.

    2016-02-01

    Most classical beam theories assume that the beam cross section remains a rigid surface under an arbitrary loading condition. However, in the absolute nodal coordinate formulation (ANCF) continuum-based beams, this assumption can be relaxed allowing for capturing deformation modes that couple the cross-section deformation and beam bending, torsion, and/or elongation. The deformation modes captured by ANCF finite elements depend on the interpolating polynomials used. The most widely used spatial ANCF beam element employs linear approximation in the transverse direction, thereby restricting the cross section deformation and leading to locking problems. The objective of this investigation is to examine the behavior of a higher order ANCF beam element that includes quadratic interpolation in the transverse directions. This higher order element allows capturing warping and non-uniform stretching distribution. Furthermore, this higher order element allows for increasing the degree of continuity at the element interface. It is shown in this paper that the higher order ANCF beam element can be used effectively to capture warping and eliminate Poisson locking that characterizes lower order ANCF finite elements. It is also shown that increasing the degree of continuity requires a special attention in order to have acceptable results. Because higher order elements can be more computationally expensive than the lower order elements, the use of reduced integration for evaluating the stress forces and the use of explicit and implicit numerical integrations to solve the nonlinear dynamic equations of motion are investigated in this paper. It is shown that the use of some of these integration methods can be very effective in reducing the CPU time without adversely affecting the solution accuracy.

  17. Status report on the 'Merging' of the Electron-Cloud Code POSINST with the 3-D Accelerator PIC CODE WARP

    Energy Technology Data Exchange (ETDEWEB)

    Vay, J.-L.; Furman, M.A.; Azevedo, A.W.; Cohen, R.H.; Friedman, A.; Grote, D.P.; Stoltz, P.H.

    2004-04-19

    We have integrated the electron-cloud code POSINST [1] with WARP [2]--a 3-D parallel Particle-In-Cell accelerator code developed for Heavy Ion Inertial Fusion--so that the two can interoperate. Both codes are run in the same process, communicate through a Python interpreter (already used in WARP), and share certain key arrays (so far, particle positions and velocities). Currently, POSINST provides primary and secondary sources of electrons, beam bunch kicks, a particle mover, and diagnostics. WARP provides the field solvers and diagnostics. Secondary emission routines are provided by the Tech-X package CMEE.

  18. Triply coupled vibrational band gap in a periodic and nonsymmetrical axially loaded thin-walled Bernoulli-Euler beam including the warping effect

    International Nuclear Information System (INIS)

    Yu Dianlong; Fang Jianyu; Cai Li; Han Xiaoyun; Wen Jihong

    2009-01-01

    The propagation of triply coupled vibrations in a periodic, nonsymmetrical and axially loaded thin-walled Bernoulli-Euler beam composed of two kinds of materials is investigated with the transfer matrix method. The cross-section of the beam lacks symmetrical axes, and bending vibrations in the two perpendicular directions are coupled with torsional vibrations. Furthermore, the effect of warping stiffness is included. The band structures of the periodic beam, both including and excluding the warping effect, are obtained. The frequency response function of the finite periodic beam is simulated with the finite element method. These simulations show large vibration-based attenuation in the frequency range of the gap, as expected. By comparing the band structure of the beam with plane wave expansion method calculations that are available in the literature, one finds that including the warping effect leads to a more accurate simulation. The effects of warping stiffness and axial force on the band structure are also discussed.

  19. Semi-automated Anatomical Labeling and Inter-subject Warping of High-Density Intracranial Recording Electrodes in Electrocorticography

    Directory of Open Access Journals (Sweden)

    Liberty S. Hamilton

    2017-10-01

    Full Text Available In this article, we introduce img_pipe, our open source python package for preprocessing of imaging data for use in intracranial electrocorticography (ECoG and intracranial stereo-EEG analyses. The process of electrode localization, labeling, and warping for use in ECoG currently varies widely across laboratories, and it is usually performed with custom, lab-specific code. This python package aims to provide a standardized interface for these procedures, as well as code to plot and display results on 3D cortical surface meshes. It gives the user an easy interface to create anatomically labeled electrodes that can also be warped to an atlas brain, starting with only a preoperative T1 MRI scan and a postoperative CT scan. We describe the full capabilities of our imaging pipeline and present a step-by-step protocol for users.

  20. Conference: Probing the warped side of our Universe with gravitational waves and computer simulations | 16 September | Uni Dufour

    CERN Multimedia

    2016-01-01

    Probing the warped side of our Universe with gravitational waves and computer simulations, by Kip Thorne, recipient of the Tomalla Prize for Gravity 2016.   "Probing the warped side of our Universe with gravitational waves and computer simulations" Uni Dufour - Auditorium U300 Friday, 16 September at 6 p.m.   Kip Thorne. (Photo: ©Jon Rou) Abstract: A half century ago, John Wheeler challenged his students and colleagues to explore Geometrodynamics: the nonlinear dynamics of curved spacetime. How does the curvature of spacetime behave when roiled in a storm, like a storm at sea with crashing waves. We tried to explore this, and failed. Success eluded us until two new tools became available: computer simulations, and gravitational wave observations. Thorne will describe what these have begun to teach us, and he will offer a vision for the future of Geometrodynamics.

  1. A parallel approximate string matching under Levenshtein distance on graphics processing units using warp-shuffle operations.

    Directory of Open Access Journals (Sweden)

    ThienLuan Ho

    Full Text Available Approximate string matching with k-differences has a number of practical applications, ranging from pattern recognition to computational biology. This paper proposes an efficient memory-access algorithm for parallel approximate string matching with k-differences on Graphics Processing Units (GPUs. In the proposed algorithm, all threads in the same GPUs warp share data using warp-shuffle operation instead of accessing the shared memory. Moreover, we implement the proposed algorithm by exploiting the memory structure of GPUs to optimize its performance. Experiment results for real DNA packages revealed that the performance of the proposed algorithm and its implementation archived up to 122.64 and 1.53 times compared to that of sequential algorithm on CPU and previous parallel approximate string matching algorithm on GPUs, respectively.

  2. Stability of zero-mode Landau levels in bilayer graphene against disorder in the presence of the trigonal warping

    International Nuclear Information System (INIS)

    Kawarabayashi, Tohru; Hasugai, Yasuhiro; Aoki, Hideo

    2013-01-01

    The stability of the zero-energy Landau levels in bilayer graphene against the chiral symmetric disorder is examined in the presence of the trigonal warping. Based on the tight-binding lattice model with a bond disorder correlated over several lattice constants, it is shown that among the four Landau levels per spin and per valley, two Landau levels exhibit the anomalous sharpness as in the absence of the trigonal warping, while the other two are broadened, yielding split peaks in the density of states. This can be attributed to the fact that the total chirality in each valley is ±2, which is protected topologically even in the presence of an intra-valley scattering due to disorder

  3. A WARP IN PROGRESS: H I AND RADIO CONTINUUM OBSERVATIONS OF THE SPIRAL NGC 3145

    International Nuclear Information System (INIS)

    Kaufman, Michele; Brinks, Elias; Struck, Curtis; Elmegreen, Bruce G.; Elmegreen, Debra M.

    2015-01-01

    VLA H i observations and λ6 cm radio continuum observations are presented of the barred-spiral galaxy NGC 3145. In optical images NGC 3145 has stellar arms that appear to cross, forming “X”-features. Our radio continuum observations rule out shock fronts at three of the four “X”-features, and our H i data provide evidence of gas motions perpendicular to the disk of NGC 3145. In large portions of NGC 3145, particularly in the middle-to-outer disk, the H i line profiles are skewed. Relative to the disk, the gas in the skewed wing of the line profiles has z-motions away from us on the approaching side of the galaxy and z-motions of about the same magnitude (∼40 km s −1 ) toward us on the receding side. These warping motions imply that there has been a perturbation with a sizeable component perpendicular to the disk over large spatial scales. Two features in NGC 3145 have velocities indicating that they are out-of-plane tidal arms. One is an apparent branch of a main spiral arm on the northeastern side of NGC 3145; the velocity of the branch is ∼150 km s −1 greater than the spiral arm where they appear to intersect in projection. The other is the arm on the southwestern side that forms three of the “X”-features. It differs in velocity by ∼56 km s −1 from that of the disk at the same projected location. H i observations are presented also of the two small companions NGC 3143 and PGC 029578. Based on its properties (enhanced SFR, H i emission 50% more extended on its northeastern side, etc.), NGC 3143 is the more likely of the two companions to have interacted with NGC 3145 recently. A simple analytic model demonstrates that an encounter between NGC 3143 and NGC 3145 is a plausible explanation for the observed warping motions in NGC 3145

  4. A WARP IN PROGRESS: H I AND RADIO CONTINUUM OBSERVATIONS OF THE SPIRAL NGC 3145

    Energy Technology Data Exchange (ETDEWEB)

    Kaufman, Michele [110 Westchester Rd, Newton, MA 02458 (United States); Brinks, Elias [University of Hertfordshire, Centre for Astrophysics Research, College Lane, Hatfield AL10 9AB (United Kingdom); Struck, Curtis [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Elmegreen, Bruce G. [IBM Research Division, T.J. Watson Research Center, 1101 Kitchawan Rd., Yorktown Heights, NY 10598 (United States); Elmegreen, Debra M., E-mail: kaufmanrallis@icloud.com, E-mail: E.Brinks@herts.ac.uk, E-mail: curt@iastate.edu, E-mail: bge@us.ibm.com, E-mail: elmegreen@vassar.edu [Department of Physics and Astronomy, Vassar College, 124 Raymond Av., Poughkeepsie, NY 12604 (United States)

    2015-09-15

    VLA H i observations and λ6 cm radio continuum observations are presented of the barred-spiral galaxy NGC 3145. In optical images NGC 3145 has stellar arms that appear to cross, forming “X”-features. Our radio continuum observations rule out shock fronts at three of the four “X”-features, and our H i data provide evidence of gas motions perpendicular to the disk of NGC 3145. In large portions of NGC 3145, particularly in the middle-to-outer disk, the H i line profiles are skewed. Relative to the disk, the gas in the skewed wing of the line profiles has z-motions away from us on the approaching side of the galaxy and z-motions of about the same magnitude (∼40 km s{sup −1}) toward us on the receding side. These warping motions imply that there has been a perturbation with a sizeable component perpendicular to the disk over large spatial scales. Two features in NGC 3145 have velocities indicating that they are out-of-plane tidal arms. One is an apparent branch of a main spiral arm on the northeastern side of NGC 3145; the velocity of the branch is ∼150 km s{sup −1} greater than the spiral arm where they appear to intersect in projection. The other is the arm on the southwestern side that forms three of the “X”-features. It differs in velocity by ∼56 km s{sup −1} from that of the disk at the same projected location. H i observations are presented also of the two small companions NGC 3143 and PGC 029578. Based on its properties (enhanced SFR, H i emission 50% more extended on its northeastern side, etc.), NGC 3143 is the more likely of the two companions to have interacted with NGC 3145 recently. A simple analytic model demonstrates that an encounter between NGC 3143 and NGC 3145 is a plausible explanation for the observed warping motions in NGC 3145.

  5. MyDTW - Dynamic Time Warping program for stratigraphical time series

    Science.gov (United States)

    Kotov, Sergey; Paelike, Heiko

    2017-04-01

    One of the general tasks in many geological disciplines is matching of one time or space signal to another. It can be classical correlation between two cores or cross-sections in sedimentology or marine geology. For example, tuning a paleoclimatic signal to a target curve, driven by variations in the astronomical parameters, is a powerful technique to construct accurate time scales. However, these methods can be rather time-consuming and can take ours of routine work even with the help of special semi-automatic software. Therefore, different approaches to automate the processes have been developed during last decades. Some of them are based on classical statistical cross-correlations such as the 'Correlator' after Olea [1]. Another ones use modern ideas of dynamic programming. A good example is as an algorithm developed by Lisiecki and Lisiecki [2] or dynamic time warping based algorithm after Pälike [3]. We introduce here an algorithm and computer program, which are also stemmed from the Dynamic Time Warping algorithm class. Unlike the algorithm of Lisiecki and Lisiecki, MyDTW does not lean on a set of penalties to follow geological logics, but on a special internal structure and specific constrains. It differs also from [3] in basic ideas of implementation and constrains design. The algorithm is implemented as a computer program with a graphical user interface using Free Pascal and Lazarus IDE and available for Windows, Mac OS, and Linux. Examples with synthetic and real data are demonstrated. Program is available for free download at http://www.marum.de/Sergey_Kotov.html . References: 1. Olea, R.A. Expert systems for automated correlation and interpretation of wireline logs // Math Geol (1994) 26: 879. doi:10.1007/BF02083420 2. Lisiecki L. and Lisiecki P. Application of dynamic programming to the correlation of paleoclimate records // Paleoceanography (2002), Volume 17, Issue 4, pp. 1-1, CiteID 1049, doi: 10.1029/2001PA000733 3. Pälike, H. Extending the

  6. Using acoustic analysis to presort warp-prone ponderosa pine 2 by 4s before kiln-drying

    Science.gov (United States)

    Xiping Wang; William T. Simpson

    2006-01-01

    This study evaluated the potential of acoustic analysis as presorting criteria to identify warp-prone boards before kiln-drying. Dimension lumber, 38 by 89 mm (nominal 2 by 4 in.) and 2.44 m (8 it) long, sawn from open-grown small-diameter ponderosa pine trees, was acoustically tested lengthwise at green condition. Three acoustic properties (acoustic speed, rate of...

  7. An accurate and rapid continuous wavelet dynamic time warping algorithm for unbalanced global mapping in nanopore sequencing

    KAUST Repository

    Han, Renmin

    2017-12-24

    Long-reads, point-of-care, and PCR-free are the promises brought by nanopore sequencing. Among various steps in nanopore data analysis, the global mapping between the raw electrical current signal sequence and the expected signal sequence from the pore model serves as the key building block to base calling, reads mapping, variant identification, and methylation detection. However, the ultra-long reads of nanopore sequencing and an order of magnitude difference in the sampling speeds of the two sequences make the classical dynamic time warping (DTW) and its variants infeasible to solve the problem. Here, we propose a novel multi-level DTW algorithm, cwDTW, based on continuous wavelet transforms with different scales of the two signal sequences. Our algorithm starts from low-resolution wavelet transforms of the two sequences, such that the transformed sequences are short and have similar sampling rates. Then the peaks and nadirs of the transformed sequences are extracted to form feature sequences with similar lengths, which can be easily mapped by the original DTW. Our algorithm then recursively projects the warping path from a lower-resolution level to a higher-resolution one by building a context-dependent boundary and enabling a constrained search for the warping path in the latter. Comprehensive experiments on two real nanopore datasets on human and on Pandoraea pnomenusa, as well as two benchmark datasets from previous studies, demonstrate the efficiency and effectiveness of the proposed algorithm. In particular, cwDTW can almost always generate warping paths that are very close to the original DTW, which are remarkably more accurate than the state-of-the-art methods including FastDTW and PrunedDTW. Meanwhile, on the real nanopore datasets, cwDTW is about 440 times faster than FastDTW and 3000 times faster than the original DTW. Our program is available at https://github.com/realbigws/cwDTW.

  8. A Robust In-Situ Warp-Correction Algorithm For VISAR Streak Camera Data at the National Ignition Facility

    International Nuclear Information System (INIS)

    Labaria, George R.; Warrick, Abbie L.; Celliers, Peter M.; Kalantar, Daniel H.

    2015-01-01

    The National Ignition Facility (NIF) at the Lawrence Livermore National Laboratory is a 192-beam pulsed laser system for high-energy-density physics experiments. Sophisticated diagnostics have been designed around key performance metrics to achieve ignition. The Velocity Interferometer System for Any Reflector (VISAR) is the primary diagnostic for measuring the timing of shocks induced into an ignition capsule. The VISAR system utilizes three streak cameras; these streak cameras are inherently nonlinear and require warp corrections to remove these nonlinear effects. A detailed calibration procedure has been developed with National Security Technologies (NSTec) and applied to the camera correction analysis in production. However, the camera nonlinearities drift over time, affecting the performance of this method. An in-situ fiber array is used to inject a comb of pulses to generate a calibration correction in order to meet the timing accuracy requirements of VISAR. We develop a robust algorithm for the analysis of the comb calibration images to generate the warp correction that is then applied to the data images. Our algorithm utilizes the method of thin-plate splines (TPS) to model the complex nonlinear distortions in the streak camera data. In this paper, we focus on the theory and implementation of the TPS warp-correction algorithm for the use in a production environment.

  9. A rotating and warping projector/backprojector for fan-beam and cone-beam iterative algorithm

    International Nuclear Information System (INIS)

    Zeng, G.L.; Hsieh, Y.L.; Gullberg, G.T.

    1994-01-01

    A rotating-and-warping projector/backprojector is proposed for iterative algorithms used to reconstruct fan-beam and cone-beam single photon emission computed tomography (SPECT) data. The development of a new projector/backprojector for implementing attenuation, geometric point response, and scatter models is motivated by the need to reduce the computation time yet to preserve the fidelity of the corrected reconstruction. At each projection angle, the projector/backprojector first rotates the image volume so that the pixelized cube remains parallel to the detector, and then warps the image volume so that the fan-beam and cone-beam rays are converted into parallel rays. In the authors implementation, these two steps are combined so that the interpolation of voxel values are performed only once. The projection operation is achieved by a simple weighted summation, and the backprojection operation is achieved by copying weighted projection array values to the image volume. An advantage of this projector/backprojector is that the system point response function can be deconvolved via the Fast Fourier Transform using the shift-invariant property of the point response when the voxel-to-detector distance is constant. The fan-beam and cone-beam rotating-and-warping projector/backprojector is applied to SPECT data showing improved resolution

  10. A Robust In-Situ Warp-Correction Algorithm For VISAR Streak Camera Data at the National Ignition Facility

    Energy Technology Data Exchange (ETDEWEB)

    Labaria, George R. [Univ. of California, Santa Cruz, CA (United States); Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Warrick, Abbie L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Celliers, Peter M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kalantar, Daniel H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-01-12

    The National Ignition Facility (NIF) at the Lawrence Livermore National Laboratory is a 192-beam pulsed laser system for high-energy-density physics experiments. Sophisticated diagnostics have been designed around key performance metrics to achieve ignition. The Velocity Interferometer System for Any Reflector (VISAR) is the primary diagnostic for measuring the timing of shocks induced into an ignition capsule. The VISAR system utilizes three streak cameras; these streak cameras are inherently nonlinear and require warp corrections to remove these nonlinear effects. A detailed calibration procedure has been developed with National Security Technologies (NSTec) and applied to the camera correction analysis in production. However, the camera nonlinearities drift over time, affecting the performance of this method. An in-situ fiber array is used to inject a comb of pulses to generate a calibration correction in order to meet the timing accuracy requirements of VISAR. We develop a robust algorithm for the analysis of the comb calibration images to generate the warp correction that is then applied to the data images. Our algorithm utilizes the method of thin-plate splines (TPS) to model the complex nonlinear distortions in the streak camera data. In this paper, we focus on the theory and implementation of the TPS warp-correction algorithm for the use in a production environment.

  11. Implementasi dan Analisis Teknik Reduksi PAPR OFDM Menggunakan Metode PTS pada WARP

    Directory of Open Access Journals (Sweden)

    Rizkha Ajeng Rochmatika

    2017-01-01

    Full Text Available Sistem OFDM cocok digunakan sebagai solusi yang dapat memenuhi layanan komunikasi data kecepatan tinggi karena memiliki efisiensi bandwidth dengan performansi terbaik. Namun dalam implementasinya, sistem OFDM memiliki kelemahan yang disebabkan oleh tingginya nilai Peak to Average Power Ratio (PAPR sehingga sinyal OFDM rentan terkena distorsi nonlinear yang disebabkan oleh adanya komponen RF power amplifier yang menyebabkan kompleksitas komponen Analog to Digital Converter (ADC yang terdapat pada Wireless Open Access Research Platform (WARP. Nilai PAPR yang besar pada OFDM membutuhkan power amplifier dengan dynamic range yang lebar untuk mengakomodasi sinyal, apabila hal tersebut tidak terpenuhi maka menyebabkan distorsi nonlinear dan pada akhirnya menurunkan performansi OFDM. Oleh karena itu, untuk mengatasinya dibutuhkan suatu metode yang dapat mereduksi nilai PAPR salah satunya menggunakan metode PTS. Guna melihat unjuk kerja teknik PTS, maka pada penelitian ini dibandingkan dua skema antara sistem OFDM tanpa dan dengan teknik PTS menggunakan analisa pada bit error rate dan nilai CCDF. Dari hasil pengukuran menunjukkan bahwa implementasi kinerja teknik PTS mampu meningkatkan kinerja sistem OFDM saat terkena distorsi nonlinear, terlihat pada pengukuran dengan modulasi 16-QAM untuk gain 56 didapatkan peningkatan BER sebesar 95.98%. Sedangkan pada grafik CCDF terjadi penurunan nilai PAPR sebesar 34.17% untuk M=4.

  12. Revealing asymmetries in the HD 181327 debris disk: A recent massive collision or interstellar medium warping

    Energy Technology Data Exchange (ETDEWEB)

    Stark, Christopher C.; Kuchner, Marc J. [NASA Goddard Space Flight Center, Exoplanets and Stellar Astrophysics Laboratory, Code 667, Greenbelt, MD 20771 (United States); Schneider, Glenn [Steward Observatory, The University of Arizona, Tucson, AZ 85721 (United States); Weinberger, Alycia J. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015 (United States); Debes, John H. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Grady, Carol A. [Eureka Scientific, 2452 Delmer, Suite 100, Oakland, CA 96002 (United States); Jang-Condell, Hannah, E-mail: christopher.c.stark@nasa.gov [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82071 (United States)

    2014-07-01

    New multi-roll coronagraphic images of the HD 181327 debris disk obtained using the Space Telescope Imaging Spectrograph on board the Hubble Space Telescope reveal the debris ring in its entirety at high signal-to-noise ratio and unprecedented spatial resolution. We present and apply a new multi-roll image processing routine to identify and further remove quasi-static point-spread function-subtraction residuals and quantify systematic uncertainties. We also use a new iterative image deprojection technique to constrain the true disk geometry and aggressively remove any surface brightness asymmetries that can be explained without invoking dust density enhancements/deficits. The measured empirical scattering phase function for the disk is more forward scattering than previously thought and is not well-fit by a Henyey-Greenstein function. The empirical scattering phase function varies with stellocentric distance, consistent with the expected radiation pressured-induced size segregation exterior to the belt. Within the belt, the empirical scattering phase function contradicts unperturbed debris ring models, suggesting the presence of an unseen planet. The radial profile of the flux density is degenerate with a radially varying scattering phase function; therefore estimates of the ring's true width and edge slope may be highly uncertain. We detect large scale asymmetries in the disk, consistent with either the recent catastrophic disruption of a body with mass >1% the mass of Pluto, or disk warping due to strong interactions with the interstellar medium.

  13. Revealing Asymmetries in the HD 181327 Debris Disk: A Recent Massive Collision or Interstellar Medium Warping

    Science.gov (United States)

    Stark, Christopher C.; Schneider, Glenn; Weinberger, Alycia J.; Debes, John H.; Grady, Carol A.; Jang-Condell, Hannah; Kuchner, Marc J.

    2014-07-01

    New multi-roll coronagraphic images of the HD 181327 debris disk obtained using the Space Telescope Imaging Spectrograph on board the Hubble Space Telescope reveal the debris ring in its entirety at high signal-to-noise ratio and unprecedented spatial resolution. We present and apply a new multi-roll image processing routine to identify and further remove quasi-static point-spread function-subtraction residuals and quantify systematic uncertainties. We also use a new iterative image deprojection technique to constrain the true disk geometry and aggressively remove any surface brightness asymmetries that can be explained without invoking dust density enhancements/deficits. The measured empirical scattering phase function for the disk is more forward scattering than previously thought and is not well-fit by a Henyey-Greenstein function. The empirical scattering phase function varies with stellocentric distance, consistent with the expected radiation pressured-induced size segregation exterior to the belt. Within the belt, the empirical scattering phase function contradicts unperturbed debris ring models, suggesting the presence of an unseen planet. The radial profile of the flux density is degenerate with a radially varying scattering phase function; therefore estimates of the ring's true width and edge slope may be highly uncertain. We detect large scale asymmetries in the disk, consistent with either the recent catastrophic disruption of a body with mass >1% the mass of Pluto, or disk warping due to strong interactions with the interstellar medium.

  14. Nanopatterning Gold by Templated Solid State Dewetting on the Silica Warp and Weft of Diatoms

    Directory of Open Access Journals (Sweden)

    Jon Hiltz

    2016-01-01

    Full Text Available The diatom, Nitzschia palea, exhibits complex silica shell (frustule topography that resembles the warp and weft pattern of woven glass. The surface is perforated with a rhombic lattice of roughly oblong pores between periodically undulating transverse weft costae. Exfoliated frustules can be used to template gold nanoparticles by thermally induced dewetting of thin gold films. Acting as templates for the process, the frustules give rise to two coexisting hierarchies of particle sizes and patterned distributions of nanoparticles. By examining temperature dependent dewetting of 5, 10, and 15 nm Au films for various annealing times, we establish conditions for particle formation and patterning. The 5 nm film gives distributions of small particles randomly distributed over the surface and multiple particles at the rhombic lattice points in the pores. Thicker films yield larger faceted particles on the surface and particles that exhibit shapes that are roughly conformal with the shape of the pore container. The pores and costae are sources of curvature instabilities in the film that lead to mass transport of gold and selective accumulation in the weft valleys and pores. We suggest that, with respect to dewetting, the frustule comprises 2-dimensional sublattices of trapping sites. The pattern of dewetting is radically altered by interposing a self-assembled molecular adhesive of mercaptopropyltrimethoxysilane between the Au film overlayer and the frustule. By adjusting the interfacial energy in this manner, a fractal-like overlay of Au islands coexists with a periodic distribution of nanoparticles in the pores.

  15. Incremental fuzzy C medoids clustering of time series data using dynamic time warping distance

    Science.gov (United States)

    Chen, Jingli; Wu, Shuai; Liu, Zhizhong; Chao, Hao

    2018-01-01

    Clustering time series data is of great significance since it could extract meaningful statistics and other characteristics. Especially in biomedical engineering, outstanding clustering algorithms for time series may help improve the health level of people. Considering data scale and time shifts of time series, in this paper, we introduce two incremental fuzzy clustering algorithms based on a Dynamic Time Warping (DTW) distance. For recruiting Single-Pass and Online patterns, our algorithms could handle large-scale time series data by splitting it into a set of chunks which are processed sequentially. Besides, our algorithms select DTW to measure distance of pair-wise time series and encourage higher clustering accuracy because DTW could determine an optimal match between any two time series by stretching or compressing segments of temporal data. Our new algorithms are compared to some existing prominent incremental fuzzy clustering algorithms on 12 benchmark time series datasets. The experimental results show that the proposed approaches could yield high quality clusters and were better than all the competitors in terms of clustering accuracy. PMID:29795600

  16. Incremental fuzzy C medoids clustering of time series data using dynamic time warping distance.

    Science.gov (United States)

    Liu, Yongli; Chen, Jingli; Wu, Shuai; Liu, Zhizhong; Chao, Hao

    2018-01-01

    Clustering time series data is of great significance since it could extract meaningful statistics and other characteristics. Especially in biomedical engineering, outstanding clustering algorithms for time series may help improve the health level of people. Considering data scale and time shifts of time series, in this paper, we introduce two incremental fuzzy clustering algorithms based on a Dynamic Time Warping (DTW) distance. For recruiting Single-Pass and Online patterns, our algorithms could handle large-scale time series data by splitting it into a set of chunks which are processed sequentially. Besides, our algorithms select DTW to measure distance of pair-wise time series and encourage higher clustering accuracy because DTW could determine an optimal match between any two time series by stretching or compressing segments of temporal data. Our new algorithms are compared to some existing prominent incremental fuzzy clustering algorithms on 12 benchmark time series datasets. The experimental results show that the proposed approaches could yield high quality clusters and were better than all the competitors in terms of clustering accuracy.

  17. PRACTICAL CONTRIBUTIONS TO THE STUDY OF RESISTANCE ASSEMBLIES MADE WITH WARP KNITS

    Directory of Open Access Journals (Sweden)

    OANA Ioan-Pavel

    2014-05-01

    Full Text Available Based on the principle that a body to be obtained by sewing the material to provide resistance and the like in the stitching assembly, the experimental study of which developed resistance is compared with the resistance materials to effectively assembled by the assembly line. The experimental values resistance for assemblies were obtained in the testing for resistance to sliding stitch ASTM D 434 using Tinius Olsen HK5T test type machine. The assembly strength was determined for warp knitted fabric and satin charmeuse, made of poly-filamentary wires and mono-filament polyester and polyamide. Resistance assembling is one of the major determinants of the quality of the stitching. It is defined as "the tensile strength or friction." Tenacity stitching seam rupture is the force recorded at its weakest point. Seam abrasion resistance is the number of cycles required friction mesh destruction of seam. It can be said that the strength of the used assembly, the seam 301 is achieved by, in most of the cases, lower resistance knitted studied. In these cases, the primary findings presented, it is clear that the assembly is not appropriate in terms of reliability and maintainability of the product. Such a situation requires a first step to change the type (class of stitch used. Another way to remedy the deficiencies could be using a sewing thread with a lower finesse or strength in grain, especially in the upper loop of wire used in the study-specific.

  18. Probabilistic wind power forecasting with online model selection and warped gaussian process

    International Nuclear Information System (INIS)

    Kou, Peng; Liang, Deliang; Gao, Feng; Gao, Lin

    2014-01-01

    Highlights: • A new online ensemble model for the probabilistic wind power forecasting. • Quantifying the non-Gaussian uncertainties in wind power. • Online model selection that tracks the time-varying characteristic of wind generation. • Dynamically altering the input features. • Recursive update of base models. - Abstract: Based on the online model selection and the warped Gaussian process (WGP), this paper presents an ensemble model for the probabilistic wind power forecasting. This model provides the non-Gaussian predictive distributions, which quantify the non-Gaussian uncertainties associated with wind power. In order to follow the time-varying characteristics of wind generation, multiple time dependent base forecasting models and an online model selection strategy are established, thus adaptively selecting the most probable base model for each prediction. WGP is employed as the base model, which handles the non-Gaussian uncertainties in wind power series. Furthermore, a regime switch strategy is designed to modify the input feature set dynamically, thereby enhancing the adaptiveness of the model. In an online learning framework, the base models should also be time adaptive. To achieve this, a recursive algorithm is introduced, thus permitting the online updating of WGP base models. The proposed model has been tested on the actual data collected from both single and aggregated wind farms

  19. Elastic Wave-equation Reflection Traveltime Inversion Using Dynamic Warping and Wave Mode Decomposition

    KAUST Repository

    Wang, T.

    2017-05-26

    Elastic full waveform inversion (EFWI) provides high-resolution parameter estimation of the subsurface but requires good initial guess of the true model. The traveltime inversion only minimizes traveltime misfits which are more sensitive and linearly related to the low-wavenumber model perturbation. Therefore, building initial P and S wave velocity models for EFWI by using elastic wave-equation reflections traveltime inversion (WERTI) would be effective and robust, especially for the deeper part. In order to distinguish the reflection travletimes of P or S-waves in elastic media, we decompose the surface multicomponent data into vector P- and S-wave seismogram. We utilize the dynamic image warping to extract the reflected P- or S-wave traveltimes. The P-wave velocity are first inverted using P-wave traveltime followed by the S-wave velocity inversion with S-wave traveltime, during which the wave mode decomposition is applied to the gradients calculation. Synthetic example on the Sigbee2A model proves the validity of our method for recovering the long wavelength components of the model.

  20. Warp simulations for capture and control of laser-accelerated proton beams

    International Nuclear Information System (INIS)

    Nuernberg, Frank; Harres, K; Roth, M; Friedman, A; Grote, D P; Logan, B G; Schollmeier, M

    2010-01-01

    The capture of laser-accelerated proton beams accompanied by co-moving electrons via a solenoid field has been studied with particle-in-cell simulations. The main advantages of the Warp simulation suite that we have used, relative to envelope or tracking codes, are the possibility of including all source parameters energy resolved, adding electrons as second species and considering the non-negligible space-charge forces and electrostatic self-fields. It was observed that the influence of the electrons is of vital importance. The magnetic effect on the electrons outbalances the space-charge force. Hence, the electrons are forced onto the beam axis and attract protons. Beside the energy dependent proton density increase on axis, the change in the particle spectrum is also important for future applications. Protons are accelerated/decelerated slightly, electrons highly. 2/3 of all electrons get lost directly at the source and 27% of all protons hit the inner wall of the solenoid.

  1. An HMM-Like Dynamic Time Warping Scheme for Automatic Speech Recognition

    Directory of Open Access Journals (Sweden)

    Ing-Jr Ding

    2014-01-01

    Full Text Available In the past, the kernel of automatic speech recognition (ASR is dynamic time warping (DTW, which is feature-based template matching and belongs to the category technique of dynamic programming (DP. Although DTW is an early developed ASR technique, DTW has been popular in lots of applications. DTW is playing an important role for the known Kinect-based gesture recognition application now. This paper proposed an intelligent speech recognition system using an improved DTW approach for multimedia and home automation services. The improved DTW presented in this work, called HMM-like DTW, is essentially a hidden Markov model- (HMM- like method where the concept of the typical HMM statistical model is brought into the design of DTW. The developed HMM-like DTW method, transforming feature-based DTW recognition into model-based DTW recognition, will be able to behave as the HMM recognition technique and therefore proposed HMM-like DTW with the HMM-like recognition model will have the capability to further perform model adaptation (also known as speaker adaptation. A series of experimental results in home automation-based multimedia access service environments demonstrated the superiority and effectiveness of the developed smart speech recognition system by HMM-like DTW.

  2. Warped solitonic deformations and propagation of black holes in 5D vacuum gravity

    International Nuclear Information System (INIS)

    Vacaru, Sergiu I; Singleton, D

    2002-01-01

    In this paper we use the anholonomic frames method to construct exact solutions for vacuum 5D gravity with metrics having off-diagonal components. The solutions are, in general, anisotropic and possess interesting features such as an anisotropic warp factor with respect to the extra dimension, or a gravitational scaling/running of some of the physical parameters associated with the solutions. A certain class of solutions is found to describe Schwarzschild black holes which 'solitonically' propagate in spacetime. The solitonic character of these black-hole solutions arises from the embedding of the sine-Gordon soliton configuration into certain ansatz functions of the 5D metric. These solitonic solutions may either violate or preserve local Lorentz invariance. In addition, there is a connection between these solutions and non-commutative field theory. In addition to the possible physical applications of the solutions presented here, this paper is meant to illustrate the strength of the anholonomic frames method in handling anisotropic solutions of the gravitational field equations

  3. Realistic D-brane models on warped throats: Fluxes, hierarchies and moduli stabilization

    International Nuclear Information System (INIS)

    Cascales, J.F.G.; Garcia del Moral, M.P.; Quevedo, F.; Uranga, A.

    2004-01-01

    We describe the construction of string theory models with semirealistic spectrum in a sector of (anti) D3-branes located at an orbifold singularity at the bottom of a highly warped throat geometry, which is a generalisation of the Klebanov-Strassler deformed conifold. These models realise the Randall-Sundrum proposal to naturally generate the Planck/electroweak hierarchy in a concrete string theory embedding, and yielding interesting chiral open string spectra. We describe examples with Standard Model gauge group (or left-right symmetric extensions) and three families of SM fermions, with correct quantum numbers including hypercharge. The dilaton and complex structure moduli of the geometry are stabilised by the 3-form fluxes required to build the throat. We describe diverse issues concerning the stabilisation of geometric Kahler moduli, like blow-up modes of the orbifold singularities, via D term potentials and gauge theory non-perturbative effects, like gaugino condensation. This local geometry, once embedded in a full compactification, could give rise to models with all moduli stabilised, and with the potential to lead to de Sitter vacua. Issues of gauge unification, proton stability, supersymmetry breaking and Yukawa couplings are also discussed. (author)

  4. The Woof and the Warp of Architecture: The Figure-Ground in Urban Design

    Directory of Open Access Journals (Sweden)

    B.D. Wortham-Galvin

    2014-08-01

    Full Text Available To borrow a metaphor used by Georg W.F. Hegel in the Philosophy of History to describe historical processes, architecture should be understood as a series of complex threads wherein one recognizes the physical forms as the warp, and the temporal, socio-political, natural, and aural contexts as the woof. Fabric is asserted as a concept broader than the immediate spatial and physical situation in which individual buildings are located; and, the threads of the fabric are all of those elements that aid in making the built environment both a designed and lived experience.In order to discuss this proposed understanding of fabric, this paper will look at how drawings informed the process and theory of urban design in the mid- to late-twentieth century. The discussion will focus on the origins of the Nolli plan and its 'rediscovery' by the Cornell School and their use of the figure-ground as a primary tool in the formulation of an urban design theory. The trajectory of the figure-ground can reinvigorate contemporary urban design praxis once more by reasserting drawing as more than mere illustration but as a means to conceptualize design methodologies that support a holistic notion of fabric.

  5. Higgs production and decay in models of a warped extra dimension with a bulk Higgs

    International Nuclear Information System (INIS)

    Archer, Paul R.; Carena, Marcela; Carmona, Adrian; Neubert, Matthias

    2015-01-01

    Warped extra-dimension models in which the Higgs boson is allowed to propagate in the bulk of a compact AdS 5 space are conjectured to be dual to models featuring a partially composite Higgs boson. They offer a framework with which to investigate the implications of changing the scaling dimension of the Higgs operator, which can be used to reduce the constraints from electroweak precision data. In the context of such models, we calculate the cross section for Higgs production in gluon fusion and the H → γγ decay rate and show that they are finite (at one-loop order) as a consequence of gauge invariance. The extended scalar sector comprising the Kaluza-Klein excitations of the Standard Model scalars is constructed in detail. The largest effects are due to virtual KK fermions, whose contributions to the cross section and decay rate introduce a quadratic sensitivity to the maximum allowed value y * of the random complex entries of the 5D anarchic Yukawa matrices. We find an enhancement of the gluon-fusion cross section and a reduction of the H → γγ rate as well as of the tree-level Higgs couplings to fermions and electroweak gauge bosons. As a result, we perform a detailed study of the correlated signal strengths for different production mechanisms and decay channels as functions of y * , the mass scale of Kaluza-Klein resonances and the scaling dimension of the composite Higgs operator

  6. Self-Consistent simulations of High-Intensity Beams and E-Clouds with WARP POSINST

    International Nuclear Information System (INIS)

    Vay, J.-L.; Friendman, A.; Grote, D.P.

    2006-01-01

    We have developed a new, comprehensive set of simulation tools aimed at modeling the interaction of intense ion beams and electron clouds (e-clouds). The set contains the 3-D accelerator PIC codeWARP and the 2-D ''slice'' ecloud code POSINST, as well as a merger of the two, augmented by new modules for impact ionization and neutral gas generation. The new capability runs on workstations or parallel supercomputers and contains advanced features such as mesh refinement, disparate adaptive time stepping, and a new ''drift-Lorentz'' particle mover for tracking charged particles in magnetic fields using large time steps. It is being applied to the modeling of ion beams (1 MeV, 180 mA, K+) for heavy ion inertial fusion and warm dense matter studies, as they interact with electron clouds in the High-Current Experiment (HCX). In earlier papers, we described the capabilities and presented recent simulation results with detailed comparisons against the HCX experiment, as well as their application (in a different regime) to the modeling of e-clouds in the Large Hadron Collider (LHC). We concentrate here on the description of the implementation of the ''quasi-static'' mode of operation, for comparison with other codes, and introduce a new consideration on the estimate of computing time between the quasi-static and the fully self-consistent modes

  7. Dynamic time warping and machine learning for signal quality assessment of pulsatile signals

    International Nuclear Information System (INIS)

    Li, Q; Clifford, G D

    2012-01-01

    In this work, we describe a beat-by-beat method for assessing the clinical utility of pulsatile waveforms, primarily recorded from cardiovascular blood volume or pressure changes, concentrating on the photoplethysmogram (PPG). Physiological blood flow is nonstationary, with pulses changing in height, width and morphology due to changes in heart rate, cardiac output, sensor type and hardware or software pre-processing requirements. Moreover, considerable inter-individual and sensor-location variability exists. Simple template matching methods are therefore inappropriate, and a patient-specific adaptive initialization is therefore required. We introduce dynamic time warping to stretch each beat to match a running template and combine it with several other features related to signal quality, including correlation and the percentage of the beat that appeared to be clipped. The features were then presented to a multi-layer perceptron neural network to learn the relationships between the parameters in the presence of good- and bad-quality pulses. An expert-labeled database of 1055 segments of PPG, each 6 s long, recorded from 104 separate critical care admissions during both normal and verified arrhythmic events, was used to train and test our algorithms. An accuracy of 97.5% on the training set and 95.2% on test set was found. The algorithm could be deployed as a stand-alone signal quality assessment algorithm for vetting the clinical utility of PPG traces or any similar quasi-periodic signal. (paper)

  8. Dynamic time warping and machine learning for signal quality assessment of pulsatile signals.

    Science.gov (United States)

    Li, Q; Clifford, G D

    2012-09-01

    In this work, we describe a beat-by-beat method for assessing the clinical utility of pulsatile waveforms, primarily recorded from cardiovascular blood volume or pressure changes, concentrating on the photoplethysmogram (PPG). Physiological blood flow is nonstationary, with pulses changing in height, width and morphology due to changes in heart rate, cardiac output, sensor type and hardware or software pre-processing requirements. Moreover, considerable inter-individual and sensor-location variability exists. Simple template matching methods are therefore inappropriate, and a patient-specific adaptive initialization is therefore required. We introduce dynamic time warping to stretch each beat to match a running template and combine it with several other features related to signal quality, including correlation and the percentage of the beat that appeared to be clipped. The features were then presented to a multi-layer perceptron neural network to learn the relationships between the parameters in the presence of good- and bad-quality pulses. An expert-labeled database of 1055 segments of PPG, each 6 s long, recorded from 104 separate critical care admissions during both normal and verified arrhythmic events, was used to train and test our algorithms. An accuracy of 97.5% on the training set and 95.2% on test set was found. The algorithm could be deployed as a stand-alone signal quality assessment algorithm for vetting the clinical utility of PPG traces or any similar quasi-periodic signal.

  9. Lepton-flavor universality violation in R K and {R}_{D{_{(\\ast )}}} from warped space

    Science.gov (United States)

    Megías, Eugenio; Quirós, Mariano; Salas, Lindber

    2017-07-01

    Some anomalies in the processes b → sℓℓ ( ℓ = μ, e) and b\\to cℓ {\\overline{ν}}_{ℓ } ( ℓ = τ, μ, e), in particular in the observables R K and {R}_{D{_{(\\ast )}}} , have been found by the BaBar, LHCb and Belle collaborations, leading to a possible lepton flavor universality violation. If these anomalies were confirmed they would inevitably lead to physics beyond the Standard Model. In this paper we try to accommodate the present anomalies in an extra dimensional theory, solving the naturalness problem of the Standard Model by means of a warped metric with a strong conformality violation near the infra-red brane. The R K anomaly can be accommodated provided that the left-handed bottom quark and muon lepton have some degree of compositeness in the dual theory. The theory is consistent with all electroweak and flavor observables, and with all direct searches of Kaluza-Klein electroweak gauge bosons and gluons. The fermion spectrum, and fermion mixing angles, can be reproduced by mostly elementary right-handed bottom quarks, and tau and muon leptons. Moreover the {R}_{D{_{(\\ast )}}} anomaly requires a strong degree of compositeness for the left-handed tau leptons, which turns out to be in tension with experimental data on the {g}_{τ_L}^Z coupling, possibly unless some degree of fine-tuning is introduced in the fixing of the CKM matrix.

  10. Superconformal symmetry in the Kaluza-Klein spectrum of warped AdS(3)

    Energy Technology Data Exchange (ETDEWEB)

    Schmude, Johannes; Vasilakis, Orestis [Department of Physics, Universidad de Oviedo, Avda. Calvo Sotelo 18, 33007, Oviedo (Spain)

    2016-10-18

    We study the Kaluza-Klein spectrum of warped AdS{sub 3} compactifications of type IIB with five-form flux which are dual to N=(0,2) SCFTs in two dimensions. We prove that the spectra of fluctuations of both the spin 2 sector of the graviton and the axio-dilaton are bounded. At the bound the modes have the correct quantum numbers to be chiral primaries and descendants thereof respectively. Moreover, we prove that the same modes give rise to superpartners in the dilatino spectrum. Our results show that a subset of the mesonic chiral ring of the dual SCFT is isomorphic to the first Kohn-Rossi cohomology groups. As an example, we consider the compactification of four-dimensional Y{sup p,q} theories on Riemann surfaces for the case of the universal twist. We conclude by studying fluctuations of the three-form, where we are able to identify Betti multiplets after imposing some mild assumptions.

  11. Warp simulations for capture and control of laser-accelerated proton beams

    International Nuclear Information System (INIS)

    Nurnberg, F.; Friedman, A.; Grote, D.P.; Harres, K.; Logan, B.G.; Schollmeier, M.; Roth, M.

    2009-01-01

    The capture of laser-accelerated proton beams accompanied by co-moving electrons via a solenoid field has been studied with particle-in-cell simulations. The main advantages of the Warp simulation suite that was used, relative to envelope or tracking codes, are the possibility of including all source parameters energy resolved, adding electrons as second species and considering the non-negligible space-charge forces and electrostatic self-fields. It was observed that the influence of the electrons is of vital importance. The magnetic effect on the electrons out balances the space-charge force. Hence, the electrons are forced onto the beam axis and attract protons. Besides the energy dependent proton density increase on axis, the change in the particle spectrum is also important for future applications. Protons are accelerated/decelerated slightly, electrons highly. 2/3 of all electrons get lost directly at the source and 27% of all protons hit the inner wall of the solenoid.

  12. Fault Diagnosis for Compensating Capacitors of Jointless Track Circuit Based on Dynamic Time Warping

    Directory of Open Access Journals (Sweden)

    Wei Dong

    2014-01-01

    Full Text Available Aiming at the problem of online fault diagnosis for compensating capacitors of jointless track circuit, a dynamic time warping (DTW based diagnosis method is proposed in this paper. Different from the existing related works, this method only uses the ground indoor monitoring signals of track circuit to locate the faulty compensating capacitor, not depending on the shunt current of inspection train, which is an indispensable condition for existing methods. So, it can be used for online diagnosis of compensating capacitor, which has not yet been realized by existing methods. To overcome the key problem that track circuit cannot obtain the precise position of the train, the DTW method is used for the first time in this situation to recover the function relationship between receiver’s peak voltage and shunt position. The necessity, thinking, and procedure of the method are described in detail. Besides the classical DTW based method, two improved methods for improving classification quality and reducing computation complexity are proposed. Finally, the diagnosis experiments based on the simulation model of track circuit show the effectiveness of the proposed methods.

  13. Time warping of evolutionary distant temporal gene expression data based on noise suppression

    Directory of Open Access Journals (Sweden)

    Papatsenko Dmitri

    2009-10-01

    Full Text Available Abstract Background Comparative analysis of genome wide temporal gene expression data has a broad potential area of application, including evolutionary biology, developmental biology, and medicine. However, at large evolutionary distances, the construction of global alignments and the consequent comparison of the time-series data are difficult. The main reason is the accumulation of variability in expression profiles of orthologous genes, in the course of evolution. Results We applied Pearson distance matrices, in combination with other noise-suppression techniques and data filtering to improve alignments. This novel framework enhanced the capacity to capture the similarities between the temporal gene expression datasets separated by large evolutionary distances. We aligned and compared the temporal gene expression data in budding (Saccharomyces cerevisiae and fission (Schizosaccharomyces pombe yeast, which are separated by more then ~400 myr of evolution. We found that the global alignment (time warping properly matched the duration of cell cycle phases in these distant organisms, which was measured in prior studies. At the same time, when applied to individual ortholog pairs, this alignment procedure revealed groups of genes with distinct alignments, different from the global alignment. Conclusion Our alignment-based predictions of differences in the cell cycle phases between the two yeast species were in a good agreement with the existing data, thus supporting the computational strategy adopted in this study. We propose that the existence of the alternative alignments, specific to distinct groups of genes, suggests presence of different synchronization modes between the two organisms and possible functional decoupling of particular physiological gene networks in the course of evolution.

  14. Development and Application of Watershed Regressions for Pesticides (WARP) for Estimating Atrazine Concentration Distributions in Streams

    Science.gov (United States)

    Larson, Steven J.; Crawford, Charles G.; Gilliom, Robert J.

    2004-01-01

    Regression models were developed for predicting atrazine concentration distributions in rivers and streams, using the Watershed Regressions for Pesticides (WARP) methodology. Separate regression equations were derived for each of nine percentiles of the annual distribution of atrazine concentrations and for the annual time-weighted mean atrazine concentration. In addition, seasonal models were developed for two specific periods of the year--the high season, when the highest atrazine concentrations are expected in streams, and the low season, when concentrations are expected to be low or undetectable. Various nationally available watershed parameters were used as explanatory variables, including atrazine use intensity, soil characteristics, hydrologic parameters, climate and weather variables, land use, and agricultural management practices. Concentration data from 112 river and stream stations sampled as part of the U.S. Geological Survey's National Water-Quality Assessment and National Stream Quality Accounting Network Programs were used for computing the concentration percentiles and mean concentrations used as the response variables in regression models. Tobit regression methods, using maximum likelihood estimation, were used for developing the models because some of the concentration values used for the response variables were censored (reported as less than a detection threshold). Data from 26 stations not used for model development were used for model validation. The annual models accounted for 62 to 77 percent of the variability in concentrations among the 112 model development stations. Atrazine use intensity (the amount of atrazine used in the watershed divided by watershed area) was the most important explanatory variable in all models, but additional watershed parameters significantly increased the amount of variability explained by the models. Predicted concentrations from all 10 models were within a factor of 10 of the observed concentrations at most

  15. LHC signals for singlet neutrinos from a natural warped seesaw mechanism. II

    Science.gov (United States)

    Agashe, Kaustubh; Du, Peizhi; Hong, Sungwoo

    2018-04-01

    A natural seesaw mechanism for obtaining the observed size of SM neutrino masses can arise in a warped extra-dimensional/composite Higgs framework. In a previous paper, we initiated the study of signals at the LHC for the associated ˜TeV mass SM singlet neutrinos, within a canonical model of S U (2 )L×S U (2 )R×U (1 )B-L (LR) symmetry in the composite sector, as motivated by consistency with the EW precision tests. Here, we investigate LHC signals in a different region of parameter space for the same model, where production of singlet neutrinos can occur from particles beyond those in the usual LR models. Specifically, we assume that the composite (B -L ) gauge boson is lighter than all the others in the EW sector. We show that the composite (B -L ) gauge boson can acquire a significant coupling to light quarks simply via mixing with elementary hypercharge gauge boson. Thus, the singlet neutrino can be pair-produced via decays of the(B -L ) gauge boson, without a charged current counterpart. Furthermore, there is no decay for the (B -L ) gauge boson directly into dibosons, unlike for the usual case of WR± and Z'. Independently of the above extension of the EW sector, we analyze production of singlet neutrinos in decays of composite partners of S U (2 )L doublet leptons, which are absent in the usual LR models. In turn, these doublet leptons can be produced in composite WL decays. We show that the 4 -5 σ signal can be achieved for both cases described above for the following spectrum with 3000 fb-1 luminosity: 2-2.5 TeV composite gauge bosons, 1 TeV composite doublet lepton (for the second case) and 500-750 GeV singlet neutrino.

  16. Equatorial Cross-Cutting Ripples on Titan - Regularly Warped Subsiding Methane Plains, not Eolian Dunes.

    Science.gov (United States)

    Kochemasov, G. G.

    2008-09-01

    probable. Very regular cross-cutting wavy forms hundred and thousand kilometers long have a spacing between ridges or grooves about 1-2 km (?) (PIA03555, PIA03566, PIA03567, PIA03568 ) or 10-20 km (PIA08454) -so called "cat scratches". The most long and wide ridge-groove system observed up to now (PIA08454 - a swath 6150 km long, 1120 km wide, almost a half length of the great planetary circle!) has the ridge-to-ridge spacing about 10-20 km; a width of ridges and grooves is nearly equal with variations to both sides; ridges are more bright, grooves are more dark; intersections of the ridge-groove systems creates chains of roundish features ("craters") of characteristic size (Fig. 3, 4). Observed wavy systems resemble dunes only at the first glance but actually are deformations of the ice-methane crust by very fine inertia-gravity waves aroused by the satellite movement in non-round elliptical keplerian orbit [3]. This movement with periodically changing accelerations arouse inertia-gravity forces and waves warping any celestial body notwithstanding its size, mass, density, chemical composition or physical state. In rotating bodies (but all bodies rotate!) these warping waves have a stationary character and 4 cross-cutting directions- ortho- and diagonal - producing uplifted (+), subsided (-) and neutral (0) tectonic blocks. Wavelengths are different but tied as harmonics. The fundamental wave1 produces ubiquitous tectonic dichotomy -two segments (2πR-structure), the first harmonics wave2 produces tectonic sectors (πR-structures) [1]. This structurization is adorned by individual for any body waves whose lengths are inversely proportional to their orbital frequencies: higher frequency - smaller waves and, vice versa, lower frequency - larger waves. These waves produce tectonic granules. There is a row of increasing granule sizes strictly tied to orbital frequencies: Mercury πR/16, Venus πR/6, Earth πR/4, Mars πR/2, asteroids πR/1. In this row Titan with its orbital

  17. WARP3D-Release 10.8: Dynamic Nonlinear Analysis of Solids using a Preconditioned Conjugate Gradient Software Architecture

    Science.gov (United States)

    Koppenhoefer, Kyle C.; Gullerud, Arne S.; Ruggieri, Claudio; Dodds, Robert H., Jr.; Healy, Brian E.

    1998-01-01

    This report describes theoretical background material and commands necessary to use the WARP3D finite element code. WARP3D is under continuing development as a research code for the solution of very large-scale, 3-D solid models subjected to static and dynamic loads. Specific features in the code oriented toward the investigation of ductile fracture in metals include a robust finite strain formulation, a general J-integral computation facility (with inertia, face loading), an element extinction facility to model crack growth, nonlinear material models including viscoplastic effects, and the Gurson-Tver-gaard dilatant plasticity model for void growth. The nonlinear, dynamic equilibrium equations are solved using an incremental-iterative, implicit formulation with full Newton iterations to eliminate residual nodal forces. The history integration of the nonlinear equations of motion is accomplished with Newmarks Beta method. A central feature of WARP3D involves the use of a linear-preconditioned conjugate gradient (LPCG) solver implemented in an element-by-element format to replace a conventional direct linear equation solver. This software architecture dramatically reduces both the memory requirements and CPU time for very large, nonlinear solid models since formation of the assembled (dynamic) stiffness matrix is avoided. Analyses thus exhibit the numerical stability for large time (load) steps provided by the implicit formulation coupled with the low memory requirements characteristic of an explicit code. In addition to the much lower memory requirements of the LPCG solver, the CPU time required for solution of the linear equations during each Newton iteration is generally one-half or less of the CPU time required for a traditional direct solver. All other computational aspects of the code (element stiffnesses, element strains, stress updating, element internal forces) are implemented in the element-by- element, blocked architecture. This greatly improves

  18. Toward adaptive radiotherapy for head and neck patients: Uncertainties in dose warping due to the choice of deformable registration algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Veiga, Catarina, E-mail: catarina.veiga.11@ucl.ac.uk; Royle, Gary [Radiation Physics Group, Department of Medical Physics and Biomedical Engineering, University College London, London WC1E 6BT (United Kingdom); Lourenço, Ana Mónica [Radiation Physics Group, Department of Medical Physics and Biomedical Engineering, University College London, London WC1E 6BT, United Kingdom and Acoustics and Ionizing Radiation Team, National Physical Laboratory, Teddington TW11 0LW (United Kingdom); Mouinuddin, Syed [Department of Radiotherapy, University College London Hospital, London NW1 2BU (United Kingdom); Herk, Marcel van [Department of Radiation Oncology, The Netherlands Cancer Institute, Amsterdam 1066 CX (Netherlands); Modat, Marc; Ourselin, Sébastien; McClelland, Jamie R. [Centre for Medical Image Computing, Department of Medical Physics and Biomedical Engineering, University College London, London WC1E 6BT (United Kingdom)

    2015-02-15

    Purpose: The aims of this work were to evaluate the performance of several deformable image registration (DIR) algorithms implemented in our in-house software (NiftyReg) and the uncertainties inherent to using different algorithms for dose warping. Methods: The authors describe a DIR based adaptive radiotherapy workflow, using CT and cone-beam CT (CBCT) imaging. The transformations that mapped the anatomy between the two time points were obtained using four different DIR approaches available in NiftyReg. These included a standard unidirectional algorithm and more sophisticated bidirectional ones that encourage or ensure inverse consistency. The forward (CT-to-CBCT) deformation vector fields (DVFs) were used to propagate the CT Hounsfield units and structures to the daily geometry for “dose of the day” calculations, while the backward (CBCT-to-CT) DVFs were used to remap the dose of the day onto the planning CT (pCT). Data from five head and neck patients were used to evaluate the performance of each implementation based on geometrical matching, physical properties of the DVFs, and similarity between warped dose distributions. Geometrical matching was verified in terms of dice similarity coefficient (DSC), distance transform, false positives, and false negatives. The physical properties of the DVFs were assessed calculating the harmonic energy, determinant of the Jacobian, and inverse consistency error of the transformations. Dose distributions were displayed on the pCT dose space and compared using dose difference (DD), distance to dose difference, and dose volume histograms. Results: All the DIR algorithms gave similar results in terms of geometrical matching, with an average DSC of 0.85 ± 0.08, but the underlying properties of the DVFs varied in terms of smoothness and inverse consistency. When comparing the doses warped by different algorithms, we found a root mean square DD of 1.9% ± 0.8% of the prescribed dose (pD) and that an average of 9% ± 4% of

  19. Similarity recognition of online data curves based on dynamic spatial time warping for the estimation of lithium-ion battery capacity

    Science.gov (United States)

    Tao, Laifa; Lu, Chen; Noktehdan, Azadeh

    2015-10-01

    Battery capacity estimation is a significant recent challenge given the complex physical and chemical processes that occur within batteries and the restrictions on the accessibility of capacity degradation data. In this study, we describe an approach called dynamic spatial time warping, which is used to determine the similarities of two arbitrary curves. Unlike classical dynamic time warping methods, this approach can maintain the invariance of curve similarity to the rotations and translations of curves, which is vital in curve similarity search. Moreover, it utilizes the online charging or discharging data that are easily collected and do not require special assumptions. The accuracy of this approach is verified using NASA battery datasets. Results suggest that the proposed approach provides a highly accurate means of estimating battery capacity at less time cost than traditional dynamic time warping methods do for different individuals and under various operating conditions.

  20. Two approaches towards the flavour puzzle. Dynamical minimal flavour violation and warped extra dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht, Michaela E.

    2010-08-16

    The minimal-flavour-violating (MFV) hypothesis considers the Standard Model (SM) Yukawa matrices as the only source of flavour violation. In this work, we promote their entries to dynamical scalar spurion fields, using an effective field theory approach, such that the maximal flavour symmetry (FS) of the SM gauge sector is formally restored at high energy scales. The non-vanishing vacuum expectation values of the spurions induce a sequence of FS breaking and generate the observed hierarchy in the SM quark masses and mixings. The fact that there exists no explanation for it in the SM is known as the flavour puzzle. Gauging the non-abelian subgroup of the spontaneously broken FS, we interpret the associated Goldstone bosons as the longitudinal degrees of freedom of the corresponding massive gauge bosons. Integrating out the heavy Higgs modes in the Yukawa spurions leads directly to flavour-changing neutral currents (FCNCs) at tree level. The coefficients of the effective four-quark operators, resulting from the exchange of heavy flavoured gauge bosons, strictly follow the MFV principle. On the other hand, the Goldstone bosons associated with the global abelian symmetry group behave as weakly coupled axions which can be used to solve the strong CP problem within a modified Peccei-Quinn formalism. Models with a warped fifth dimension contain five-dimensional (5D) fermion bulk mass matrices in addition to their 5D Yukawa matrices, which thus represent an additional source of flavour violation beyond MFV. They can address the flavour puzzle since their eigenvalues allow for a different localisation of the fermion zero mode profiles along the extra dimension which leads to a hierarchy in the effective four-dimensional (4D) Yukawa matrices. At the same time, the fermion splitting introduces non-universal fermion couplings to Kaluza-Klein (KK) gauge boson modes, inducing tree-level FCNCs. Within a Randall-Sundrum model with custodial protection (RSc model) we carefully work

  1. Instantaneous and Frequency-Warped Signal Processing Techniques for Auditory Source Separation.

    Science.gov (United States)

    Wang, Avery Li-Chun

    This thesis summarizes several contributions to the areas of signal processing and auditory source separation. The philosophy of Frequency-Warped Signal Processing is introduced as a means for separating the AM and FM contributions to the bandwidth of a complex-valued, frequency-varying sinusoid p (n), transforming it into a signal with slowly-varying parameters. This transformation facilitates the removal of p (n) from an additive mixture while minimizing the amount of damage done to other signal components. The average winding rate of a complex-valued phasor is explored as an estimate of the instantaneous frequency. Theorems are provided showing the robustness of this measure. To implement frequency tracking, a Frequency-Locked Loop algorithm is introduced which uses the complex winding error to update its frequency estimate. The input signal is dynamically demodulated and filtered to extract the envelope. This envelope may then be remodulated to reconstruct the target partial, which may be subtracted from the original signal mixture to yield a new, quickly-adapting form of notch filtering. Enhancements to the basic tracker are made which, under certain conditions, attain the Cramer -Rao bound for the instantaneous frequency estimate. To improve tracking, the novel idea of Harmonic -Locked Loop tracking, using N harmonically constrained trackers, is introduced for tracking signals, such as voices and certain musical instruments. The estimated fundamental frequency is computed from a maximum-likelihood weighting of the N tracking estimates, making it highly robust. The result is that harmonic signals, such as voices, can be isolated from complex mixtures in the presence of other spectrally overlapping signals. Additionally, since phase information is preserved, the resynthesized harmonic signals may be removed from the original mixtures with relatively little damage to the residual signal. Finally, a new methodology is given for designing linear-phase FIR filters

  2. Two approaches towards the flavour puzzle. Dynamical minimal flavour violation and warped extra dimensions

    International Nuclear Information System (INIS)

    Albrecht, Michaela E.

    2010-01-01

    The minimal-flavour-violating (MFV) hypothesis considers the Standard Model (SM) Yukawa matrices as the only source of flavour violation. In this work, we promote their entries to dynamical scalar spurion fields, using an effective field theory approach, such that the maximal flavour symmetry (FS) of the SM gauge sector is formally restored at high energy scales. The non-vanishing vacuum expectation values of the spurions induce a sequence of FS breaking and generate the observed hierarchy in the SM quark masses and mixings. The fact that there exists no explanation for it in the SM is known as the flavour puzzle. Gauging the non-abelian subgroup of the spontaneously broken FS, we interpret the associated Goldstone bosons as the longitudinal degrees of freedom of the corresponding massive gauge bosons. Integrating out the heavy Higgs modes in the Yukawa spurions leads directly to flavour-changing neutral currents (FCNCs) at tree level. The coefficients of the effective four-quark operators, resulting from the exchange of heavy flavoured gauge bosons, strictly follow the MFV principle. On the other hand, the Goldstone bosons associated with the global abelian symmetry group behave as weakly coupled axions which can be used to solve the strong CP problem within a modified Peccei-Quinn formalism. Models with a warped fifth dimension contain five-dimensional (5D) fermion bulk mass matrices in addition to their 5D Yukawa matrices, which thus represent an additional source of flavour violation beyond MFV. They can address the flavour puzzle since their eigenvalues allow for a different localisation of the fermion zero mode profiles along the extra dimension which leads to a hierarchy in the effective four-dimensional (4D) Yukawa matrices. At the same time, the fermion splitting introduces non-universal fermion couplings to Kaluza-Klein (KK) gauge boson modes, inducing tree-level FCNCs. Within a Randall-Sundrum model with custodial protection (RSc model) we carefully work

  3. LHC signals for singlet neutrinos from a natural warped seesaw mechanism. I

    Science.gov (United States)

    Agashe, Kaustubh; Du, Peizhi; Hong, Sungwoo

    2018-04-01

    Recently, it was shown in K. Agashe et al. [Phys. Rev. D 94, 013001 (2016), 10.1103/PhysRevD.94.013001] that a straightforward implementation of the type I seesaw mechanism in a warped extra dimensional framework is in reality a natural realization of "inverse" seesaw; i.e., the Standard Model (SM) neutrino mass is dominantly generated by exchange of pseudo-Dirac TeV-mass SM singlet neutrinos. By the AdS /CFT correspondence, this scenario is dual to these singlet particles being composites of some new strong dynamics, along with the SM Higgs boson (and possibly the top quark), with the rest of the SM particles being mostly elementary. We study signals from production of these heavy neutrinos at the Large Hadron Collider (LHC). We focus on the scenario where the strong sector has a global S U (2 )L×S U (2 )R×U (1 )X symmetry; such a left-right (LR) structure being motivated by consistency with the electroweak (EW) precision tests. The singlet neutrinos are charged under S U (2 )R×U (1 )X symmetry, thus can be produced from WR± exchange, as in four-dimensional LR symmetric models. However, the direct coupling of light quarks to WR± is negligible, due to WR± also being composite (cf. four-dimensional LR models); nonetheless, a sizable coupling can be induced by mixings among the various types of W± bosons. Furthermore, WR± decays dominantly into the singlet and composite partner of charged lepton (cf. SM lepton itself in four-dimensional LR model). This heavy charged lepton, in turn, decays into SM lepton, plus Z /Higgs , thus the latter can be used for extra identification of the signal. For a benchmark scenario with WR± of mass 2 TeV and singlet neutrino of mass 750 GeV, we find that, in both the dilepton +dijet +Higgs and trilepton +Higgs channels, significant evidence can be seen at the 14 TeV LHC for an integrated luminosity of 300 fb-1 and that even discovery is possible with slightly more luminosity.

  4. ACCRETION KINEMATICS THROUGH THE WARPED TRANSITION DISK IN HD 142527 FROM RESOLVED CO(6–5) OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Casassus, S.; Marino, S.; Pérez, S.; Plas, G. van der; Christiaens, V.; Montesinos, Matías [Departamento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile); Roman, P.; Dunhill, A.; Cuadra, J.; Cieza, L.; Moral, Victor [Millennium Nucleus “Protoplanetary Disks,” Chile (Chile); Armitage, P. J. [JILA, University of Colorado and NIST, UCB 440, Boulder, CO 80309 (United States); Wootten, A., E-mail: scasassus@u.uchile.cl [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903-2475 (United States)

    2015-10-01

    The finding of residual gas in the large central cavity of the HD 142527 disk motivates questions regarding the origin of its non-Keplerian kinematics and possible connections with planet formation. We aim to understand the physical structure that underlies the intra-cavity gaseous flows, guided by new molecular-line data in CO(6–5) with unprecedented angular resolutions. Given the warped structure inferred from the identification of scattered-light shadows cast on the outer disk, the kinematics are consistent, to first order, with axisymmetric accretion onto the inner disk occurring at all azimuths. A steady-state accretion profile, fixed at the stellar accretion rate, explains the depth of the cavity as traced in CO isotopologues. The abrupt warp and evidence for near free-fall radial flows in HD 142527 resemble theoretical models for disk tearing, which could be driven by the reported low-mass companion, whose orbit may be contained in the plane of the inner disk. The companion’s high inclination with respect to the massive outer disk could drive Kozai oscillations over long timescales; high-eccentricity periods may perhaps account for the large cavity. While shadowing by the tilted disk could imprint an azimuthal modulation in the molecular-line maps, further observations are required to ascertain the significance of azimuthal structure in the density field inside the cavity of HD 142527.

  5. Magnetic resonance imaging in cadaver dogs with metallic vertebral implants at 3 Tesla: evaluation of the WARP-turbo spin echo sequence.

    Science.gov (United States)

    Griffin, John F; Archambault, Nicholas S; Mankin, Joseph M; Wall, Corey R; Thompson, James A; Padua, Abraham; Purdy, David; Kerwin, Sharon C

    2013-11-15

    Laboratory investigation, ex vivo. Postoperative complications are common after spinal implantation procedures, and magnetic resonance imaging (MRI) would be the ideal modality to image these patients. Unfortunately, the implants cause artifacts that can render MRI nondiagnostic. The WARP-turbo spin echo (TSE) sequence has been developed to mitigate artifacts caused by metal. The objective of this investigation was to evaluate the performance of the WARP-TSE sequence in canine cadaver specimens after implantation with metallic vertebral implants. Magnetic field strength, implant type, and MRI acquisition technique all play a role in the severity of susceptibility artifacts. The WARP-TSE sequence uses increased bandwidth, view angle tilting, and SEMAC (slice-encoding metal artifact correction) to correct for susceptibility artifact. The WARP-TSE technique has outperformed conventional techniques in patients, after total hip arthroplasty. However, published reports of its application in subjects with vertebral column implants are lacking. Ex vivo anterior stabilization of the atlantoaxial joint was performed on 6 adult small breed (implantation with stainless steel implants. N/A.

  6. A warping window approach to real-time vision-based pedestrian detection in a truck’s blind spot zone

    OpenAIRE

    Van Beeck, Kristof; Goedemé, Toon; Tuytelaars, Tinne

    2012-01-01

    Van Beeck K., Goedemé T., Tuytelaars T., ''A warping window approach to real-time vision-based pedestrian detection in a truck’s blind spot zone'', Proceedings 9th international conference on informatics in control, automation and robotics - ICINCO 2012, vol. 2, pp. 561-568, July 28-31, 2012, Rome, Italy.

  7. Real-time vision-based pedestrian detection in a truck’s blind spot zone using a warping window approach

    OpenAIRE

    Van Beeck, Kristof; Goedemé, Toon; Tuytelaars, Tinne

    2014-01-01

    Van Beeck K., Goedemé G., Tuytelaars T., ''Real-time vision-based pedestrian detection in a truck’s blind spot zone using a warping window approach'', Informatics in control, automation and robotics - lecture notes in electrical engineering, vol. 283, pp. 251-264, Ferrier J.-L., Bernard A., Gusikhin O. and Madani K., eds., 2014.

  8. Improvement of temporal and dynamic subtraction images on abdominal CT using 3D global image matching and nonlinear image warping techniques

    International Nuclear Information System (INIS)

    Okumura, E; Sanada, S; Suzuki, M; Takemura, A; Matsui, O

    2007-01-01

    Accurate registration of the corresponding non-enhanced and arterial-phase CT images is necessary to create temporal and dynamic subtraction images for the enhancement of subtle abnormalities. However, respiratory movement causes misregistration at the periphery of the liver. To reduce these misregistration errors, we developed a temporal and dynamic subtraction technique to enhance small HCC by 3D global matching and nonlinear image warping techniques. The study population consisted of 21 patients with HCC. Using the 3D global matching and nonlinear image warping technique, we registered current and previous arterial-phase CT images or current non-enhanced and arterial-phase CT images obtained in the same position. The temporal subtraction image was obtained by subtracting the previous arterial-phase CT image from the warped current arterial-phase CT image. The dynamic subtraction image was obtained by the subtraction of the current non-enhanced CT image from the warped current arterial-phase CT image. The percentage of fair or superior temporal subtraction images increased from 52.4% to 95.2% using the new technique, while on the dynamic subtraction images, the percentage increased from 66.6% to 95.2%. The new subtraction technique may facilitate the diagnosis of subtle HCC based on the superior ability of these subtraction images to show nodular and/or ring enhancement

  9. High-resolution and high-throughput multichannel Fourier transform spectrometer with two-dimensional interferogram warping compensation

    Science.gov (United States)

    Watanabe, A.; Furukawa, H.

    2018-04-01

    The resolution of multichannel Fourier transform (McFT) spectroscopy is insufficient for many applications despite its extreme advantage of high throughput. We propose an improved configuration to realise both performance using a two-dimensional area sensor. For the spectral resolution, we obtained the interferogram of a larger optical path difference by shifting the area sensor without altering any optical components. The non-linear phase error of the interferometer was successfully corrected using a phase-compensation calculation. Warping compensation was also applied to realise a higher throughput to accumulate the signal between vertical pixels. Our approach significantly improved the resolution and signal-to-noise ratio by factors of 1.7 and 34, respectively. This high-resolution and high-sensitivity McFT spectrometer will be useful for detecting weak light signals such as those in non-invasive diagnosis.

  10. [Biometric identification method for ECG based on the piecewise linear representation (PLR) and dynamic time warping (DTW)].

    Science.gov (United States)

    Yang, Licai; Shen, Jun; Bao, Shudi; Wei, Shoushui

    2013-10-01

    To treat the problem of identification performance and the complexity of the algorithm, we proposed a piecewise linear representation and dynamic time warping (PLR-DTW) method for ECG biometric identification. Firstly we detected R peaks to get the heartbeats after denoising preprocessing. Then we used the PLR method to keep important information of an ECG signal segment while reducing the data dimension at the same time. The improved DTW method was used for similarity measurements between the test data and the templates. The performance evaluation was carried out on the two ECG databases: PTB and MIT-BIH. The analystic results showed that compared to the discrete wavelet transform method, the proposed PLR-DTW method achieved a higher accuracy rate which is nearly 8% of rising, and saved about 30% operation time, and this demonstrated that the proposed method could provide a better performance.

  11. Double trigonal warping and the anomalous quantum Hall step in bilayer graphene with Rashba spin-orbit coupling

    International Nuclear Information System (INIS)

    Wang Bo; Ma Zhongshui; Zhang, C

    2012-01-01

    We demonstrate that the trigonal warping observed in bilayer graphene is doubled in the presence of Rashba spin-orbit (RSO) coupling, i.e. the Dirac points along the three-fold symmetry axis are doubled. There are now seven Dirac points. Furthermore, the RSO interaction breaks the electron-hole symmetry of the magnetic band structure. The most intriguing feature is that the step of the quantum Hall plateau at zero energy is four times that at finite energy. The number of Dirac points and the zero energy Hall step are only determined by the existence of RSO coupling, but are independent of the strength of the coupling. The robustness of these phenomena suggests equivalence between the RSO coupling and the topological effect in bilayer coupling.

  12. Initial Self-Consistent 3D Electron-Cloud Simulations of the LHC Beam with the Code WARP+POSINST

    International Nuclear Information System (INIS)

    Vay, J; Furman, M A; Cohen, R H; Friedman, A; Grote, D P

    2005-01-01

    We present initial results for the self-consistent beam-cloud dynamics simulations for a sample LHC beam, using a newly developed set of modeling capability based on a merge [1] of the three-dimensional parallel Particle-In-Cell (PIC) accelerator code WARP [2] and the electron-cloud code POSINST [3]. Although the storage ring model we use as a test bed to contain the beam is much simpler and shorter than the LHC, its lattice elements are realistically modeled, as is the beam and the electron cloud dynamics. The simulated mechanisms for generation and absorption of the electrons at the walls are based on previously validated models available in POSINST [3, 4

  13. Equivalence between Born–Infeld tachyon and effective real scalar field theories for brane structures in warped geometry

    International Nuclear Information System (INIS)

    Bernardini, A.E.; Bertolami, O.

    2013-01-01

    An equivalence between Born–Infeld and effective real scalar field theories for brane structures is built in some specific warped space–time scenarios. Once the equations of motion for tachyon fields related to the Born–Infeld action are written as first-order equations, a simple analytical connection with a particular class of real scalar field superpotentials can be found. This equivalence leads to the conclusion that, for a certain class of superpotentials, both systems can support identical thick brane solutions as well as brane structures described through localized energy densities, T 00 (y), in the 5th dimension, y. Our results indicate that thick brane solutions realized by the Born–Infeld cosmology can be connected to real scalar field brane scenarios which can be used to effectively map the tachyon condensation mechanism

  14. Measuring Regional Changes in the Diastolic Deformation of the Left Ventricle of SHR Rats Using microPET Technology and Hyperelastic Warping

    Energy Technology Data Exchange (ETDEWEB)

    Gullberg, Grant T; VERESS , ALEXANDER I.; WEISS, JEFFREY A.; HUESMAN, RONALD H.; REUTTER, BRYAN W.; TAYLOR , SCOTT E.; SITEK , AREK; FENG, BING; YANG , YONGFENG; GULLBERG, GRANT T.

    2008-04-04

    The objective of this research was to assess applicability of a technique known as hyperelastic warping for the measurement of local strains in the left ventricle (LV) directly from microPET image data sets. The technique uses differences in image intensities between template (reference) and target (loaded) image data sets to generate a body force that deforms a finite element (FE) representation of the template so that it registers with the target images. For validation, the template image was defined as the end-systolic microPET image data set from a Wistar Kyoto (WKY) rat. The target image was created by mapping the template image using the deformation results obtained from a FE model of diastolic filling. Regression analysis revealed highly significant correlations between the simulated forward FE solution and image derived warping predictions for fiber stretch (R2 = 0.96), circumferential strain (R2 = 0.96), radial strain (R2 = 0.93), and longitudinal strain (R2 = 0.76) (p<0.001for all cases). The technology was applied to microPET image data of two spontaneously hypertensive rats (SHR) and a WKY control. Regional analysis revealed that, the lateral freewall in the SHR subjects showed the greatest deformation compared with the other wall segments. This work indicates that warping can accurately predict the strain distributions during diastole from the analysis of microPET data sets.

  15. Measuring Regional Changes in the Diastolic Deformation of the Left Ventricle of SHR Rats Using microPET Technology and Hyperelastic Warping

    International Nuclear Information System (INIS)

    Gullberg, Grant T; VERESS, ALEXANDER I.; WEISS, JEFFREY A.; HUESMAN, RONALD H.; REUTTER, BRYAN W.; TAYLOR, SCOTT E.; SITEK, AREK; FENG, BING; YANG, YONGFENG; GULLBERG, GRANT T.

    2008-01-01

    The objective of this research was to assess applicability of a technique known as hyperelastic warping for the measurement of local strains in the left ventricle (LV) directly from microPET image data sets. The technique uses differences in image intensities between template (reference) and target (loaded) image data sets to generate a body force that deforms a finite element (FE) representation of the template so that it registers with the target images. For validation, the template image was defined as the end-systolic microPET image data set from a Wistar Kyoto (WKY) rat. The target image was created by mapping the template image using the deformation results obtained from a FE model of diastolic filling. Regression analysis revealed highly significant correlations between the simulated forward FE solution and image derived warping predictions for fiber stretch (R2 = 0.96), circumferential strain (R2 = 0.96), radial strain (R2 = 0.93), and longitudinal strain (R2 = 0.76) (p < 0.001 for all cases). The technology was applied to microPET image data of two spontaneously hypertensive rats (SHR) and a WKY control. Regional analysis revealed that, the lateral freewall in the SHR subjects showed the greatest deformation compared with the other wall segments. This work indicates that warping can accurately predict the strain distributions during diastole from the analysis of microPET data sets

  16. Usefulness of metal artifact reduction with WARP technique at 1.5 and 3T MRI in imaging metal-on-metal hip resurfacings

    Energy Technology Data Exchange (ETDEWEB)

    Lazik, Andrea; Lauenstein, Thomas C.; Theysohn, Jens M. [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Landgraeber, Stefan; Schulte, Patrick [University Hospital Essen, Department of Orthopedics, Essen (Germany); Kraff, Oliver [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany)

    2015-03-25

    To evaluate the usefulness of the metal artifact reduction technique ''WARP'' in the assessment of metal-on-metal hip resurfacings at 1.5 and 3T in the context of image quality and imaging speed. Nineteen patients (25 hip resurfacings) were randomized for 1.5 and 3T MRI, both including T1 and T2 turbo spin-echo as well as turbo inversion recovery magnitude sequences with and without view angle tilting and high bandwidth. Additional 3T sequences were acquired with a reduced number of averages and using the parallel acquisition technique for accelerating imaging speed. Artifact size (diameter, area), image quality (5-point scale) and delineation of anatomical structures were compared among the techniques, sequences and field strengths using the Wilcoxon sign-rank and paired t-test with Bonferroni correction. At both field strengths, WARP showed significant superiority over standard sequences regarding image quality, artifact size and delineation of anatomical structures. At 3T, artifacts were larger compared to 1.5T without affecting diagnostic quality, and scanning time could be reduced by up to 64 % without quality degradation. WARP proved useful in imaging metal-on-metal hip resurfacings at 1.5T as well as 3T with better image quality surrounding the implants. At 3T imaging could be considerably accelerated without losing diagnostic quality. (orig.)

  17. Usefulness of metal artifact reduction with WARP technique at 1.5 and 3T MRI in imaging metal-on-metal hip resurfacings

    International Nuclear Information System (INIS)

    Lazik, Andrea; Lauenstein, Thomas C.; Theysohn, Jens M.; Landgraeber, Stefan; Schulte, Patrick; Kraff, Oliver

    2015-01-01

    To evaluate the usefulness of the metal artifact reduction technique ''WARP'' in the assessment of metal-on-metal hip resurfacings at 1.5 and 3T in the context of image quality and imaging speed. Nineteen patients (25 hip resurfacings) were randomized for 1.5 and 3T MRI, both including T1 and T2 turbo spin-echo as well as turbo inversion recovery magnitude sequences with and without view angle tilting and high bandwidth. Additional 3T sequences were acquired with a reduced number of averages and using the parallel acquisition technique for accelerating imaging speed. Artifact size (diameter, area), image quality (5-point scale) and delineation of anatomical structures were compared among the techniques, sequences and field strengths using the Wilcoxon sign-rank and paired t-test with Bonferroni correction. At both field strengths, WARP showed significant superiority over standard sequences regarding image quality, artifact size and delineation of anatomical structures. At 3T, artifacts were larger compared to 1.5T without affecting diagnostic quality, and scanning time could be reduced by up to 64 % without quality degradation. WARP proved useful in imaging metal-on-metal hip resurfacings at 1.5T as well as 3T with better image quality surrounding the implants. At 3T imaging could be considerably accelerated without losing diagnostic quality. (orig.)

  18. Neutrino oscillations from warped flavor symmetry: Predictions for long baseline experiments T2K, NOvA, and DUNE

    Science.gov (United States)

    Pasquini, Pedro; Chuliá, Salvador Centelles; Valle, J. W. F.

    2017-05-01

    Here we study the pattern of neutrino oscillations emerging from a previously proposed warped standard model construction incorporating Δ (27 ) flavor symmetry [J. High Energy Phys. 01 (2016) 007, 10.1007/JHEP01(2016)007]. In addition to a complete description of fermion masses, the model predicts the lepton mixing matrix in terms of two parameters. The good measurement of θ13 makes these two parameters tightly correlated, leading to an approximate one-parameter description of neutrino oscillations. We find secondary minima for the C P phase absent in the general unconstrained oscillation scenario and determine the fourfold degenerate sharp correlation between the physical C P phase δC P and the atmospheric mixing angle θ23. This implies that maximal θ23 correlates with maximal leptonic C P violation. We perform a realistic estimate of the total neutrino and antineutrino event numbers expected at long baseline oscillation experiments T2K, NOvA, and the upcoming DUNE proposal. We show how an improved knowledge of the C P phase will probe the model in a significant way.

  19. Evaluation of short-term physical weathering of a heavy fuel oil by use of time warping and PCA

    International Nuclear Information System (INIS)

    Malmquist, L.M.V.; Olsen, R.R.; Christensen, J.H.; Andersen, O.

    2005-01-01

    An estimated 1,140 billion tons of oil was accidentally spilled to the environment during the 1990s. These spills present an ecotoxicologic risk due to the presence of toxic and mutagenic compounds in the oil. Oil is affected by short term and long term weathering processes such as evaporation, dissolution, dispersion, emulsification, photodegradation and biodegradation. Physical weathering processes change the composition of the oil but they do not alter the oil components. Gas chromatography and mass spectrometry can characterize the compositional changes resulting from evaporation. However, the process depends on subjective analysis because it is based on manual interpretation of results and visual inspection. This paper presents a rapid and objective method to compare oil sample compositions. The method is based on automated data preprocessing involving baseline removal, alignment of chromatograms using correlation optimized warping (COW) and normalization. Preprocessed data is analyzed by principal component analysis (PCA) based on the total chromatograms. The method has successfully resolved the effects of evaporation and dissolution processes and showed clear dependence of time, but it did not completely resolve the effect of weathering from the analytical variability because better quality data is required. 21 refs., 3 figs

  20. Evaluation of short-term physical weathering of a heavy fuel oil by use of time warping and PCA

    Energy Technology Data Exchange (ETDEWEB)

    Malmquist, L.M.V.; Olsen, R.R. [Roskilde Univ., Roskilde (Denmark). Dept. of Life Sciences and Chemistry]|[National Environmental Research Inst., Roskilde (Denmark). Dept. of Environmental Chemistry and Microbiology; Christensen, J.H. [Royal Veterinary and Agricultural Univ., Thorvaldsensvej (Denmark). Dept. of Natural Sciences; Andersen, O. [Roskilde Univ., Roskilde (Denmark). Dept. of Life Sciences and Chemistry

    2005-07-01

    An estimated 1,140 billion tons of oil was accidentally spilled to the environment during the 1990s. These spills present an ecotoxicologic risk due to the presence of toxic and mutagenic compounds in the oil. Oil is affected by short term and long term weathering processes such as evaporation, dissolution, dispersion, emulsification, photodegradation and biodegradation. Physical weathering processes change the composition of the oil but they do not alter the oil components. Gas chromatography and mass spectrometry can characterize the compositional changes resulting from evaporation. However, the process depends on subjective analysis because it is based on manual interpretation of results and visual inspection. This paper presents a rapid and objective method to compare oil sample compositions. The method is based on automated data preprocessing involving baseline removal, alignment of chromatograms using correlation optimized warping (COW) and normalization. Preprocessed data is analyzed by principal component analysis (PCA) based on the total chromatograms. The method has successfully resolved the effects of evaporation and dissolution processes and showed clear dependence of time, but it did not completely resolve the effect of weathering from the analytical variability because better quality data is required. 21 refs., 3 figs.

  1. How the 'warped' relationships between nurses' emotions, attitudes, social support and perceived organizational conditions impact customer orientation.

    Science.gov (United States)

    Gountas, Sandra; Gountas, John

    2016-02-01

    Much research focuses on organizational culture and its impact on customer orientation or emotional states and their impact on job satisfaction and well-being. This study aims to combine the complex roles of nurses' emotion states and job satisfaction in a model that identifies the effects of standards for service delivery (organizational culture), supervisor and co-worker support and the development of customer orientation. A previous study examined the relationships between nurses' personal resources, job satisfaction and customer orientation. This study examines how these variables relate to organizational standards and social support. A cross-sectional survey using a self-completion questionnaire with validated, existing scales to measure standards for service delivery, supervisor and co-worker support, job satisfaction, empathic concern, emotional exhaustion and customer orientation. Nurses (159) completed the questionnaire in 2010. The data were analysed using WarpPLS, a structural equation modelling software package. The results indicate that the final model fits the data well and explains 84% of the variance in customer orientation. The findings show the importance of standard for service delivery (organizational culture), supervisor and co-worker support on customer orientation. Nurses' personal resources interact with these, particularly supervisor and co-worker support, to develop staff job satisfaction and empathy. The need for support mechanisms in stressful times is discussed. We propose that training in compassion and empathy would help leaders to model desirable attributes that contribute towards customer orientation. © 2015 John Wiley & Sons Ltd.

  2. Classification of biosensor time series using dynamic time warping: applications in screening cancer cells with characteristic biomarkers.

    Science.gov (United States)

    Rai, Shesh N; Trainor, Patrick J; Khosravi, Farhad; Kloecker, Goetz; Panchapakesan, Balaji

    2016-01-01

    The development of biosensors that produce time series data will facilitate improvements in biomedical diagnostics and in personalized medicine. The time series produced by these devices often contains characteristic features arising from biochemical interactions between the sample and the sensor. To use such characteristic features for determining sample class, similarity-based classifiers can be utilized. However, the construction of such classifiers is complicated by the variability in the time domains of such series that renders the traditional distance metrics such as Euclidean distance ineffective in distinguishing between biological variance and time domain variance. The dynamic time warping (DTW) algorithm is a sequence alignment algorithm that can be used to align two or more series to facilitate quantifying similarity. In this article, we evaluated the performance of DTW distance-based similarity classifiers for classifying time series that mimics electrical signals produced by nanotube biosensors. Simulation studies demonstrated the positive performance of such classifiers in discriminating between time series containing characteristic features that are obscured by noise in the intensity and time domains. We then applied a DTW distance-based k -nearest neighbors classifier to distinguish the presence/absence of mesenchymal biomarker in cancer cells in buffy coats in a blinded test. Using a train-test approach, we find that the classifier had high sensitivity (90.9%) and specificity (81.8%) in differentiating between EpCAM-positive MCF7 cells spiked in buffy coats and those in plain buffy coats.

  3. EVOLUTION OF WARPED ACCRETION DISKS IN ACTIVE GALACTIC NUCLEI. I. ROLES OF FEEDING AT THE OUTER BOUNDARIES

    International Nuclear Information System (INIS)

    Li, Yan-Rong; Wang, Jian-Min; Cheng, Cheng; Qiu, Jie

    2013-01-01

    We investigate the alignment processes of spinning black holes and their surrounding warped accretion disks in a frame of two different types of feeding at the outer boundaries. We consider (1) fixed flows in which gas is continually fed with a preferred angular momentum, and (2) free flows in which there is no gas supply and the disks diffuse freely at their outer edges. As expected, we find that for the cases of fixed flows the black hole disk systems always align on timescales of several 10 6 yr, irrespective of the initial inclinations. If the initial inclination angles are larger than π/2, the black hole accretion transits from retrograde to prograde fashion, and the accreted mass onto the black holes during these two phases is comparable. On the other hand, for the cases of free flows, both alignments and anti-alignments can occur, depending on the initial inclinations and the ratios of the angular momentum of the disks to that of the black holes. In such cases, the disks will be consumed within timescales of 10 6 yr by black holes accreting at the Eddington limit. We propose that there is a close connection between the black hole spin and the lifetime for which the feeding persists, which determines the observable episodic lifetimes of active galactic nuclei. We conclude that careful inclusion of the disk feeding at the outer boundaries is crucial for modeling the evolution of the black hole spin.

  4. Similarity measure and topology evolution of foreign exchange markets using dynamic time warping method: Evidence from minimal spanning tree

    Science.gov (United States)

    Wang, Gang-Jin; Xie, Chi; Han, Feng; Sun, Bo

    2012-08-01

    In this study, we employ a dynamic time warping method to study the topology of similarity networks among 35 major currencies in international foreign exchange (FX) markets, measured by the minimal spanning tree (MST) approach, which is expected to overcome the synchronous restriction of the Pearson correlation coefficient. In the empirical process, firstly, we subdivide the analysis period from June 2005 to May 2011 into three sub-periods: before, during, and after the US sub-prime crisis. Secondly, we choose NZD (New Zealand dollar) as the numeraire and then, analyze the topology evolution of FX markets in terms of the structure changes of MSTs during the above periods. We also present the hierarchical tree associated with the MST to study the currency clusters in each sub-period. Our results confirm that USD and EUR are the predominant world currencies. But USD gradually loses the most central position while EUR acts as a stable center in the MST passing through the crisis. Furthermore, an interesting finding is that, after the crisis, SGD (Singapore dollar) becomes a new center currency for the network.

  5. Nonlinear Geometric Warping of the Mask Image: A New Method for Reducing Misregistration Artifacts in Digital Subtraction Angiography

    International Nuclear Information System (INIS)

    Hayashi, Nobushige; Sakai, Toyohiko; Kitagawa, Manabu; Inagaki, Rika; Sadato, Norihiro; Ishii, Yasushi; Nishimoto, Yasuhiro; Tanaka, Masato; Fukushima, Tetsuya; Komuro, Hiroyuki; Ogura, Hisakazu; Kobayashi, Hidenori; Kubota, Toshihiko

    1998-01-01

    Purpose: Misregistration artifact is the major cause of image degradation in digital subtraction angiography (DSA). The purpose of this study was to evaluate the efficacy of a newly developed nonlinear geometric warping method to reduce misregistration artifact in DSA. Methods: The processing of the images was carried out on a workstation with a fully automatic computerized program. After making differential images with a lapracian filter, 49 regions of interest (ROIs) were set in the image to be processed. Each ROI of the live image scanned the corresponding ROI of the mask image searching for the best position to match itself. Each pixel of the mask image was shifted individually following the data calculated from the shifts of the ROIs. Five radiologists compared the images produced by the conventional parallel shift technique and those processed with this new method in 16 series of cerebral DSA. Results: In 14 of 16 series (88%), more radiologists judged the images processed with the new method to be better in quality. Small arteries near the skull base and veins of low density were clearly visualized in the images processed by the new method. Conclusion: This newly proposed method could be a simple and practical way to automatically reduce misregistration artifacts in DSA

  6. Toward fully self-consistent simulation of the interaction of E-Clouds and beams with WARP-POSINST

    International Nuclear Information System (INIS)

    Furman, M.A.; Furman, M.A.; Celata, C.M.; Sonnad, K.; Venturini, M.; Cohen, R.H.; Friedman, A.; Grote, D.P.; Vay, J.-L.

    2007-01-01

    To predict the evolution of electron clouds and their effect on the beam, the high energy physics community has relied so far on the complementary use of 'buildup' and 'single/multi-bunch instability' reduced descriptions. The former describes the evolution of electron clouds at a given location in the ring, or 'station', under the influence of prescribed beams and external fields [1], while the latter (sometimes also referred as the 'quasi-static' approximation [2]) follows the interaction between the beams and the electron clouds around the accelerator with prescribed initial distributions of electrons, assumed to be concentrated at a number of discrete 'stations' around the ring. Examples of single bunch instability codes include HEADTAIL [3], QuickPIC [4, 5], and PEHTS [6]. By contrast, a fully self-consistent approach, in which both the electron cloud and beam distributions evolve simultaneously under their mutual influence without any restriction on their relative motion, is required for modeling the interaction of high-intensity beams with electron clouds for heavy-ion beam-driven fusion and warm-dense matter science. This community has relied on the use of Particle-In-Cell (PIC) methods through the development and use of the WARP-POSINST code suite [1, 7, 8]. The development of novel numerical techniques (including adaptive mesh refinement, and a new 'drift-Lorentz' particle mover for tracking charged particles in magnetic fields using large time steps) has enabled the first application of WARP-POSINST to the fully self-consistent modeling of beams and electron clouds in high energy accelerators [9], albeit for only a few betatron oscillations. It was recently observed [10] that there exists a preferred frame of reference which minimizes the number of computer operations needed to simulate the interaction of relativistic objects. This opens the possibility of reducing the cost of fully self-consistent simulations for the interaction of ultrarelativistic

  7. Application of split-green fluorescent protein for topology mapping membrane proteins in Escherichia coli

    DEFF Research Database (Denmark)

    Toddo, Stephen; Soderstrom, Bill; Palombo, Isolde

    2012-01-01

    A topology map of a membrane protein defines the location of transmembrane helices and the orientation of soluble domains relative to the membrane. In the absence of a high-resolution structure, a topology map is an essential guide for studying structurefunction relationships. Although these maps....../periplasmic location of the N-terminus of a protein. Here, we show that the bimolecular split-green fluorescent protein complementation system can overcome this limitation and can be used to determine the location of both the N- and C-termini of inner membrane proteins in Escherichia coli....

  8. PolyWaTT: A polynomial water travel time estimator based on Derivative Dynamic Time Warping and Perceptually Important Points

    Science.gov (United States)

    Claure, Yuri Navarro; Matsubara, Edson Takashi; Padovani, Carlos; Prati, Ronaldo Cristiano

    2018-03-01

    Traditional methods for estimating timing parameters in hydrological science require a rigorous study of the relations of flow resistance, slope, flow regime, watershed size, water velocity, and other local variables. These studies are mostly based on empirical observations, where the timing parameter is estimated using empirically derived formulas. The application of these studies to other locations is not always direct. The locations in which equations are used should have comparable characteristics to the locations from which such equations have been derived. To overcome this barrier, in this work, we developed a data-driven approach to estimate timing parameters such as travel time. Our proposal estimates timing parameters using historical data of the location without the need of adapting or using empirical formulas from other locations. The proposal only uses one variable measured at two different locations on the same river (for instance, two river-level measurements, one upstream and the other downstream on the same river). The recorded data from each location generates two time series. Our method aligns these two time series using derivative dynamic time warping (DDTW) and perceptually important points (PIP). Using data from timing parameters, a polynomial function generalizes the data by inducing a polynomial water travel time estimator, called PolyWaTT. To evaluate the potential of our proposal, we applied PolyWaTT to three different watersheds: a floodplain ecosystem located in the part of Brazil known as Pantanal, the world's largest tropical wetland area; and the Missouri River and the Pearl River, in United States of America. We compared our proposal with empirical formulas and a data-driven state-of-the-art method. The experimental results demonstrate that PolyWaTT showed a lower mean absolute error than all other methods tested in this study, and for longer distances the mean absolute error achieved by PolyWaTT is three times smaller than empirical

  9. Probing Higgs-radion mixing in warped models through complementary searches at the LHC and the ILC

    Science.gov (United States)

    Frank, Mariana; Huitu, Katri; Maitra, Ushoshi; Patra, Monalisa

    2016-09-01

    We consider the Higgs-radion mixing in the context of warped space extradimensional models with custodial symmetry and investigate the prospects of detecting the mixed radion. Custodial symmetries allow the Kaluza-Klein excitations to be lighter and protect Z b b ¯ to be in agreement with experimental constraints. We perform a complementary study of discovery reaches of the Higgs-radion mixed state at the 13 and 14 TeV LHC and at the 500 and 1000 GeV International Linear Collider (ILC). We carry out a comprehensive analysis of the most significant production and decay modes of the mixed radion in the 80 GeV-1 TeV mass range and indicate the parameter space that can be probed at the LHC and the ILC. There exists a region of the parameter space which can be probed, at the LHC, through the diphoton channel even for a relatively low luminosity of 50 fb-1 . The reach of the four-lepton final state in probing the parameter space is also studied in the context of 14 TeV LHC, for a luminosity of 1000 fb-1 . At the ILC, with an integrated luminosity of 500 fb-1 , we analyze the Z -radion associated production and the W W fusion production, followed by the radion decay into b b ¯ and W+W-. The W W fusion production is favored over the Z -radion associated channel in probing regions of the parameter space beyond the LHC reach. The complementary study at the LHC and the ILC is useful both for the discovery of the radion and the understanding of its mixing sector.

  10. Demonstration of accuracy and clinical versatility of mutual information for automatic multimodality image fusion using affine and thin-plate spline warped geometric deformations.

    Science.gov (United States)

    Meyer, C R; Boes, J L; Kim, B; Bland, P H; Zasadny, K R; Kison, P V; Koral, K; Frey, K A; Wahl, R L

    1997-04-01

    This paper applies and evaluates an automatic mutual information-based registration algorithm across a broad spectrum of multimodal volume data sets. The algorithm requires little or no pre-processing, minimal user input and easily implements either affine, i.e. linear or thin-plate spline (TPS) warped registrations. We have evaluated the algorithm in phantom studies as well as in selected cases where few other algorithms could perform as well, if at all, to demonstrate the value of this new method. Pairs of multimodal gray-scale volume data sets were registered by iteratively changing registration parameters to maximize mutual information. Quantitative registration errors were assessed in registrations of a thorax phantom using PET/CT and in the National Library of Medicine's Visible Male using MRI T2-/T1-weighted acquisitions. Registrations of diverse clinical data sets were demonstrated including rotate-translate mapping of PET/MRI brain scans with significant missing data, full affine mapping of thoracic PET/CT and rotate-translate mapping of abdominal SPECT/CT. A five-point thin-plate spline (TPS) warped registration of thoracic PET/CT is also demonstrated. The registration algorithm converged in times ranging between 3.5 and 31 min for affine clinical registrations and 57 min for TPS warping. Mean error vector lengths for rotate-translate registrations were measured to be subvoxel in phantoms. More importantly the rotate-translate algorithm performs well even with missing data. The demonstrated clinical fusions are qualitatively excellent at all levels. We conclude that such automatic, rapid, robust algorithms significantly increase the likelihood that multimodality registrations will be routinely used to aid clinical diagnoses and post-therapeutic assessment in the near future.

  11. Algorithmic choices in WARP – A framework for continuous energy Monte Carlo neutron transport in general 3D geometries on GPUs

    International Nuclear Information System (INIS)

    Bergmann, Ryan M.; Vujić, Jasmina L.

    2015-01-01

    Highlights: • WARP, a GPU-accelerated Monte Carlo neutron transport code, has been developed. • The NVIDIA OptiX high-performance ray tracing library is used to process geometric data. • The unionized cross section representation is modified for higher performance. • Reference remapping is used to keep the GPU busy as neutron batch population reduces. • Reference remapping is done using a key-value radix sort on neutron reaction type. - Abstract: In recent supercomputers, general purpose graphics processing units (GPGPUs) are a significant faction of the supercomputer’s total computational power. GPGPUs have different architectures compared to central processing units (CPUs), and for Monte Carlo neutron transport codes used in nuclear engineering to take advantage of these coprocessor cards, transport algorithms must be changed to execute efficiently on them. WARP is a continuous energy Monte Carlo neutron transport code that has been written to do this. The main thrust of WARP is to adapt previous event-based transport algorithms to the new GPU hardware; the algorithmic choices for all parts of which are presented in this paper. It is found that remapping history data references increases the GPU processing rate when histories start to complete. The main reason for this is that completed data are eliminated from the address space, threads are kept busy, and memory bandwidth is not wasted on checking completed data. Remapping also allows the interaction kernels to be launched concurrently, improving efficiency. The OptiX ray tracing framework and CUDPP library are used for geometry representation and parallel dataset-side operations, ensuring high performance and reliability

  12. STM imaging of electronic waves on the surface of Bi2Te3: topologically protected surface states and hexagonal warping effects

    Energy Technology Data Exchange (ETDEWEB)

    Alpichshev, Zhanybek; /SIMES, Stanford /SLAC /Stanford U., Phys. Dept.; Analytis, J.G.; /SIMES, Stanford /SLAC /Stanford U., Phys. Dept.; Chu, J.-H.; Fisher, I.R.; /SIMES, Stanford /SLAC /Stanford U., Phys. Dept. /Stanford U., Appl. Phys. Dept.; Chen, Y.L.; /SIMES, Stanford /SLAC /Stanford U., Phys. Dept.; Shen, Z.X.; /SIMES, Stanford /SLAC /Stanford U., Phys. Dept. /Stanford U., Appl. Phys. Dept.; Fang, A.; /Stanford U., Phys. Dept. /Stanford U., Appl. Phys. Dept.; Kapitulnik, A.; /SIMES, Stanford /SLAC /Stanford U., Phys. Dept. /Stanford U., Appl. Phys. Dept.

    2010-06-02

    Scanning tunneling spectroscopy studies on high-quality Bi{sub 2}Te{sub 3} crystals exhibit perfect correspondence to ARPES data, hence enabling identification of different regimes measured in the local density of states (LDOS). Oscillations of LDOS near a step are analyzed. Within the main part of the surface band oscillations are strongly damped, supporting the hypothesis of topological protec- tion. At higher energies, as the surface band becomes concave, oscillations appear which disperse with a particular wave-vector that may result from an unconventional hexagonal warping term.

  13. ΔF = 2 observables and fine-tuning in a warped extra dimension with custodial protection

    International Nuclear Information System (INIS)

    Blanke, Monika; Buras, Andrzej J.; Duling, Bjoern; Gori, Stefania; Weiler, Andreas

    2009-01-01

    We present a complete study of ΔS = 2 and ΔB = 2 processes in a warped extra dimensional model with a custodial protection of Zb L b-bar L , including ε K , ΔM K , ΔM s , ΔM d , A SL q , ΔΓ q , A CP (B d →ψK S ) and A CP (B s →ψφ). These processes are affected by tree level contributions from Kaluza-Klein gluons, the heavy KK photon, new heavy electroweak gauge bosons Z H and Z', and in principle by tree level Z contributions. We confirm recent findings that the fully anarchic approach where all the hierarchies in quark masses and weak mixing angles are geometrically explained seems implausible and we confirm that the KK mass scale M KK generically has to be at least ∼ 20 TeV to satisfy the ε K constraint. We point out, however, that there exist regions in parameter space with only modest fine-tuning in the 5D Yukawa couplings which satisfy all existing ΔF = 2 and electroweak precision constraints for scales M KK ≅ 3 TeV in reach of the LHC. Simultaneously we find that A CP (B s → ψφ) and A s SL can be much larger than in the SM as indicated by recent results from CDF and DOe data. We point out that for B d,s physics ΔF = 2 observables the complex (Z H ,Z') can compete with KK gluons, while the tree level Z and KK photon contributions are very small. In particular we point out that the Zd i L d-bar j L couplings are protected by the custodial symmetry. As a by-product we show the relation of the RS flavour model to the Froggatt-Nielsen mechanism and we provide analytic formulae for the effective flavour mixing matrices in terms of the fundamental 5D parameters.

  14. Implementasi Dan Evaluasi Kinerja Encoder-Decoder Reed Solomon Pada M-Ary Quadrature Amplitude Modulation (M-Qam Mengunakan Wireless Open-Access Research Platform (WARP

    Directory of Open Access Journals (Sweden)

    Nadya Noor Oktarini

    2015-12-01

    Full Text Available Teknik modulasi multilevel seperti M-ary Quadrature Amplitude Modulation (M-QAM memiliki kelemahan yaitu semakin tinggi level modulasi yang digunakan, maka semakin tinggi pula nilai BER yang dihasilkan. Hal ini menyebabkan kinerja sistem menjadi tidak maksimal karena sistem semakin tidak tahan terhadap noise.  Salah satu teknik error control coding yang digunakan untuk mendeteksi kesalahan sekaligus memperbaiki kesalahan yaitu kode Reed Solomon. Kelebihan dari kode Reed Solomon adalah sifatnya yang non-binary artinya data diolah dalam simbol sehingga kemampuan koreksi data lebih banyak. WARP merupakan salah satu jenis dari teknologi SDR yang bisa diprogram untuk membuat prototype sistem komunikasi nirkabel. Pengimplementasian encoder dan decoder reed solomon dengan menggunakan perangkat WARP bertujuan untuk membandingkan modulasi M-QAM dengan dan tanpa kode reed solomon, kemudian mengetahui kinerja code rate yang berbeda pada modulasi M-QAM, serta mengetahui pengaruh besarnya daya pancar dan jarak pada sistem komunikasi. Hasil implementasi terbaik terdapat pada sistem RS (15,9 yang mana dapat memperbaiki kesalahan di semua level modulasi karena memiliki kemampuan koreksi error ganda (t=3 dengan ukuran k yang sama. Dari hasil implementasi juga didapatkan kesimpulan bahwa nilai BER akan semakin besar terhadap bertambahnya jarak antar node untuk daya pancar tetap, ini menandakan jarak sangat mempengaruhi kualitas kinerja suatu sistem komunikasi.

  15. Comfort and Functional Properties of Far-Infrared/Anion-Releasing Warp-Knitted Elastic Composite Fabrics Using Bamboo Charcoal, Copper, and Phase Change Materials

    Directory of Open Access Journals (Sweden)

    Ting-Ting Li

    2016-02-01

    Full Text Available Elastic warp-knitted composite fabrics with far-infrared emissivity and an anion-releasing property were prepared using bamboo charcoal (BC, copper (Cu, and phase-change material (PCM. The functional composite fabric, which was composed of self-made complex yarns with various twisting degrees and material composition, were created using a rotor twister and ring-spinning technique. The fabric structure was diversified by the feeding modes of weft yarn into a crochet-knitting machine. The twist number of complex yarns was optimized by tensile tenacity, twist contraction, and hairiness, and analysis showed that twisting at 12 twists per inch produced the highest tensile tenacity and appropriate twist contraction and hairiness. Comfort evaluation showed that the elastic composite fabrics with BC weft yarns exhibited higher water–vapor transmission rate and air permeability, reaching 876 g/m2∙ day and 73.2 cm3/s/cm2, respectively. Three structures of composite fabric with various weft yarns had >0.85 ε far-infrared emissivity and 350–420 counts/cm3 anion amount. The prepared elastic warp-knitted fabrics can provide a comfortable, dry, and breathable environment to the wearer and can thus be applied as health-care textiles in the future.

  16. Exploring the warped bulk

    Indian Academy of Sciences (India)

    K Sridhar

    2017-10-05

    Oct 5, 2017 ... fields localized on the IR brane. Thus, mass scales which suppress dangerous higher-dimensional opera- tors responsible for proton decay or neutrino masses also become small which spells a disaster for the RS model. One way out of this is to realize that to solve the gauge-hierarchy problem one needs ...

  17. Repeated Transient Jets from a Warped Disk in the Symbiotic Prototype Z And: A Link to the Long-lasting Active Phase

    Science.gov (United States)

    Skopal, Augustin; Tarasova, Taya. N.; Wolf, Marek; Dubovský, Pavol A.; Kudzej, Igor

    2018-05-01

    Active phases of some symbiotic binaries survive for a long time, from years to decades. The accretion process onto a white dwarf (WD) sustaining long-lasting activity, and sometimes leading to collimated ejection, is not well understood. We present the repeated emergence of highly collimated outflows (jets) from the symbiotic prototype Z And during its 2008 and 2009–10 outbursts and suggest their link to the current long-lasting (from 2000) active phase. We monitored Z And with high-resolution spectroscopy, multicolor UBVR C—and high time resolution—photometry. The well-pronounced bipolar jets were ejected again during the 2009–10 outburst together with the simultaneous emergence of the rapid photometric variability (Δm ≈ 0.06 mag) on the timescale of hours, showing similar properties as those during the 2006 outburst. These phenomena and the measured disk–jets connection could be caused by the radiation-induced warping of the inner disk due to a significant increase of the burning WD luminosity. Ejection of transient jets by Z And around outburst maxima signals a transient accretion at rates above the upper limit of the stable hydrogen burning on the WD surface, and thus proves the nature of Z And-type outbursts. The enhanced accretion through the disk warping, supplemented by the accretion from the giant’s wind, can keep a high luminosity of the WD for a long time, until depletion of the disk. In this way, the jets provide a link to long-lasting active phases of Z And.

  18. Novel modeling of task versus rest brain state predictability using a dynamic time warping spectrum: comparisons and contrasts with other standard measures of brain dynamics

    Directory of Open Access Journals (Sweden)

    Martin eDinov

    2016-05-01

    Full Text Available Dynamic time warping, or DTW, is a powerful and domain-general sequence alignment method for computing a similarity measure. Such dynamic programming-based techniques like DTW are now the backbone and driver of most bioinformatics methods and discoveries. In neuroscience it has had far less use, though this has begun to change. We wanted to explore new ways of applying DTW, not simply as a measure with which to cluster or compare similarity between features but in a conceptually different way. We have used DTW to provide a more interpretable spectral description of the data, compared to standard approaches such as the Fourier and related transforms. The DTW approach and standard discrete Fourier transform (DFT are assessed against benchmark measures of neural dynamics. These include EEG microstates, EEG avalanches and the sum squared error (SSE from a multilayer perceptron (MLP prediction of the EEG timeseries, and simultaneously acquired FMRI BOLD signal. We explored the relationships between these variables of interest in an EEG-FMRI dataset acquired during a standard cognitive task, which allowed us to explore how DTW differentially performs in different task settings. We found that despite strong correlations between DTW and DFT-spectra, DTW was a better predictor for almost every measure of brain dynamics. Using these DTW measures, we show that predictability is almost always higher in task than in rest states, which is consistent to other theoretical and empirical findings, providing additional evidence for the utility of the DTW approach.

  19. Scalar production in association with a Z boson at the LHC and ILC: The mixed Higgs-radion case of warped models

    Science.gov (United States)

    Angelescu, Andrei; Moreau, Grégory; Richard, François

    2017-07-01

    The radion scalar field might be the lightest new particle predicted by extradimensional extensions of the standard model. It could thus lead to the first signatures of new physics at the LHC collider. We perform a complete study of the radion production in association with the Z gauge boson in the custodially protected warped model with a brane-localized Higgs boson addressing the gauge hierarchy problem. Radion-Higgs mixing effects are present. Such a radion production receives possibly resonant contributions from the Kaluza-Klein excitations of the Z boson as well as the extra neutral gauge boson (Z'). All the exchange and mixing effects induced by those heavy bosons are taken into account in the radion coupling and rate calculations. The investigation of the considered radion production at the LHC allows us to be sensitive to some parts of the parameter space but only the ILC program at high luminosity would cover most of the theoretically allowed parameter space via the studied reaction. Complementary tests of the same theoretical parameters can be realized through the high accuracy measurements of the Higgs couplings at the ILC. The generic sensitivity limits on the rates discussed for the LHC and ILC potential reach can be applied to the searches for other (light) exotic scalar bosons.

  20. Using Dynamic Time Warping and Data Forensics to Examine Tradeoffs among Land-Energy-Water Networks Across the Conterminous United States

    Science.gov (United States)

    McManamay, R.; Allen, M. R.; Piburn, J.; Sanyal, J.; Stewart, R.; Bhaduri, B. L.

    2017-12-01

    Characterizing interdependencies among land-energy-water sectors, their vulnerabilities, and tipping points, is challenging, especially if all sectors are simultaneously considered. Because such holistic system behavior is uncertain, largely unmodeled, and in need of testable hypotheses of system drivers, these dynamics are conducive to exploratory analytics of spatiotemporal patterns, powered by tools, such as Dynamic Time Warping (DTW). Here, we conduct a retrospective analysis (1950 - 2010) of temporal trends in land use, energy use, and water use within US counties to identify commonalities in resource consumption and adaptation strategies to resource limitations. We combine existing and derived data from statistical downscaling to synthesize a temporally comprehensive land-energy-water dataset at the US county level and apply DTW and subsequent hierarchical clustering to examine similar temporal trends in resource typologies for land, energy, and water sectors. As expected, we observed tradeoffs among water uses (e.g., public supply vs irrigation) and land uses (e.g., urban vs ag). Strong associations between clusters amongst sectors reveal tight system interdependencies, whereas weak associations suggest unique behaviors and potential for human adaptations towards disruptive technologies and less resource-dependent population growth. Our framework is useful for exploring complex human-environmental system dynamics and generating hypotheses to guide subsequent energy-water-nexus research.

  1. Implementasi dan Evaluasi Kinerja Multi Input SingleOutput Orthogonal Frequency Division Multiplexing (MISO OFDM Menggunakan Wireless Open Access Research Platform (WARP

    Directory of Open Access Journals (Sweden)

    Galih Permana Putra

    2017-01-01

    Full Text Available Teknologi komunikasi nirkabel terus berkembang untuk memenuhi kebutuhan manusia akan koneksi informasi yang cepat, pengiriman data yang berkapasitas besar dan dapat diandalkan. Di dalam proses tersebut banyak sekali gangguan yang dapat mempengaruhi penurunan kinerja komunikasi diantaranya adalah multipath fading [1]. Multi Input Single Output (MISO merupakan salah satu teknik space diversity yang menggunakan banyak antena dengan tujuan untuk mengatasi multipath fading. Adapun pada proses transmisi digunakan teknik Orthogonal Frequency-Division Multiplexing (OFDM yang bertujuan memberikan keuntungan dalam hal efisiensi pada saat transmisi data dan mampu menghindari Inter Simbol Interference (ISI. Pada penelitian ini akan dibandingkan kinerja sistem MISO OFDM dan SISO OFDM yang akan disimulasikan dan di implementasikan pada modul Wireless Open Access Penelitian Platform (WARP untuk mengevaluasi kinerja BER sebagai fungsi dari daya pancar dan jarak variasi. Parameter yang digunakan di dalam pengukuran berdasarkan IEEE 802.11 a/g karena menggunakan frekuensi 2,4 Ghz. Terdapat dua skema pengukuran yaitu SISO OFDM dan MISO OFDM dengan variasi jarak 4,6 dan 8 meter dengan variasi daya pancar -35 s/d -4 dBm dengan peningkatan gain 5 kali secara berkala. Dari dua skema yang dilaksanakan dapat disimpulkan bahwa semakin jauh jarak antara pemancar dan penerima maka dibutuhkan penambahan gain untuk menjaga kualitas data yang dikirimkan. Disamping itu, terdapat perbedaan nilai gain untuk mencapai nilai BER = dibutuhkan penambahan gain = - 33 sedangkan pada SISO OFM dibutuhkan penambahan gain = -18.

  2. Warped AdS{sub 6}×S{sup 2} in Type IIB supergravity II: global solutions and five-brane webs

    Energy Technology Data Exchange (ETDEWEB)

    D’Hoker, Eric; Gutperle, Michael; Uhlemann, Christoph F. [Mani L. Bhaumik Institute for Theoretical Physics,Department of Physics and Astronomy, University of California Los Angeles,475 Portola Plaza, Los Angeles, CA 90095 (United States)

    2017-05-23

    Motivated by the construction of holographic duals to five-dimensional superconformal quantum field theories, we obtain global solutions to Type IIB supergravity invariant under the superalgebra F(4) on a space-time of the form AdS{sub 6}×S{sup 2} warped over a two-dimensional Riemann surface Σ. In earlier work, the general local solutions were expressed in terms of two locally holomorphic functions A{sub ±} on Σ and global solutions were sketched when Σ is a disk. In the present paper, the physical regularity conditions on the supergravity fields required for global solutions are implemented on A{sub ±} for arbitrary Σ. Global solutions exist only when Σ has a non-empty boundary ∂Σ. The differentials ∂A{sub ±} are allowed to have poles only on ∂Σ and each pole corresponds to a semi-infinite (p,q) five-brane. The construction for the disk is carried out in detail and the conditions for the existence of global solutions are articulated for surfaces with more than one boundary and higher genus.

  3. Increasing feasibility of the field-programmable gate array implementation of an iterative image registration using a kernel-warping algorithm

    Science.gov (United States)

    Nguyen, An Hung; Guillemette, Thomas; Lambert, Andrew J.; Pickering, Mark R.; Garratt, Matthew A.

    2017-09-01

    Image registration is a fundamental image processing technique. It is used to spatially align two or more images that have been captured at different times, from different sensors, or from different viewpoints. There have been many algorithms proposed for this task. The most common of these being the well-known Lucas-Kanade (LK) and Horn-Schunck approaches. However, the main limitation of these approaches is the computational complexity required to implement the large number of iterations necessary for successful alignment of the images. Previously, a multi-pass image interpolation algorithm (MP-I2A) was developed to considerably reduce the number of iterations required for successful registration compared with the LK algorithm. This paper develops a kernel-warping algorithm (KWA), a modified version of the MP-I2A, which requires fewer iterations to successfully register two images and less memory space for the field-programmable gate array (FPGA) implementation than the MP-I2A. These reductions increase feasibility of the implementation of the proposed algorithm on FPGAs with very limited memory space and other hardware resources. A two-FPGA system rather than single FPGA system is successfully developed to implement the KWA in order to compensate insufficiency of hardware resources supported by one FPGA, and increase parallel processing ability and scalability of the system.

  4. System for face recognition under expression variations of neutral-sampled individuals using recognized expression warping and a virtual expression-face database

    Science.gov (United States)

    Petpairote, Chayanut; Madarasmi, Suthep; Chamnongthai, Kosin

    2018-01-01

    The practical identification of individuals using facial recognition techniques requires the matching of faces with specific expressions to faces from a neutral face database. A method for facial recognition under varied expressions against neutral face samples of individuals via recognition of expression warping and the use of a virtual expression-face database is proposed. In this method, facial expressions are recognized and the input expression faces are classified into facial expression groups. To aid facial recognition, the virtual expression-face database is sorted into average facial-expression shapes and by coarse- and fine-featured facial textures. Wrinkle information is also employed in classification by using a process of masking to adjust input faces to match the expression-face database. We evaluate the performance of the proposed method using the CMU multi-PIE, Cohn-Kanade, and AR expression-face databases, and we find that it provides significantly improved results in terms of face recognition accuracy compared to conventional methods and is acceptable for facial recognition under expression variation.

  5. One-against-all weighted dynamic time warping for language-independent and speaker-dependent speech recognition in adverse conditions.

    Directory of Open Access Journals (Sweden)

    Xianglilan Zhang

    Full Text Available Considering personal privacy and difficulty of obtaining training material for many seldom used English words and (often non-English names, language-independent (LI with lightweight speaker-dependent (SD automatic speech recognition (ASR is a promising option to solve the problem. The dynamic time warping (DTW algorithm is the state-of-the-art algorithm for small foot-print SD ASR applications with limited storage space and small vocabulary, such as voice dialing on mobile devices, menu-driven recognition, and voice control on vehicles and robotics. Even though we have successfully developed two fast and accurate DTW variations for clean speech data, speech recognition for adverse conditions is still a big challenge. In order to improve recognition accuracy in noisy environment and bad recording conditions such as too high or low volume, we introduce a novel one-against-all weighted DTW (OAWDTW. This method defines a one-against-all index (OAI for each time frame of training data and applies the OAIs to the core DTW process. Given two speech signals, OAWDTW tunes their final alignment score by using OAI in the DTW process. Our method achieves better accuracies than DTW and merge-weighted DTW (MWDTW, as 6.97% relative reduction of error rate (RRER compared with DTW and 15.91% RRER compared with MWDTW are observed in our extensive experiments on one representative SD dataset of four speakers' recordings. To the best of our knowledge, OAWDTW approach is the first weighted DTW specially designed for speech data in adverse conditions.

  6. Multivariate statistical process control (MSPC) using Raman spectroscopy for in-line culture cell monitoring considering time-varying batches synchronized with correlation optimized warping (COW).

    Science.gov (United States)

    Liu, Ya-Juan; André, Silvère; Saint Cristau, Lydia; Lagresle, Sylvain; Hannas, Zahia; Calvosa, Éric; Devos, Olivier; Duponchel, Ludovic

    2017-02-01

    Multivariate statistical process control (MSPC) is increasingly popular as the challenge provided by large multivariate datasets from analytical instruments such as Raman spectroscopy for the monitoring of complex cell cultures in the biopharmaceutical industry. However, Raman spectroscopy for in-line monitoring often produces unsynchronized data sets, resulting in time-varying batches. Moreover, unsynchronized data sets are common for cell culture monitoring because spectroscopic measurements are generally recorded in an alternate way, with more than one optical probe parallelly connecting to the same spectrometer. Synchronized batches are prerequisite for the application of multivariate analysis such as multi-way principal component analysis (MPCA) for the MSPC monitoring. Correlation optimized warping (COW) is a popular method for data alignment with satisfactory performance; however, it has never been applied to synchronize acquisition time of spectroscopic datasets in MSPC application before. In this paper we propose, for the first time, to use the method of COW to synchronize batches with varying durations analyzed with Raman spectroscopy. In a second step, we developed MPCA models at different time intervals based on the normal operation condition (NOC) batches synchronized by COW. New batches are finally projected considering the corresponding MPCA model. We monitored the evolution of the batches using two multivariate control charts based on Hotelling's T 2 and Q. As illustrated with results, the MSPC model was able to identify abnormal operation condition including contaminated batches which is of prime importance in cell culture monitoring We proved that Raman-based MSPC monitoring can be used to diagnose batches deviating from the normal condition, with higher efficacy than traditional diagnosis, which would save time and money in the biopharmaceutical industry. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Quality control of the soil moisture probe response patterns from a green infrastructure site using Dynamic Time Warping (DTW) and association rule learning

    Science.gov (United States)

    Yu, Z.; Bedig, A.; Quigley, M.; Montalto, F. A.

    2017-12-01

    In-situ field monitoring can help to improve the design and management of decentralized Green Infrastructure (GI) systems in urban areas. Because of the vast quantity of continuous data generated from multi-site sensor systems, cost-effective post-construction opportunities for real-time control are limited; and the physical processes that influence the observed phenomena (e.g. soil moisture) are hard to track and control. To derive knowledge efficiently from real-time monitoring data, there is currently a need to develop more efficient approaches to data quality control. In this paper, we employ dynamic time warping method to compare the similarity of two soil moisture patterns without ignoring the inherent autocorrelation. We also use a rule-based machine learning method to investigate the feasibility of detecting anomalous responses from soil moisture probes. The data was generated from both individual and clusters of probes, deployed in a GI site in Milwaukee, WI. In contrast to traditional QAQC methods, which seek to detect outliers at individual time steps, the new method presented here converts the continuous time series into event-based symbolic sequences from which unusual response patterns can be detected. Different Matching rules are developed on different physical characteristics for different seasons. The results suggest that this method could be used alternatively to detect sensor failure, to identify extreme events, and to call out abnormal change patterns, compared to intra-probe and inter-probe historical observations. Though this algorithm was developed for soil moisture probes, the same approach could easily be extended to advance QAQC efficiency for any continuous environmental datasets.

  8. ALICE moves into warp drive.

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    A Large Ion Collider Experiment (ALICE) is the heavy-ion detector designed to study the physics of strongly interacting matter and the quark-gluon plasma at the CERN Large Hadron Collider (LHC). Since its successful start-up in 2010, the LHC has been performing outstandingly, providing to the experiments long periods of stable collisions and an integrated luminosity that greatly exceeds the planned targets. To fully explore these privileged conditions, we aim at maximizing the experiment's data taking productivity during stable collisions. We present in this paper the evolution of the online systems in order to spot reasons of inefficiency and address new requirements. This paper describes the features added to the ALICE Electronic Logbook (eLogbook) to allow the Run Coordination team to identify, prioritize, fix and follow causes of inefficiency in the experiment. Thorough monitoring of the data taking efficiency provides reports for the collaboration to portray its evolution and evaluate the measures (fix...

  9. Time tunnels meet warped passages

    CERN Multimedia

    Kushner, David

    2006-01-01

    "Just in time for its 40th anniversary, the classic sci-fi television show "The time tunnel" is out on DVD. The conceit is something every engineer can relate to: a pulled plug. Scientists in an underground lab are working on a secret government experiment in time travel. (1 page)

  10. Supersymmetry Breaking Casimir Warp Drive

    Science.gov (United States)

    Obousy, Richard K.; Cleaver, Gerald

    2007-01-01

    This paper utilizes a recent model which relates the cosmological constant to the Casimir energy of the extra dimensions in brane-world theories. The objective of this paper is to demonstrate that, given some sufficiently advanced civilization with the ability to manipulate the radius of the extra dimension, a local adjustment of the cosmological constant could be created. This adjustment would facilitate an expansion/contraction of the spacetime around a spacecraft creating an exotic form of field-propulsion. This idea is analogous to the Alcubierre bubble, but differs entirely in the approach, utilizing the physics of higher dimensional quantum field theory, instead of general relativity.

  11. The drug-minded protein interaction database (DrumPID) for efficient target analysis and drug development.

    Science.gov (United States)

    Kunz, Meik; Liang, Chunguang; Nilla, Santosh; Cecil, Alexander; Dandekar, Thomas

    2016-01-01

    The drug-minded protein interaction database (DrumPID) has been designed to provide fast, tailored information on drugs and their protein networks including indications, protein targets and side-targets. Starting queries include compound, target and protein interactions and organism-specific protein families. Furthermore, drug name, chemical structures and their SMILES notation, affected proteins (potential drug targets), organisms as well as diseases can be queried including various combinations and refinement of searches. Drugs and protein interactions are analyzed in detail with reference to protein structures and catalytic domains, related compound structures as well as potential targets in other organisms. DrumPID considers drug functionality, compound similarity, target structure, interactome analysis and organismic range for a compound, useful for drug development, predicting drug side-effects and structure-activity relationships.Database URL:http://drumpid.bioapps.biozentrum.uni-wuerzburg.de. © The Author(s) 2016. Published by Oxford University Press.

  12. Total protein

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/003483.htm Total protein To use the sharing features on this page, please enable JavaScript. The total protein test measures the total amount of two classes ...

  13. Proteins engineering

    International Nuclear Information System (INIS)

    2000-01-01

    At the - Departement d'Ingenierie et d'etudes de proteines (Deip) of the CEA more than seventy researchers are working hard to understand the function of proteins. For that they use the molecular labelling technique (F.M.)

  14. Whey Protein

    Science.gov (United States)

    ... reliable information about the safety of taking whey protein if you are pregnant or breast feeding. Stay on the safe side and avoid use. Milk allergy: If you are allergic to cow's milk, avoid using whey protein.

  15. The Human-Computer Domain Relation in UX Models

    DEFF Research Database (Denmark)

    Clemmensen, Torkil

    influential lines of UX research: aesthetics and temporal UX, and two use situations: using a website and starting to use a smartphone. The results suggest that the two lines of UX research share a focus on users’ evaluative judgments of technology, both focuses on product qualities rather than activity...

  16. Protein politics

    NARCIS (Netherlands)

    Vijver, Marike

    2005-01-01

    This study is part of the program of the interdisciplinary research group Profetas (protein foods, environment, technology and society). Profetas consists of technological, environmental and socio-economic research projects on protein food systems which result in the development of scenarios and

  17. Protein adhesives

    Science.gov (United States)

    Charles R. Frihart; Linda F. Lorenz

    2018-01-01

    Nature uses a wide variety of chemicals for providing adhesion internally (e.g., cell to cell) and externally (e.g., mussels to ships and piers). This adhesive bonding is chemically and mechanically complex, involving a variety of proteins, carbohydrates, and other compounds.Consequently,the effect of protein structures on adhesive properties is only partially...

  18. Tau protein

    DEFF Research Database (Denmark)

    Frederiksen, Jette Lautrup Battistini; Kristensen, Kim; Bahl, Jmc

    2011-01-01

    Background: Tau protein has been proposed as biomarker of axonal damage leading to irreversible neurological impairment in MS. CSF concentrations may be useful when determining risk of progression from ON to MS. Objective: To investigate the association between tau protein concentration and 14......-3-3 protein in the cerebrospinal fluid (CSF) of patients with monosymptomatic optic neuritis (ON) versus patients with monosymptomatic onset who progressed to multiple sclerosis (MS). To evaluate results against data found in a complete literature review. Methods: A total of 66 patients with MS and/or ON from...... the Department of Neurology of Glostrup Hospital, University of Copenhagen, Denmark, were included. CSF samples were analysed for tau protein and 14-3-3 protein, and clinical and paraclinical information was obtained from medical records. Results: The study shows a significantly increased concentration of tau...

  19. A Nucleotide Phosphatase Activity in the Nucleotide Binding Domain of an Orphan Resistance Protein from Rice*

    Science.gov (United States)

    Fenyk, Stepan; de San Eustaquio Campillo, Alba; Pohl, Ehmke; Hussey, Patrick J.; Cann, Martin J.

    2012-01-01

    Plant resistance proteins (R-proteins) are key components of the plant immune system activated in response to a plethora of different pathogens. R-proteins are P-loop NTPase superfamily members, and current models describe their main function as ATPases in defense signaling pathways. Here we show that a subset of R-proteins have evolved a new function to combat pathogen infection. This subset of R-proteins possesses a nucleotide phosphatase activity in the nucleotide-binding domain. Related R-proteins that fall in the same phylogenetic clade all show the same nucleotide phosphatase activity indicating a conserved function within at least a subset of R-proteins. R-protein nucleotide phosphatases catalyze the production of nucleoside from nucleotide with the nucleotide monophosphate as the preferred substrate. Mutation of conserved catalytic residues substantially reduced activity consistent with the biochemistry of P-loop NTPases. Kinetic analysis, analytical gel filtration, and chemical cross-linking demonstrated that the nucleotide-binding domain was active as a multimer. Nuclear magnetic resonance and nucleotide analogues identified the terminal phosphate bond as the target of a reaction that utilized a metal-mediated nucleophilic attack by water on the phosphoester. In conclusion, we have identified a group of R-proteins with a unique function. This biochemical activity appears to have co-evolved with plants in signaling pathways designed to resist pathogen attack. PMID:22157756

  20. A nucleotide phosphatase activity in the nucleotide binding domain of an orphan resistance protein from rice.

    Science.gov (United States)

    Fenyk, Stepan; Campillo, Alba de San Eustaquio; Pohl, Ehmke; Hussey, Patrick J; Cann, Martin J

    2012-02-03

    Plant resistance proteins (R-proteins) are key components of the plant immune system activated in response to a plethora of different pathogens. R-proteins are P-loop NTPase superfamily members, and current models describe their main function as ATPases in defense signaling pathways. Here we show that a subset of R-proteins have evolved a new function to combat pathogen infection. This subset of R-proteins possesses a nucleotide phosphatase activity in the nucleotide-binding domain. Related R-proteins that fall in the same phylogenetic clade all show the same nucleotide phosphatase activity indicating a conserved function within at least a subset of R-proteins. R-protein nucleotide phosphatases catalyze the production of nucleoside from nucleotide with the nucleotide monophosphate as the preferred substrate. Mutation of conserved catalytic residues substantially reduced activity consistent with the biochemistry of P-loop NTPases. Kinetic analysis, analytical gel filtration, and chemical cross-linking demonstrated that the nucleotide-binding domain was active as a multimer. Nuclear magnetic resonance and nucleotide analogues identified the terminal phosphate bond as the target of a reaction that utilized a metal-mediated nucleophilic attack by water on the phosphoester. In conclusion, we have identified a group of R-proteins with a unique function. This biochemical activity appears to have co-evolved with plants in signaling pathways designed to resist pathogen attack.

  1. Protein nanoparticles for therapeutic protein delivery.

    Science.gov (United States)

    Herrera Estrada, L P; Champion, J A

    2015-06-01

    Therapeutic proteins can face substantial challenges to their activity, requiring protein modification or use of a delivery vehicle. Nanoparticles can significantly enhance delivery of encapsulated cargo, but traditional small molecule carriers have some limitations in their use for protein delivery. Nanoparticles made from protein have been proposed as alternative carriers and have benefits specific to therapeutic protein delivery. This review describes protein nanoparticles made by self-assembly, including protein cages, protein polymers, and charged or amphipathic peptides, and by desolvation. It presents particle fabrication and delivery characterization for a variety of therapeutic and model proteins, as well as comparison of the features of different protein nanoparticles.

  2. Protein-Protein Interaction Databases

    DEFF Research Database (Denmark)

    Szklarczyk, Damian; Jensen, Lars Juhl

    2015-01-01

    Years of meticulous curation of scientific literature and increasingly reliable computational predictions have resulted in creation of vast databases of protein interaction data. Over the years, these repositories have become a basic framework in which experiments are analyzed and new directions...

  3. Aquaporin Protein-Protein Interactions

    Directory of Open Access Journals (Sweden)

    Jennifer Virginia Roche

    2017-10-01

    Full Text Available Aquaporins are tetrameric membrane-bound channels that facilitate transport of water and other small solutes across cell membranes. In eukaryotes, they are frequently regulated by gating or trafficking, allowing for the cell to control membrane permeability in a specific manner. Protein–protein interactions play crucial roles in both regulatory processes and also mediate alternative functions such as cell adhesion. In this review, we summarize recent knowledge about aquaporin protein–protein interactions; dividing the interactions into three types: (1 interactions between aquaporin tetramers; (2 interactions between aquaporin monomers within a tetramer (hetero-tetramerization; and (3 transient interactions with regulatory proteins. We particularly focus on the structural aspects of the interactions, discussing the small differences within a conserved overall fold that allow for aquaporins to be differentially regulated in an organism-, tissue- and trigger-specific manner. A deep knowledge about these differences is needed to fully understand aquaporin function and regulation in many physiological processes, and may enable design of compounds targeting specific aquaporins for treatment of human disease.

  4. Protein immobilization strategies for protein biochips

    NARCIS (Netherlands)

    Rusmini, F.; Rusmini, Federica; Zhong, Zhiyuan; Feijen, Jan

    2007-01-01

    In the past few years, protein biochips have emerged as promising proteomic and diagnostic tools for obtaining information about protein functions and interactions. Important technological innovations have been made. However, considerable development is still required, especially regarding protein

  5. TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.

    Science.gov (United States)

    Ye, Qiaozhen; Rosenberg, Scott C; Moeller, Arne; Speir, Jeffrey A; Su, Tiffany Y; Corbett, Kevin D

    2015-04-28

    The AAA+ family ATPase TRIP13 is a key regulator of meiotic recombination and the spindle assembly checkpoint, acting on signaling proteins of the conserved HORMA domain family. Here we present the structure of the Caenorhabditis elegans TRIP13 ortholog PCH-2, revealing a new family of AAA+ ATPase protein remodelers. PCH-2 possesses a substrate-recognition domain related to those of the protein remodelers NSF and p97, while its overall hexameric architecture and likely structural mechanism bear close similarities to the bacterial protein unfoldase ClpX. We find that TRIP13, aided by the adapter protein p31(comet), converts the HORMA-family spindle checkpoint protein MAD2 from a signaling-active 'closed' conformer to an inactive 'open' conformer. We propose that TRIP13 and p31(comet) collaborate to inactivate the spindle assembly checkpoint through MAD2 conformational conversion and disassembly of mitotic checkpoint complexes. A parallel HORMA protein disassembly activity likely underlies TRIP13's critical regulatory functions in meiotic chromosome structure and recombination.

  6. TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Qiaozhen [Ludwig Institute for Cancer Research, San Diego Branch, La Jolla, United States; Rosenberg, Scott C. [Ludwig Institute for Cancer Research, San Diego Branch, La Jolla, United States; Moeller, Arne [National Resource for Automated Molecular Microscopy, Department of Integrative Structural and Computational Biology, The Scripps Research Institute, La Jolla, United States; Speir, Jeffrey A. [National Resource for Automated Molecular Microscopy, Department of Integrative Structural and Computational Biology, The Scripps Research Institute, La Jolla, United States; Su, Tiffany Y. [Ludwig Institute for Cancer Research, San Diego Branch, La Jolla, United States; Corbett, Kevin D. [Ludwig Institute for Cancer Research, San Diego Branch, La Jolla, United States; Department of Cellular and Molecular Medicine, University of California, San Diego, La Jolla, United States

    2015-04-28

    The AAA+ family ATPase TRIP13 is a key regulator of meiotic recombination and the spindle assembly checkpoint, acting on signaling proteins of the conserved HORMA domain family. Here we present the structure of the Caenorhabditis elegans TRIP13 ortholog PCH-2, revealing a new family of AAA+ ATPase protein remodelers. PCH-2 possesses a substrate-recognition domain related to those of the protein remodelers NSF and p97, while its overall hexameric architecture and likely structural mechanism bear close similarities to the bacterial protein unfoldase ClpX. We find that TRIP13, aided by the adapter protein p31(comet), converts the HORMA-family spindle checkpoint protein MAD2 from a signaling-active ‘closed’ conformer to an inactive ‘open’ conformer. We propose that TRIP13 and p31(comet) collaborate to inactivate the spindle assembly checkpoint through MAD2 conformational conversion and disassembly of mitotic checkpoint complexes. A parallel HORMA protein disassembly activity likely underlies TRIP13's critical regulatory functions in meiotic chromosome structure and recombination.

  7. Higgs Production in a Warped Extra Dimension

    Energy Technology Data Exchange (ETDEWEB)

    Carena, Marcela [Chicago U., EFI; Casagrande, Sandro [Munich, Tech. U., Universe; Goertz, Florian [Zurich, ETH; Haisch, Ulrich [Oxford U., Theor. Phys.; Neubert, Matthias [Mainz U., Inst. Phys.

    2012-04-01

    Measurements of the Higgs-boson production cross section at the LHC are an important tool for studying electroweak symmetry breaking at the quantum level, since the main production mechanism gg-->h is loop-suppressed in the Standard Model (SM). Higgs production in extra-dimensional extensions of the SM is sensitive to the Kaluza-Klein (KK) excitations of the quarks, which can be exchanged as virtual particles in the loop. In the context of the minimal Randall-Sundrum (RS) model with bulk fields and a brane-localized Higgs sector, we derive closed analytical expressions for the gluon-gluon fusion process, finding that the effect of the infinite tower of virtual KK states can be described in terms of a simple function of the fundamental (5D) Yukawa matrices. Given a specific RS model, this will allow one to easily constrain the parameter space, once a Higgs signal has been established. We explain that discrepancies between existing calculations of Higgs production in RS models are related to the non-commutativity of two limits: taking the number of KK states to infinity and removing the regulator on the Higgs-boson profile, which is required in an intermediate step to make the relevant overlap integrals well defined. Even though the one-loop gg-->h amplitude is finite in RS scenarios with a brane-localized Higgs sector, it is important to introduce a consistent ultraviolet regulator in order to obtain the correct result.

  8. A flavor protection for warped Higgsless models

    International Nuclear Information System (INIS)

    Csaki, Csaba; Curtin, David

    2009-01-01

    We examine various possibilities for realistic 5D Higgsless models on a Randall-Sundrum (RS) background, and construct a full quark sector featuring next-to-minimal flavor violation (with an exact bulk SU(2) protecting the first two generations) which satisfies electroweak and flavor constraints. The 'new custodially protected representation' is used for the third generation to protect the light quarks from flavor violations induced due to the heavy top. A combination of flavor symmetries, and an 'RS-GIM' mechanism for the right-handed quarks suppresses flavor-changing neutral currents below experimental bounds, assuming Cabibbo-Kobayashi-Maskawa-type mixing on the UV brane. In addition to the usual Higgsless RS signals, this model predicts an exotic charge-5/3 quark with mass of about 0.5 TeV which should show up at the LHC very quickly, as well as nonzero flavor-changing neutral currents which could be detected in the next generation of flavor experiments. In the course of our analysis, we also find quantitative estimates for the errors of the fermion zero-mode approximation, which are significant for Higgsless-type models.

  9. The warp and weft of Fries, Virginia

    OpenAIRE

    Flanigan, Katherine Janet

    1998-01-01

    Fries, Virginia exists because of the Fries Textile Mill. The closing of the mill calls into question the future of the community of Fries. The decline of the town can be tied to the closing of the mill. Conversely, the revitalization of the mill should help to reshape the town. Even as it stands empty, the mill continues to be a massive presence on the hillside overlooking the New River. It is possible to turn this symbol of the past into a hope for the future. Ab...

  10. From Bayes to PDEs in image warping

    DEFF Research Database (Denmark)

    Nielsen, Mads; Markussen, Bo

    2006-01-01

    In many disciplines of computer vision, such as stereo vision, flow computation, medical image registration, the essential computational problem is the geometrical alignment of images. In this chapter we describe how such an alignment may be obtained as statistical optimal through solving a partial...

  11. Epididymal research: more warp than weft?

    Directory of Open Access Journals (Sweden)

    Trevor G Cooper

    2015-01-01

    Full Text Available From a review of some aspects of epididymal structure, function and research done largely in my research area over the last 50 years, I conclude that more is known than is understood of sperm maturation and storage in the epididymis. Highly qualified technicians have not always applied sophisticated modern techniques in well-considered experiments to physiologically relevant and properly-prepared samples, so that our understanding of the biological problem of the nature of the epididymal epithelial influence on maturing epididymal spermatozoa has not kept pace with the outpouring of data generated, much of which is difficult to interpret. We stand at a crossroads of where to aim our limited resources and personnel: should we continue new technology-led studies in many directions, backtrack to test hypotheses and fill in gaps in our knowledge, or consider more biological directions to our research?

  12. Phenomenological mass matrices with a democratic warp

    International Nuclear Information System (INIS)

    Kleppe, A.

    2018-01-01

    Taking into account all available data on the mass sector, we obtain unitary rotation matrices that diagonalize the quark matrices by using a specific parametrization of the Cabibbo-Kobayashi-Maskawa mixing matrix. In this way, we find mass matrices for the up- and down-quark sectors of a specific, symmetric form, with traces of a democratic texture.

  13. Electrodynamics in a 6D warped geometry

    International Nuclear Information System (INIS)

    Aranda, A.; Diaz-Cruz, J. L.; Linares, R.; Morales-Tecotl, H. A.; Pedraza, O.

    2009-01-01

    We obtain the effective 4D action that arises from a 6D free gauge action in the space-time metric RSI-1. Solving explicitly the 6D equations of motion we obtain the Kaluza-Klein decomposition of the 6D gauge field. This work constitutes the first step towards the discussion of the Gauge-Higgs Unification scenario in this background.

  14. Conformal hyperbolicity of Lorentzian warped products

    International Nuclear Information System (INIS)

    Markowitz, M.J.

    1982-01-01

    A space-time M is said to be conformally hyperbolic if the intrinsic conformal Lorentz pseudodistance dsub(M) is a true distance. In this paper criteria are derived which insure the conformal hyperbolicity of certain space-times which are generalizations of the Robertson-Walker spaces. Then dsub(M) is determined explicitly for Einstein-de Sitter space, and important cosmological model. (author)

  15. Conformal hyperbolicity of Lorentzian warped products

    Energy Technology Data Exchange (ETDEWEB)

    Markowitz, M.J. (Chicago Univ., IL (USA). Dept. of Mathematics)

    1982-12-01

    A space-time M is said to be conformally hyperbolic if the intrinsic conformal Lorentz pseudodistance dsub(M) is a true distance. In this paper criteria are derived which insure the conformal hyperbolicity of certain space-times which are generalizations of the Robertson-Walker spaces. Then dsub(M) is determined explicitly for Einstein-de Sitter space, and important cosmological model.

  16. Radion stabilization in higher curvature warped spacetime

    Energy Technology Data Exchange (ETDEWEB)

    Das, Ashmita [Indian Institute of Technology, Department of Physics, Guwahati, Assam (India); Mukherjee, Hiya; Paul, Tanmoy; SenGupta, Soumitra [Indian Association for the Cultivation of Science, Department of Theoretical Physics, Kolkata (India)

    2018-02-15

    We consider a five dimensional AdS spacetime in presence of higher curvature term like F(R) = R + αR{sup 2} in the bulk. In this model, we examine the possibility of modulus stabilization from the scalar degrees of freedom of higher curvature gravity free of ghosts. Our result reveals that the model stabilizes itself and the mechanism of modulus stabilization can be argued from a geometric point of view. We determine the region of the parametric space for which the modulus (or radion) can to be stabilized. We also show how the mass and coupling parameters of radion field are modified due to higher curvature term leading to modifications of its phenomenological implications on the visible 3-brane. (orig.)

  17. The E5 Proteins

    OpenAIRE

    DiMaio, Daniel; Petti, Lisa

    2013-01-01

    The E5 proteins are short transmembrane proteins encoded by many animal and human papillomaviruses. These proteins display transforming activity in cultured cells and animals, and they presumably also play a role in the productive virus life cycle. The E5 proteins are thought to act by modulating the activity of cellular proteins. Here, we describe the biological activities of the best-studied E5 proteins and discuss the evidence implicating specific protein targets and pathways in mediating ...

  18. EDITORIAL: Precision proteins Precision proteins

    Science.gov (United States)

    Demming, Anna

    2010-06-01

    Since the birth of modern day medicine, during the times of Hippocrates in ancient Greece, the profession has developed from the rudimentary classification of disease into a rigorous science with an inspiring capability to treat and cure. Scientific methodology has distilled clinical diagnostic tools from the early arts of prognosis, which used to rely as much on revelation and prophecy, as intuition and judgement [1]. Over the past decade, research into the interactions between proteins and nanosystems has provided some ingenious and apt techniques for delving into the intricacies of anatomical systems. In vivo biosensing has emerged as a vibrant field of research, as much of medical diagnosis relies on the detection of substances or an imbalance in the chemicals in the body. The inherent properties of nanoscale structures, such as cantilevers, make them well suited to biosensing applications that demand the detection of molecules at very low concentrations. Measurable deflections in cantilevers functionalised with antibodies provide quantitative indicators of the presence of specific antigens when the two react. Such developments have roused mounting interest in the interactions of proteins with nanostructures, such as carbon nanotubes [3], which have demonstrated great potential as generic biomarkers. Plasmonic properties are also being exploited in sensing applications, such as the molecular sentinel recently devised by researchers in the US. The device uses the plasmonic properties of a silver nanoparticle linked to a Raman labelled hairpin DNA probe to signal changes in the probe geometry resulting from interactions with substances in the environment. Success stories so far include the detection of two specific genes associated with breast cancer [4]. A greater understanding of how RNA interference regulates gene expression has highlighted the potential of using this natural process as another agent for combating disease in personalized medicine. However, the

  19. Protein docking prediction using predicted protein-protein interface

    Directory of Open Access Journals (Sweden)

    Li Bin

    2012-01-01

    Full Text Available Abstract Background Many important cellular processes are carried out by protein complexes. To provide physical pictures of interacting proteins, many computational protein-protein prediction methods have been developed in the past. However, it is still difficult to identify the correct docking complex structure within top ranks among alternative conformations. Results We present a novel protein docking algorithm that utilizes imperfect protein-protein binding interface prediction for guiding protein docking. Since the accuracy of protein binding site prediction varies depending on cases, the challenge is to develop a method which does not deteriorate but improves docking results by using a binding site prediction which may not be 100% accurate. The algorithm, named PI-LZerD (using Predicted Interface with Local 3D Zernike descriptor-based Docking algorithm, is based on a pair wise protein docking prediction algorithm, LZerD, which we have developed earlier. PI-LZerD starts from performing docking prediction using the provided protein-protein binding interface prediction as constraints, which is followed by the second round of docking with updated docking interface information to further improve docking conformation. Benchmark results on bound and unbound cases show that PI-LZerD consistently improves the docking prediction accuracy as compared with docking without using binding site prediction or using the binding site prediction as post-filtering. Conclusion We have developed PI-LZerD, a pairwise docking algorithm, which uses imperfect protein-protein binding interface prediction to improve docking accuracy. PI-LZerD consistently showed better prediction accuracy over alternative methods in the series of benchmark experiments including docking using actual docking interface site predictions as well as unbound docking cases.

  20. Protein docking prediction using predicted protein-protein interface.

    Science.gov (United States)

    Li, Bin; Kihara, Daisuke

    2012-01-10

    Many important cellular processes are carried out by protein complexes. To provide physical pictures of interacting proteins, many computational protein-protein prediction methods have been developed in the past. However, it is still difficult to identify the correct docking complex structure within top ranks among alternative conformations. We present a novel protein docking algorithm that utilizes imperfect protein-protein binding interface prediction for guiding protein docking. Since the accuracy of protein binding site prediction varies depending on cases, the challenge is to develop a method which does not deteriorate but improves docking results by using a binding site prediction which may not be 100% accurate. The algorithm, named PI-LZerD (using Predicted Interface with Local 3D Zernike descriptor-based Docking algorithm), is based on a pair wise protein docking prediction algorithm, LZerD, which we have developed earlier. PI-LZerD starts from performing docking prediction using the provided protein-protein binding interface prediction as constraints, which is followed by the second round of docking with updated docking interface information to further improve docking conformation. Benchmark results on bound and unbound cases show that PI-LZerD consistently improves the docking prediction accuracy as compared with docking without using binding site prediction or using the binding site prediction as post-filtering. We have developed PI-LZerD, a pairwise docking algorithm, which uses imperfect protein-protein binding interface prediction to improve docking accuracy. PI-LZerD consistently showed better prediction accuracy over alternative methods in the series of benchmark experiments including docking using actual docking interface site predictions as well as unbound docking cases.

  1. Shotgun protein sequencing.

    Energy Technology Data Exchange (ETDEWEB)

    Faulon, Jean-Loup Michel; Heffelfinger, Grant S.

    2009-06-01

    A novel experimental and computational technique based on multiple enzymatic digestion of a protein or protein mixture that reconstructs protein sequences from sequences of overlapping peptides is described in this SAND report. This approach, analogous to shotgun sequencing of DNA, is to be used to sequence alternative spliced proteins, to identify post-translational modifications, and to sequence genetically engineered proteins.

  2. Introduction to protein blotting.

    Science.gov (United States)

    Kurien, Biji T; Scofield, R Hal

    2009-01-01

    Protein blotting is a powerful and important procedure for the immunodetection of proteins following electrophoresis, particularly proteins that are of low abundance. Since the inception of the protocol for protein transfer from an electrophoresed gel to a membrane in 1979, protein blotting has evolved greatly. The scientific community is now confronted with a variety of ways and means to carry out this transfer.

  3. Our interests in protein-protein interactions

    Indian Academy of Sciences (India)

    protein interactions. Evolution of P-P partnerships. Evolution of P-P structures. Evolutionary dynamics of P-P interactions. Dynamics of P-P interaction network. Host-pathogen interactions. CryoEM mapping of gigantic protein assemblies.

  4. Evolution of protein-protein interactions

    Indian Academy of Sciences (India)

    Evolution of protein-protein interactions · Our interests in protein-protein interactions · Slide 3 · Slide 4 · Slide 5 · Slide 6 · Slide 7 · Slide 8 · Slide 9 · Slide 10 · Slide 11 · Slide 12 · Slide 13 · Slide 14 · Slide 15 · Slide 16 · Slide 17 · Slide 18 · Slide 19 · Slide 20.

  5. Protein in diet

    Science.gov (United States)

    Diet - protein ... Protein foods are broken down into parts called amino acids during digestion. The human body needs a ... to eat animal products to get all the protein you need in your diet. Amino acids are ...

  6. Protein-losing enteropathy

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/007338.htm Protein-losing enteropathy To use the sharing features on this page, please enable JavaScript. Protein-losing enteropathy is an abnormal loss of protein ...

  7. Oligomeric protein structure networks: insights into protein-protein interactions

    Directory of Open Access Journals (Sweden)

    Brinda KV

    2005-12-01

    Full Text Available Abstract Background Protein-protein association is essential for a variety of cellular processes and hence a large number of investigations are being carried out to understand the principles of protein-protein interactions. In this study, oligomeric protein structures are viewed from a network perspective to obtain new insights into protein association. Structure graphs of proteins have been constructed from a non-redundant set of protein oligomer crystal structures by considering amino acid residues as nodes and the edges are based on the strength of the non-covalent interactions between the residues. The analysis of such networks has been carried out in terms of amino acid clusters and hubs (highly connected residues with special emphasis to protein interfaces. Results A variety of interactions such as hydrogen bond, salt bridges, aromatic and hydrophobic interactions, which occur at the interfaces are identified in a consolidated manner as amino acid clusters at the interface, from this study. Moreover, the characterization of the highly connected hub-forming residues at the interfaces and their comparison with the hubs from the non-interface regions and the non-hubs in the interface regions show that there is a predominance of charged interactions at the interfaces. Further, strong and weak interfaces are identified on the basis of the interaction strength between amino acid residues and the sizes of the interface clusters, which also show that many protein interfaces are stronger than their monomeric protein cores. The interface strengths evaluated based on the interface clusters and hubs also correlate well with experimentally determined dissociation constants for known complexes. Finally, the interface hubs identified using the present method correlate very well with experimentally determined hotspots in the interfaces of protein complexes obtained from the Alanine Scanning Energetics database (ASEdb. A few predictions of interface hot

  8. Protein surface shielding agents in protein crystallization

    International Nuclear Information System (INIS)

    Hašek, J.

    2011-01-01

    The crystallization process can be controlled by protein surface shielding agents blocking undesirable competitive adhesion modes during non-equilibrium processes of deposition of protein molecules on the surface of growing crystalline blocks. The hypothesis is based on a number of experimental proofs from diffraction experiments and also retrieved from the Protein Data Bank. The molecules adhering temporarily on the surface of protein molecules change the propensity of protein molecules to deposit on the crystal surface in a definite position and orientation. The concepts of competitive adhesion modes and protein surface shielding agents acting on the surface of molecules in a non-equilibrium process of protein crystallization provide a useful platform for the control of crystallization. The desirable goal, i.e. a transient preference of a single dominating adhesion mode between protein molecules during crystallization, leads to uniform deposition of proteins in a crystal. This condition is the most important factor for diffraction quality and thus also for the accuracy of protein structure determination. The presented hypothesis is a generalization of the experimentally well proven behaviour of hydrophilic polymers on the surface of protein molecules of other compounds

  9. Protein sequence comparison and protein evolution

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, W.R. [Univ. of Virginia, Charlottesville, VA (United States). Dept. of Biochemistry

    1995-12-31

    This tutorial was one of eight tutorials selected to be presented at the Third International Conference on Intelligent Systems for Molecular Biology which was held in the United Kingdom from July 16 to 19, 1995. This tutorial examines how the information conserved during the evolution of a protein molecule can be used to infer reliably homology, and thus a shared proteinfold and possibly a shared active site or function. The authors start by reviewing a geological/evolutionary time scale. Next they look at the evolution of several protein families. During the tutorial, these families will be used to demonstrate that homologous protein ancestry can be inferred with confidence. They also examine different modes of protein evolution and consider some hypotheses that have been presented to explain the very earliest events in protein evolution. The next part of the tutorial will examine the technical aspects of protein sequence comparison. Both optimal and heuristic algorithms and their associated parameters that are used to characterize protein sequence similarities are discussed. Perhaps more importantly, they survey the statistics of local similarity scores, and how these statistics can both be used to improve the selectivity of a search and to evaluate the significance of a match. They them examine distantly related members of three protein families, the serine proteases, the glutathione transferases, and the G-protein-coupled receptors (GCRs). Finally, the discuss how sequence similarity can be used to examine internal repeated or mosaic structures in proteins.

  10. Protein Structure Prediction by Protein Threading

    Science.gov (United States)

    Xu, Ying; Liu, Zhijie; Cai, Liming; Xu, Dong

    The seminal work of Bowie, Lüthy, and Eisenberg (Bowie et al., 1991) on "the inverse protein folding problem" laid the foundation of protein structure prediction by protein threading. By using simple measures for fitness of different amino acid types to local structural environments defined in terms of solvent accessibility and protein secondary structure, the authors derived a simple and yet profoundly novel approach to assessing if a protein sequence fits well with a given protein structural fold. Their follow-up work (Elofsson et al., 1996; Fischer and Eisenberg, 1996; Fischer et al., 1996a,b) and the work by Jones, Taylor, and Thornton (Jones et al., 1992) on protein fold recognition led to the development of a new brand of powerful tools for protein structure prediction, which we now term "protein threading." These computational tools have played a key role in extending the utility of all the experimentally solved structures by X-ray crystallography and nuclear magnetic resonance (NMR), providing structural models and functional predictions for many of the proteins encoded in the hundreds of genomes that have been sequenced up to now.

  11. Polymer Directed Protein Assemblies

    NARCIS (Netherlands)

    van Rijn, Patrick

    2013-01-01

    Protein aggregation and protein self-assembly is an important occurrence in natural systems, and is in some form or other dictated by biopolymers. Very obvious influences of biopolymers on protein assemblies are, e. g., virus particles. Viruses are a multi-protein assembly of which the morphology is

  12. Amino acids and proteins

    Science.gov (United States)

    A balanced, safe diet with proteins is important to meet nutritional requirements. Proteins occur in animal as well as vegetable products in important quantities. In some countries, many people obtain much of their protein from animal products. In other regions, the major portion of dietary protein ...

  13. The Protein Model Portal

    OpenAIRE

    Arnold, Konstantin; Kiefer, Florian; Kopp, J?rgen; Battey, James N. D.; Podvinec, Michael; Westbrook, John D.; Berman, Helen M.; Bordoli, Lorenza; Schwede, Torsten

    2008-01-01

    Structural Genomics has been successful in determining the structures of many unique proteins in a high throughput manner. Still, the number of known protein sequences is much larger than the number of experimentally solved protein structures. Homology (or comparative) modeling methods make use of experimental protein structures to build models for evolutionary related proteins. Thereby, experimental structure determination efforts and homology modeling complement each other in the exploratio...

  14. Protein- protein interaction detection system using fluorescent protein microdomains

    Science.gov (United States)

    Waldo, Geoffrey S.; Cabantous, Stephanie

    2010-02-23

    The invention provides a protein labeling and interaction detection system based on engineered fragments of fluorescent and chromophoric proteins that require fused interacting polypeptides to drive the association of the fragments, and further are soluble and stable, and do not change the solubility of polypeptides to which they are fused. In one embodiment, a test protein X is fused to a sixteen amino acid fragment of GFP (.beta.-strand 10, amino acids 198-214), engineered to not perturb fusion protein solubility. A second test protein Y is fused to a sixteen amino acid fragment of GFP (.beta.-strand 11, amino acids 215-230), engineered to not perturb fusion protein solubility. When X and Y interact, they bring the GFP strands into proximity, and are detected by complementation with a third GFP fragment consisting of GFP amino acids 1-198 (strands 1-9). When GFP strands 10 and 11 are held together by interaction of protein X and Y, they spontaneous association with GFP strands 1-9, resulting in structural complementation, folding, and concomitant GFP fluorescence.

  15. Comparing side chain packing in soluble proteins, protein-protein interfaces, and transmembrane proteins.

    Science.gov (United States)

    Gaines, J C; Acebes, S; Virrueta, A; Butler, M; Regan, L; O'Hern, C S

    2018-05-01

    We compare side chain prediction and packing of core and non-core regions of soluble proteins, protein-protein interfaces, and transmembrane proteins. We first identified or created comparable databases of high-resolution crystal structures of these 3 protein classes. We show that the solvent-inaccessible cores of the 3 classes of proteins are equally densely packed. As a result, the side chains of core residues at protein-protein interfaces and in the membrane-exposed regions of transmembrane proteins can be predicted by the hard-sphere plus stereochemical constraint model with the same high prediction accuracies (>90%) as core residues in soluble proteins. We also find that for all 3 classes of proteins, as one moves away from the solvent-inaccessible core, the packing fraction decreases as the solvent accessibility increases. However, the side chain predictability remains high (80% within 30°) up to a relative solvent accessibility, rSASA≲0.3, for all 3 protein classes. Our results show that ≈40% of the interface regions in protein complexes are "core", that is, densely packed with side chain conformations that can be accurately predicted using the hard-sphere model. We propose packing fraction as a metric that can be used to distinguish real protein-protein interactions from designed, non-binding, decoys. Our results also show that cores of membrane proteins are the same as cores of soluble proteins. Thus, the computational methods we are developing for the analysis of the effect of hydrophobic core mutations in soluble proteins will be equally applicable to analyses of mutations in membrane proteins. © 2018 Wiley Periodicals, Inc.

  16. IGSF9 Family Proteins

    DEFF Research Database (Denmark)

    Hansen, Maria; Walmod, Peter Schledermann

    2013-01-01

    The Drosophila protein Turtle and the vertebrate proteins immunoglobulin superfamily (IgSF), member 9 (IGSF9/Dasm1) and IGSF9B are members of an evolutionarily ancient protein family. A bioinformatics analysis of the protein family revealed that invertebrates contain only a single IGSF9 family gene......, the longest isoforms of the proteins have the same general organization as the neural cell adhesion molecule family of cell adhesion molecule proteins, and like this family of proteins, IGSF9 family members are expressed in the nervous system. A review of the literature revealed that Drosophila Turtle...... facilitates homophilic cell adhesion. Moreover, IGSF9 family proteins have been implicated in the outgrowth and branching of neurites, axon guidance, synapse maturation, self-avoidance, and tiling. However, despite the few published studies on IGSF9 family proteins, reports on the functions of both Turtle...

  17. Personalizing Protein Nourishment

    Science.gov (United States)

    DALLAS, DAVID C.; SANCTUARY, MEGAN R.; QU, YUNYAO; KHAJAVI, SHABNAM HAGHIGHAT; VAN ZANDT, ALEXANDRIA E.; DYANDRA, MELISSA; FRESE, STEVEN A.; BARILE, DANIELA; GERMAN, J. BRUCE

    2016-01-01

    Proteins are not equally digestible—their proteolytic susceptibility varies by their source and processing method. Incomplete digestion increases colonic microbial protein fermentation (putrefaction), which produces toxic metabolites that can induce inflammation in vitro and have been associated with inflammation in vivo. Individual humans differ in protein digestive capacity based on phenotypes, particularly disease states. To avoid putrefaction-induced intestinal inflammation, protein sources and processing methods must be tailored to the consumer’s digestive capacity. This review explores how food processing techniques alter protein digestibility and examines how physiological conditions alter digestive capacity. Possible solutions to improving digestive function or matching low digestive capacity with more digestible protein sources are explored. Beyond the ileal digestibility measurements of protein digestibility, less invasive, quicker and cheaper techniques for monitoring the extent of protein digestion and fermentation are needed to personalize protein nourishment. Biomarkers of protein digestive capacity and efficiency can be identified with the toolsets of peptidomics, metabolomics, microbial sequencing and multiplexed protein analysis of fecal and urine samples. By monitoring individual protein digestive function, the protein component of diets can be tailored via protein source and processing selection to match individual needs to minimize colonic putrefaction and, thus, optimize gut health. PMID:26713355

  18. Prediction of Protein-Protein Interactions Related to Protein Complexes Based on Protein Interaction Networks

    Directory of Open Access Journals (Sweden)

    Peng Liu

    2015-01-01

    Full Text Available A method for predicting protein-protein interactions based on detected protein complexes is proposed to repair deficient interactions derived from high-throughput biological experiments. Protein complexes are pruned and decomposed into small parts based on the adaptive k-cores method to predict protein-protein interactions associated with the complexes. The proposed method is adaptive to protein complexes with different structure, number, and size of nodes in a protein-protein interaction network. Based on different complex sets detected by various algorithms, we can obtain different prediction sets of protein-protein interactions. The reliability of the predicted interaction sets is proved by using estimations with statistical tests and direct confirmation of the biological data. In comparison with the approaches which predict the interactions based on the cliques, the overlap of the predictions is small. Similarly, the overlaps among the predicted sets of interactions derived from various complex sets are also small. Thus, every predicted set of interactions may complement and improve the quality of the original network data. Meanwhile, the predictions from the proposed method replenish protein-protein interactions associated with protein complexes using only the network topology.

  19. Athoropometric measurements and plasma proteins in protein ...

    African Journals Online (AJOL)

    Athoropometric measurements and plasma proteins in protein energy malnutrition. MH Etukudo, EO Agbedana, OO Akinyinka, BOA Osifo. Abstract. No Abstract. Global Journal of Medical Sciences Vol. 5(1) 2006: 7-11. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  20. Polymer Directed Protein Assemblies

    Directory of Open Access Journals (Sweden)

    Patrick van Rijn

    2013-05-01

    Full Text Available Protein aggregation and protein self-assembly is an important occurrence in natural systems, and is in some form or other dictated by biopolymers. Very obvious influences of biopolymers on protein assemblies are, e.g., virus particles. Viruses are a multi-protein assembly of which the morphology is dictated by poly-nucleotides namely RNA or DNA. This “biopolymer” directs the proteins and imposes limitations on the structure like the length or diameter of the particle. Not only do these bionanoparticles use polymer-directed self-assembly, also processes like amyloid formation are in a way a result of directed protein assembly by partial unfolded/misfolded biopolymers namely, polypeptides. The combination of proteins and synthetic polymers, inspired by the natural processes, are therefore regarded as a highly promising area of research. Directed protein assembly is versatile with respect to the possible interactions which brings together the protein and polymer, e.g., electrostatic, v.d. Waals forces or covalent conjugation, and possible combinations are numerous due to the large amounts of different polymers and proteins available. The protein-polymer interacting behavior and overall morphology is envisioned to aid in clarifying protein-protein interactions and are thought to entail some interesting new functions and properties which will ultimately lead to novel bio-hybrid materials.

  1. Protein and protein hydrolysates in sports nutrition.

    Science.gov (United States)

    van Loon, Luc J C; Kies, Arie K; Saris, Wim H M

    2007-08-01

    With the increasing knowledge about the role of nutrition in increasing exercise performance, it has become clear over the last 2 decades that amino acids, protein, and protein hydrolysates can play an important role. Most of the attention has been focused on their effects at a muscular level. As these nutrients are ingested, however, it also means that gastrointestinal digestibility and absorption can modulate their efficacy significantly. Therefore, discussing the role of amino acids, protein, and protein hydrolysates in sports nutrition entails holding a discussion on all levels of the metabolic route. On May 28-29, 2007, a small group of researchers active in the field of exercise science and protein metabolism presented an overview of the different aspects of the application of protein and protein hydrolysates in sports nutrition. In addition, they were asked to share their opinions on the future progress in their fields of research. In this overview, an introduction to the workshop and a short summary of its outcome is provided.

  2. Protein Data Bank (PDB)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Protein Data Bank (PDB) archive is the single worldwide repository of information about the 3D structures of large biological molecules, including proteins and...

  3. Learning about Proteins

    Science.gov (United States)

    ... Fitness Diseases & Conditions Infections Drugs & Alcohol School & Jobs Sports Expert Answers (Q&A) Staying Safe Videos for Educators Search English Español Learning About Proteins KidsHealth / For Kids / Learning About Proteins What's in ...

  4. Protein electrophoresis - serum

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003540.htm Protein electrophoresis - serum To use the sharing features on ... JavaScript. This lab test measures the types of protein in the fluid (serum) part of a blood ...

  5. Polarizable protein packing

    KAUST Repository

    Ng, Albert H.; Snow, Christopher D.

    2011-01-01

    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full

  6. Urine protein electrophoresis test

    Science.gov (United States)

    Urine protein electrophoresis; UPEP; Multiple myeloma - UPEP; Waldenström macroglobulinemia - UPEP; Amyloidosis - UPEP ... special paper and apply an electric current. The proteins move and form visible bands. These reveal the ...

  7. Allosteric Regulation of Proteins

    Indian Academy of Sciences (India)

    interactions with other proteins, or binding of small molecules. Covalent .... vealed through structural elucidation of the protein in free and oxygen-bound forms .... stance, molecular dynamic simulation of glutamine binding pro- tein shows that ...

  8. NMR of unfolded proteins

    Indian Academy of Sciences (India)

    Unknown

    2005-01-03

    Jan 3, 2005 ... covering all the systems, so far discovered.5,7,8,12. With the increasing ... Structural investigations on proteins by NMR are, currently ... rapid analysis of unfolded proteins. ...... and hence help in design of drugs against them.

  9. CSF total protein

    Science.gov (United States)

    CSF total protein is a test to determine the amount of protein in your spinal fluid, also called cerebrospinal fluid (CSF). ... The normal protein range varies from lab to lab, but is typically about 15 to 60 milligrams per deciliter (mg/dL) ...

  10. Protein - Which is Best?

    Science.gov (United States)

    Hoffman, Jay R; Falvo, Michael J

    2004-09-01

    Protein intake that exceeds the recommended daily allowance is widely accepted for both endurance and power athletes. However, considering the variety of proteins that are available much less is known concerning the benefits of consuming one protein versus another. The purpose of this paper is to identify and analyze key factors in order to make responsible recommendations to both the general and athletic populations. Evaluation of a protein is fundamental in determining its appropriateness in the human diet. Proteins that are of inferior content and digestibility are important to recognize and restrict or limit in the diet. Similarly, such knowledge will provide an ability to identify proteins that provide the greatest benefit and should be consumed. The various techniques utilized to rate protein will be discussed. Traditionally, sources of dietary protein are seen as either being of animal or vegetable origin. Animal sources provide a complete source of protein (i.e. containing all essential amino acids), whereas vegetable sources generally lack one or more of the essential amino acids. Animal sources of dietary protein, despite providing a complete protein and numerous vitamins and minerals, have some health professionals concerned about the amount of saturated fat common in these foods compared to vegetable sources. The advent of processing techniques has shifted some of this attention and ignited the sports supplement marketplace with derivative products such as whey, casein and soy. Individually, these products vary in quality and applicability to certain populations. The benefits that these particular proteins possess are discussed. In addition, the impact that elevated protein consumption has on health and safety issues (i.e. bone health, renal function) are also reviewed. Key PointsHigher protein needs are seen in athletic populations.Animal proteins is an important source of protein, however potential health concerns do exist from a diet of protein

  11. Peptide segments in protein-protein interfaces

    Indian Academy of Sciences (India)

    Prakash

    2006-09-06

    Sep 6, 2006 ... contact surface from the rest of the protein surface have been used to identify ..... interfaces the contribution of the charged residues, such as. Lys, Asp and ..... Lawrence M C and Colman P M 1993 Shape complementarity at.

  12. Highly thermostable fluorescent proteins

    Science.gov (United States)

    Bradbury, Andrew M [Santa Fe, NM; Waldo, Geoffrey S [Santa Fe, NM; Kiss, Csaba [Los Alamos, NM

    2011-03-22

    Thermostable fluorescent proteins (TSFPs), methods for generating these and other stability-enhanced proteins, polynucleotides encoding such proteins, and assays and method for using the TSFPs and TSFP-encoding nucleic acid molecules are provided. The TSFPs of the invention show extremely enhanced levels of stability and thermotolerance. In one case, for example, a TSFP of the invention is so stable it can be heated to 99.degree. C. for short periods of time without denaturing, and retains 85% of its fluorescence when heated to 80.degree. C. for several minutes. The invention also provides a method for generating stability-enhanced variants of a protein, including but not limited to fluorescent proteins.

  13. Intracellular protein breakdown. 8

    International Nuclear Information System (INIS)

    Bohley, P.; Kirschke, H.; Langner, J.; Wiederanders, B.; Ansorge, S.

    1976-01-01

    Double-labelled proteins from rat liver cytosol ( 14 C in long-lived, 3 H in short-lived proteins after in-vivo-labelling) are used as substrates for unlabelled proteinases in vitro. Differences in the degradation rates of short-lived and long-lived proteins in vitro by different proteinases and after addition of different effectors allow conclusions concerning their importance for the in-vivo-turnover of substrate proteins. The main activity (>90%) of soluble lysosomal proteinases at pH 6.1 and pH 6.9 is caused by thiolproteinases, which degrade preferentially short-lived cytosol proteins. These proteinases are inhibited by leupeptin. Autolysis of double-labelled cell fractions shows a remarkably faster breakdown of short-lived substrate proteins only in the soluble part of lysosomes. Microsomal fractions degrade in vitro preferentially long-lived substrate proteins. (author)

  14. Protein carbonylation in plants

    DEFF Research Database (Denmark)

    Møller, Ian Max; Havelund, Jesper; Rogowska-Wrzesinska, Adelina

    2017-01-01

    This chapter provides an overview of the current knowledge on protein carbonylation in plants and its role in plant physiology. It starts with a brief outline of the turnover and production sites of reactive oxygen species (ROS) in plants and the causes of protein carbonylation. This is followed...... by a description of the methods used to study protein carbonylation in plants, which is also very brief as the methods are similar to those used in studies on animals. The chapter also focuses on protein carbonylation in plants in general and in mitochondria and in seeds in particular, as case stories where...... specific carbonylated proteins have been identified. Protein carbonylation appears to accumulate at all stages of seed development and germination investigated to date. In some cases, such as seed aging, it is probably simply an accumulation of oxidative damage. However, in other cases protein...

  15. Racemic protein crystallography.

    Science.gov (United States)

    Yeates, Todd O; Kent, Stephen B H

    2012-01-01

    Although natural proteins are chiral and are all of one "handedness," their mirror image forms can be prepared by chemical synthesis. This opens up new opportunities for protein crystallography. A racemic mixture of the enantiomeric forms of a protein molecule can crystallize in ways that natural proteins cannot. Recent experimental data support a theoretical prediction that this should make racemic protein mixtures highly amenable to crystallization. Crystals obtained from racemic mixtures also offer advantages in structure determination strategies. The relevance of these potential advantages is heightened by advances in synthetic methods, which are extending the size limit for proteins that can be prepared by chemical synthesis. Recent ideas and results in the area of racemic protein crystallography are reviewed.

  16. Texturized dairy proteins.

    Science.gov (United States)

    Onwulata, Charles I; Phillips, John G; Tunick, Michael H; Qi, Phoebi X; Cooke, Peter H

    2010-03-01

    Dairy proteins are amenable to structural modifications induced by high temperature, shear, and moisture; in particular, whey proteins can change conformation to new unfolded states. The change in protein state is a basis for creating new foods. The dairy products, nonfat dried milk (NDM), whey protein concentrate (WPC), and whey protein isolate (WPI) were modified using a twin-screw extruder at melt temperatures of 50, 75, and 100 degrees C, and moistures ranging from 20 to 70 wt%. Viscoelasticity and solubility measurements showed that extrusion temperature was a more significant (P extruded dairy protein ranged from rigid (2500 N) to soft (2.7 N). Extruding at or above 75 degrees C resulted in increased peak force for WPC (138 to 2500 N) and WPI (2.7 to 147.1 N). NDM was marginally texturized; the presence of lactose interfered with its texturization. WPI products extruded at 50 degrees C were not texturized; their solubility values ranged from 71.8% to 92.6%. A wide possibility exists for creating new foods with texturized dairy proteins due to the extensive range of states achievable. Dairy proteins can be used to boost the protein content in puffed snacks made from corn meal, but unmodified, they bind water and form doughy pastes with starch. To minimize the water binding property of dairy proteins, WPI, or WPC, or NDM were modified by extrusion processing. Extrusion temperature conditions were adjusted to 50, 75, or 100 degrees C, sufficient to change the structure of the dairy proteins, but not destroy them. Extrusion modified the structures of these dairy proteins for ease of use in starchy foods to boost nutrient levels. Dairy proteins can be used to boost the protein content in puffed snacks made from corn meal, but unmodified, they bind water and form doughy pastes with starch. To minimize the water binding property of dairy proteins, whey protein isolate, whey protein concentrate, or nonfat dried milk were modified by extrusion processing. Extrusion

  17. Protein kinesis: The dynamics of protein trafficking and stability

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-31

    The purpose of this conference is to provide a multidisciplinary forum for exchange of state-of-the-art information on protein kinesis. This volume contains abstracts of papers in the following areas: protein folding and modification in the endoplasmic reticulum; protein trafficking; protein translocation and folding; protein degradation; polarity; nuclear trafficking; membrane dynamics; and protein import into organelles.

  18. PROTEIN - WHICH IS BEST?

    Directory of Open Access Journals (Sweden)

    Michael J. Falvo

    2004-09-01

    Full Text Available Protein intake that exceeds the recommended daily allowance is widely accepted for both endurance and power athletes. However, considering the variety of proteins that are available much less is known concerning the benefits of consuming one protein versus another. The purpose of this paper is to identify and analyze key factors in order to make responsible recommendations to both the general and athletic populations. Evaluation of a protein is fundamental in determining its appropriateness in the human diet. Proteins that are of inferior content and digestibility are important to recognize and restrict or limit in the diet. Similarly, such knowledge will provide an ability to identify proteins that provide the greatest benefit and should be consumed. The various techniques utilized to rate protein will be discussed. Traditionally, sources of dietary protein are seen as either being of animal or vegetable origin. Animal sources provide a complete source of protein (i.e. containing all essential amino acids, whereas vegetable sources generally lack one or more of the essential amino acids. Animal sources of dietary protein, despite providing a complete protein and numerous vitamins and minerals, have some health professionals concerned about the amount of saturated fat common in these foods compared to vegetable sources. The advent of processing techniques has shifted some of this attention and ignited the sports supplement marketplace with derivative products such as whey, casein and soy. Individually, these products vary in quality and applicability to certain populations. The benefits that these particular proteins possess are discussed. In addition, the impact that elevated protein consumption has on health and safety issues (i.e. bone health, renal function are also reviewed

  19. Specificity and affinity quantification of protein-protein interactions.

    Science.gov (United States)

    Yan, Zhiqiang; Guo, Liyong; Hu, Liang; Wang, Jin

    2013-05-01

    Most biological processes are mediated by the protein-protein interactions. Determination of the protein-protein structures and insight into their interactions are vital to understand the mechanisms of protein functions. Currently, compared with the isolated protein structures, only a small fraction of protein-protein structures are experimentally solved. Therefore, the computational docking methods play an increasing role in predicting the structures and interactions of protein-protein complexes. The scoring function of protein-protein interactions is the key responsible for the accuracy of the computational docking. Previous scoring functions were mostly developed by optimizing the binding affinity which determines the stability of the protein-protein complex, but they are often lack of the consideration of specificity which determines the discrimination of native protein-protein complex against competitive ones. We developed a scoring function (named as SPA-PP, specificity and affinity of the protein-protein interactions) by incorporating both the specificity and affinity into the optimization strategy. The testing results and comparisons with other scoring functions show that SPA-PP performs remarkably on both predictions of binding pose and binding affinity. Thus, SPA-PP is a promising quantification of protein-protein interactions, which can be implemented into the protein docking tools and applied for the predictions of protein-protein structure and affinity. The algorithm is implemented in C language, and the code can be downloaded from http://dl.dropbox.com/u/1865642/Optimization.cpp.

  20. General protein-protein cross-linking.

    Science.gov (United States)

    Alegria-Schaffer, Alice

    2014-01-01

    This protocol describes a general protein-to-protein cross-linking procedure using the water-soluble amine-reactive homobifunctional BS(3) (bis[sulfosuccinimidyl] suberate); however, the protocol can be easily adapted using other cross-linkers of similar properties. BS(3) is composed of two sulfo-NHS ester groups and an 11.4 Å linker. Sulfo-NHS ester groups react with primary amines in slightly alkaline conditions (pH 7.2-8.5) and yield stable amide bonds. The reaction releases N-hydroxysuccinimide (see an application of NHS esters on Labeling a protein with fluorophores using NHS ester derivitization). © 2014 Elsevier Inc. All rights reserved.

  1. Scoring functions for protein-protein interactions.

    Science.gov (United States)

    Moal, Iain H; Moretti, Rocco; Baker, David; Fernández-Recio, Juan

    2013-12-01

    The computational evaluation of protein-protein interactions will play an important role in organising the wealth of data being generated by high-throughput initiatives. Here we discuss future applications, report recent developments and identify areas requiring further investigation. Many functions have been developed to quantify the structural and energetic properties of interacting proteins, finding use in interrelated challenges revolving around the relationship between sequence, structure and binding free energy. These include loop modelling, side-chain refinement, docking, multimer assembly, affinity prediction, affinity change upon mutation, hotspots location and interface design. Information derived from models optimised for one of these challenges can be used to benefit the others, and can be unified within the theoretical frameworks of multi-task learning and Pareto-optimal multi-objective learning. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. Computational Protein Design

    DEFF Research Database (Denmark)

    Johansson, Kristoffer Enøe

    Proteins are the major functional group of molecules in biology. The impact of protein science on medicine and chemical productions is rapidly increasing. However, the greatest potential remains to be realized. The fi eld of protein design has advanced computational modeling from a tool of support...... to a central method that enables new developments. For example, novel enzymes with functions not found in natural proteins have been de novo designed to give enough activity for experimental optimization. This thesis presents the current state-of-the-art within computational design methods together...... with a novel method based on probability theory. With the aim of assembling a complete pipeline for protein design, this work touches upon several aspects of protein design. The presented work is the computational half of a design project where the other half is dedicated to the experimental part...

  3. Blue Emission in Proteins

    OpenAIRE

    Sarkar, Sohini; Sengupta, Abhigyan; Hazra, Partha; Mandal, Pankaj

    2014-01-01

    Recent literatures reported blue-green emission from amyloid fibril as exclusive signature of fibril formation. This unusual visible luminescence is regularly used to monitor fibril growth. Blue-green emission has also been observed in crystalline protein and in solution. However, the origin of this emission is not known exactly. Our spectroscopic study of serum proteins reveals that the blue-green emission is a property of protein monomer. Evidences suggest that semiconductor-like band struc...

  4. Pressure cryocooling protein crystals

    Science.gov (United States)

    Kim, Chae Un [Ithaca, NY; Gruner, Sol M [Ithaca, NY

    2011-10-04

    Preparation of cryocooled protein crystal is provided by use of helium pressurizing and cryocooling to obtain cryocooled protein crystal allowing collection of high resolution data and by heavier noble gas (krypton or xenon) binding followed by helium pressurizing and cryocooling to obtain cryocooled protein crystal for collection of high resolution data and SAD phasing simultaneously. The helium pressurizing is carried out on crystal coated to prevent dehydration or on crystal grown in aqueous solution in a capillary.

  5. Yeast ribosomal proteins

    International Nuclear Information System (INIS)

    Otaka, E.; Kobata, K.

    1978-01-01

    The cytoplasmic 80s ribosomal proteins from the cells of yeast Saccharomyces cerevisiae were analyzed by SDS two-dimensional polyacrylamide gel electrophoresis. Seventyfour proteins were identified and consecutively numbered from 1 to 74. Upon oxidation of the 80s proteins with performic acid, ten proteins (no. 15, 20, 35, 40, 44, 46, 49, 51, 54 and 55) were dislocated on the gel without change of the total number of protein spots. Five proteins (no. 8, 14, 16, 36 and 74) were phosphorylated in vivo as seen in 32 P-labelling experiments. The large and small subunits separated in low magnesium medium were analyzed by the above gel electrophoresis. At least forty-five and twenty-eight proteins were assumed to be in the large and small subunits, respectively. All proteins found in the 80s ribosomes, except for no. 3, were detected in either subunit without appearance of new spots. The acidic protein no. 3 seems to be lost during subunit dissociation. (orig.) [de

  6. Physics of protein folding

    Science.gov (United States)

    Finkelstein, A. V.; Galzitskaya, O. V.

    2004-04-01

    Protein physics is grounded on three fundamental experimental facts: protein, this long heteropolymer, has a well defined compact three-dimensional structure; this structure can spontaneously arise from the unfolded protein chain in appropriate environment; and this structure is separated from the unfolded state of the chain by the “all-or-none” phase transition, which ensures robustness of protein structure and therefore of its action. The aim of this review is to consider modern understanding of physical principles of self-organization of protein structures and to overview such important features of this process, as finding out the unique protein structure among zillions alternatives, nucleation of the folding process and metastable folding intermediates. Towards this end we will consider the main experimental facts and simple, mostly phenomenological theoretical models. We will concentrate on relatively small (single-domain) water-soluble globular proteins (whose structure and especially folding are much better studied and understood than those of large or membrane and fibrous proteins) and consider kinetic and structural aspects of transition of initially unfolded protein chains into their final solid (“native”) 3D structures.

  7. Ultrafiltration of pegylated proteins

    Science.gov (United States)

    Molek, Jessica R.

    There is considerable clinical interest in the use of "second-generation" therapeutics produced by conjugation of a native protein with various polymers including polyethylene glycol (PEG). PEG--protein conjugates, so-called PEGylated proteins, can exhibit enhanced stability, half-life, and bioavailability. One of the challenges in the commercial production of PEGylated proteins is the purification required to remove unreacted polymer, native protein, and in many cases PEGylated proteins with nonoptimal degrees of conjugation. The overall objective of this thesis was to examine the use of ultrafiltration for the purification of PEGylated proteins. This included: (1) analysis of size-based separation of PEGylated proteins using conventional ultrafiltration membranes, (2) use of electrically-charged membranes to exploit differences in electrostatic interactions, and (3) examination of the effects of PEGylation on protein fouling. The experimental results were analyzed using appropriate theoretical models, with the underlying physical properties of the PEGylated proteins evaluated using size exclusion chromatography, capillary electrophoresis, dynamic light scattering, and reverse phase chromatography. PEGylated proteins were produced by covalent attachment of activated PEG to a protein via primary amines on the lysine residues. A simple model was developed for the reaction kinetics, which was used to explore the effect of reaction conditions and mode of operation on the distribution of PEGylated products. The effective size of the PEGylated proteins was evaluated using size exclusion chromatography, with appropriate correlations developed for the size in terms of the molecular weight of the native protein and attached PEG. The electrophoretic mobility of the PEGylated proteins were evaluated by capillary electrophoresis with the data in good agreement with a simple model accounting for the increase in protein size and the reduction in the number of protonated amine

  8. Advances in Protein Precipitation

    NARCIS (Netherlands)

    Golubovic, M.

    2009-01-01

    Proteins are biological macromolecules, which are among the key components of all living organisms. Proteins are nowadays present in all fields of biotech industry, such as food and feed, synthetic and pharmaceutical industry. They are isolated from their natural sources or produced in different

  9. Synthesis of Lipidated Proteins.

    Science.gov (United States)

    Mejuch, Tom; Waldmann, Herbert

    2016-08-17

    Protein lipidation is one of the major post-translational modifications (PTM) of proteins. The attachment of the lipid moiety frequently determines the localization and the function of the lipoproteins. Lipidated proteins participate in many essential biological processes in eukaryotic cells, including vesicular trafficking, signal transduction, and regulation of the immune response. Malfunction of these cellular processes usually leads to various diseases such as cancer. Understanding the mechanism of cellular signaling and identifying the protein-protein and protein-lipid interactions in which the lipoproteins are involved is a crucial task. To achieve these goals, fully functional lipidated proteins are required. However, access to lipoproteins by means of standard expression is often rather limited. Therefore, semisynthetic methods, involving the synthesis of lipidated peptides and their subsequent chemoselective ligation to yield full-length lipoproteins, were developed. In this Review we summarize the commonly used methods for lipoprotein synthesis and the development of the corresponding chemoselective ligation techniques. Several key studies involving full-length semisynthetic lipidated Ras, Rheb, and LC3 proteins are presented.

  10. Amino acids and proteins

    NARCIS (Netherlands)

    van Goudoever, Johannes B.; Vlaardingerbroek, Hester; van den Akker, Chris H.; de Groof, Femke; van der Schoor, Sophie R. D.

    2014-01-01

    Amino acids and protein are key factors for growth. The neonatal period requires the highest intake in life to meet the demands. Those demands include amino acids for growth, but proteins and amino acids also function as signalling molecules and function as neurotransmitters. Often the nutritional

  11. Protein Attachment on Nanodiamonds.

    Science.gov (United States)

    Lin, Chung-Lun; Lin, Cheng-Huang; Chang, Huan-Cheng; Su, Meng-Chih

    2015-07-16

    A recent advance in nanotechnology is the scale-up production of small and nonaggregated diamond nanoparticles suitable for biological applications. Using detonation nanodiamonds (NDs) with an average diameter of ∼4 nm as the adsorbents, we have studied the static attachment of three proteins (myoglobin, bovine serum albumin, and insulin) onto the nanoparticles by optical spectroscopy, mass spectrometry, and dynamic light scattering, and electrophoretic zeta potential measurements. Results show that the protein surface coverage is predominantly determined by the competition between protein-protein and protein-ND interactions, giving each protein a unique and characteristic structural configuration in its own complex. Specifically, both myoglobin and bovine serum albumin show a Langmuir-type adsorption behavior, forming 1:1 complexes at saturation, whereas insulin folds into a tightly bound multimer before adsorption. The markedly different adsorption patterns appear to be independent of the protein concentration and are closely related to the affinity of the individual proteins for the NDs. The present study provides a fundamental understanding for the use of NDs as a platform for nanomedical drug delivery.

  12. Poxviral Ankyrin Proteins

    Directory of Open Access Journals (Sweden)

    Michael H. Herbert

    2015-02-01

    Full Text Available Multiple repeats of the ankyrin motif (ANK are ubiquitous throughout the kingdoms of life but are absent from most viruses. The main exception to this is the poxvirus family, and specifically the chordopoxviruses, with ANK repeat proteins present in all but three species from separate genera. The poxviral ANK repeat proteins belong to distinct orthologue groups spread over different species, and align well with the phylogeny of their genera. This distribution throughout the chordopoxviruses indicates these proteins were present in an ancestral vertebrate poxvirus, and have since undergone numerous duplication events. Most poxviral ANK repeat proteins contain an unusual topology of multiple ANK motifs starting at the N-terminus with a C-terminal poxviral homologue of the cellular F-box enabling interaction with the cellular SCF ubiquitin ligase complex. The subtle variations between ANK repeat proteins of individual poxviruses suggest an array of different substrates may be bound by these protein-protein interaction domains and, via the F-box, potentially directed to cellular ubiquitination pathways and possible degradation. Known interaction partners of several of these proteins indicate that the NF-κB coordinated anti-viral response is a key target, whilst some poxviral ANK repeat domains also have an F-box independent affect on viral host-range.

  13. Protein oxidation and peroxidation

    DEFF Research Database (Denmark)

    Davies, Michael Jonathan

    2016-01-01

    Proteins are major targets for radicals and two-electron oxidants in biological systems due to their abundance and high rate constants for reaction. With highly reactive radicals damage occurs at multiple side-chain and backbone sites. Less reactive species show greater selectivity with regard...... to the residues targeted and their spatial location. Modification can result in increased side-chain hydrophilicity, side-chain and backbone fragmentation, aggregation via covalent cross-linking or hydrophobic interactions, protein unfolding and altered conformation, altered interactions with biological partners...... and modified turnover. In the presence of O2, high yields of peroxyl radicals and peroxides (protein peroxidation) are formed; the latter account for up to 70% of the initial oxidant flux. Protein peroxides can oxidize both proteins and other targets. One-electron reduction results in additional radicals...

  14. Protein restriction and cancer.

    Science.gov (United States)

    Yin, Jie; Ren, Wenkai; Huang, Xingguo; Li, Tiejun; Yin, Yulong

    2018-03-26

    Protein restriction without malnutrition is currently an effective nutritional intervention known to prevent diseases and promote health span from yeast to human. Recently, low protein diets are reported to be associated with lowered cancer incidence and mortality risk of cancers in human. In murine models, protein restriction inhibits tumor growth via mTOR signaling pathway. IGF-1, amino acid metabolic programing, FGF21, and autophagy may also serve as potential mechanisms of protein restriction mediated cancer prevention. Together, dietary intervention aimed at reducing protein intake can be beneficial and has the potential to be widely adopted and effective in preventing and treating cancers. Copyright © 2018 Elsevier B.V. All rights reserved.

  15. Sensitizing properties of proteins

    DEFF Research Database (Denmark)

    Poulsen, Lars K.; Ladics, Gregory S; McClain, Scott

    2014-01-01

    The scope of allergy risk is diverse considering the myriad ways in which protein allergenicity is affected by physiochemical characteristics of proteins. The complexity created by the matrices of foods and the variability of the human immune system add additional challenges to understanding...... the relationship between sensitization potential and allergy disease. To address these and other issues, an April 2012 international symposium was held in Prague, Czech Republic, to review and discuss the state-of-the-science of sensitizing properties of protein allergens. The symposium, organized by the Protein...... Allergenicity Technical Committee of the International Life Sciences Institute's Health and Environmental Sciences Institute, featured presentations on current methods, test systems, research trends, and unanswered questions in the field of protein sensitization. A diverse group of over 70 interdisciplinary...

  16. Artificially Engineered Protein Polymers.

    Science.gov (United States)

    Yang, Yun Jung; Holmberg, Angela L; Olsen, Bradley D

    2017-06-07

    Modern polymer science increasingly requires precise control over macromolecular structure and properties for engineering advanced materials and biomedical systems. The application of biological processes to design and synthesize artificial protein polymers offers a means for furthering macromolecular tunability, enabling polymers with dispersities of ∼1.0 and monomer-level sequence control. Taking inspiration from materials evolved in nature, scientists have created modular building blocks with simplified monomer sequences that replicate the function of natural systems. The corresponding protein engineering toolbox has enabled the systematic development of complex functional polymeric materials across areas as diverse as adhesives, responsive polymers, and medical materials. This review discusses the natural proteins that have inspired the development of key building blocks for protein polymer engineering and the function of these elements in material design. The prospects and progress for scalable commercialization of protein polymers are reviewed, discussing both technology needs and opportunities.

  17. The Protein Model Portal.

    Science.gov (United States)

    Arnold, Konstantin; Kiefer, Florian; Kopp, Jürgen; Battey, James N D; Podvinec, Michael; Westbrook, John D; Berman, Helen M; Bordoli, Lorenza; Schwede, Torsten

    2009-03-01

    Structural Genomics has been successful in determining the structures of many unique proteins in a high throughput manner. Still, the number of known protein sequences is much larger than the number of experimentally solved protein structures. Homology (or comparative) modeling methods make use of experimental protein structures to build models for evolutionary related proteins. Thereby, experimental structure determination efforts and homology modeling complement each other in the exploration of the protein structure space. One of the challenges in using model information effectively has been to access all models available for a specific protein in heterogeneous formats at different sites using various incompatible accession code systems. Often, structure models for hundreds of proteins can be derived from a given experimentally determined structure, using a variety of established methods. This has been done by all of the PSI centers, and by various independent modeling groups. The goal of the Protein Model Portal (PMP) is to provide a single portal which gives access to the various models that can be leveraged from PSI targets and other experimental protein structures. A single interface allows all existing pre-computed models across these various sites to be queried simultaneously, and provides links to interactive services for template selection, target-template alignment, model building, and quality assessment. The current release of the portal consists of 7.6 million model structures provided by different partner resources (CSMP, JCSG, MCSG, NESG, NYSGXRC, JCMM, ModBase, SWISS-MODEL Repository). The PMP is available at http://www.proteinmodelportal.org and from the PSI Structural Genomics Knowledgebase.

  18. Parkinsonian motor impairment predicts personality domains related to genetic risk and treatment outcomes in schizophrenia.

    Science.gov (United States)

    Molina, Juan L; Calvó, María; Padilla, Eduardo; Balda, Mara; Alemán, Gabriela González; Florenzano, Néstor V; Guerrero, Gonzalo; Kamis, Danielle; Rangeon, Beatriz Molina; Bourdieu, Mercedes; Strejilevich, Sergio A; Conesa, Horacio A; Escobar, Javier I; Zwir, Igor; Cloninger, C Robert; de Erausquin, Gabriel A

    2017-01-01

    Identifying endophenotypes of schizophrenia is of critical importance and has profound implications on clinical practice. Here we propose an innovative approach to clarify the mechanims through which temperament and character deviance relates to risk for schizophrenia and predict long-term treatment outcomes. We recruited 61 antipsychotic naïve subjects with chronic schizophrenia, 99 unaffected relatives, and 68 healthy controls from rural communities in the Central Andes. Diagnosis was ascertained with the Schedules of Clinical Assessment in Neuropsychiatry; parkinsonian motor impairment was measured with the Unified Parkinson's Disease Rating Scale; mesencephalic parenchyma was evaluated with transcranial ultrasound; and personality traits were assessed using the Temperament and Character Inventory. Ten-year outcome data was available for ~40% of the index cases. Patients with schizophrenia had higher harm avoidance and self-transcendence (ST), and lower reward dependence (RD), cooperativeness (CO), and self-directedness (SD). Unaffected relatives had higher ST and lower CO and SD. Parkinsonism reliably predicted RD, CO, and SD after correcting for age and sex. The average duration of untreated psychosis (DUP) was over 5 years. Further, SD was anticorrelated with DUP and antipsychotic dosing at follow-up. Baseline DUP was related to antipsychotic dose-years. Further, 'explosive/borderline', 'methodical/obsessive', and 'disorganized/schizotypal' personality profiles were associated with increased risk of schizophrenia. Parkinsonism predicts core personality features and treatment outcomes in schizophrenia. Our study suggests that RD, CO, and SD are endophenotypes of the disease that may, in part, be mediated by dopaminergic function. Further, SD is an important determinant of treatment course and outcome.

  19. Coarse-grain modelling of protein-protein interactions

    NARCIS (Netherlands)

    Baaden, Marc; Marrink, Siewert J.

    2013-01-01

    Here, we review recent advances towards the modelling of protein-protein interactions (PPI) at the coarse-grained (CG) level, a technique that is now widely used to understand protein affinity, aggregation and self-assembly behaviour. PPI models of soluble proteins and membrane proteins are

  20. Protein-Protein Docking in Drug Design and Discovery.

    Science.gov (United States)

    Kaczor, Agnieszka A; Bartuzi, Damian; Stępniewski, Tomasz Maciej; Matosiuk, Dariusz; Selent, Jana

    2018-01-01

    Protein-protein interactions (PPIs) are responsible for a number of key physiological processes in the living cells and underlie the pathomechanism of many diseases. Nowadays, along with the concept of so-called "hot spots" in protein-protein interactions, which are well-defined interface regions responsible for most of the binding energy, these interfaces can be targeted with modulators. In order to apply structure-based design techniques to design PPIs modulators, a three-dimensional structure of protein complex has to be available. In this context in silico approaches, in particular protein-protein docking, are a valuable complement to experimental methods for elucidating 3D structure of protein complexes. Protein-protein docking is easy to use and does not require significant computer resources and time (in contrast to molecular dynamics) and it results in 3D structure of a protein complex (in contrast to sequence-based methods of predicting binding interfaces). However, protein-protein docking cannot address all the aspects of protein dynamics, in particular the global conformational changes during protein complex formation. In spite of this fact, protein-protein docking is widely used to model complexes of water-soluble proteins and less commonly to predict structures of transmembrane protein assemblies, including dimers and oligomers of G protein-coupled receptors (GPCRs). In this chapter we review the principles of protein-protein docking, available algorithms and software and discuss the recent examples, benefits, and drawbacks of protein-protein docking application to water-soluble proteins, membrane anchoring and transmembrane proteins, including GPCRs.

  1. Bacterial Ice Crystal Controlling Proteins

    Science.gov (United States)

    Lorv, Janet S. H.; Rose, David R.; Glick, Bernard R.

    2014-01-01

    Across the world, many ice active bacteria utilize ice crystal controlling proteins for aid in freezing tolerance at subzero temperatures. Ice crystal controlling proteins include both antifreeze and ice nucleation proteins. Antifreeze proteins minimize freezing damage by inhibiting growth of large ice crystals, while ice nucleation proteins induce formation of embryonic ice crystals. Although both protein classes have differing functions, these proteins use the same ice binding mechanisms. Rather than direct binding, it is probable that these protein classes create an ice surface prior to ice crystal surface adsorption. Function is differentiated by molecular size of the protein. This paper reviews the similar and different aspects of bacterial antifreeze and ice nucleation proteins, the role of these proteins in freezing tolerance, prevalence of these proteins in psychrophiles, and current mechanisms of protein-ice interactions. PMID:24579057

  2. Protein oxidation in aquatic foods

    DEFF Research Database (Denmark)

    Baron, Caroline P.

    2014-01-01

    The chapter discusses general considerations about protein oxidation and reviews the mechanisms involved in protein oxidation and consequences of protein oxidation on fish proteins. It presents two case studies, the first deals with protein and lipid oxidation in frozen rainbow trout......, and the second with oxidation in salted herring. The mechanisms responsible for initiation of protein oxidation are unclear, but it is generally accepted that free radical species initiating lipid oxidation can also initiate protein oxidation. The chapter focuses on interaction between protein and lipid...... oxidation. The protein carbonyl group measurement is the widely used method for estimating protein oxidation in foods and has been used in fish muscle. The chapter also talks about the impact of protein oxidation on protein functionality, fish muscle texture, and food nutritional value. Protein oxidation...

  3. Endometrial proteins: a reappraisal.

    Science.gov (United States)

    Seppälä, M; Julkunen, M; Riittinen, L; Koistinen, R

    1992-06-01

    Uterine factors influence reproduction at the macro-anatomy level, and the effects of hormonal steroids on endometrial morphology are well recognized in the histopathological diagnosis of dysfunctional bleeding and infertility. During the past decade, attention has been paid to endometrial protein synthesis and secretion with respect to endocrine stimuli and implantation, and to the paracrine/autocrine effects of endometrial peptide growth factors, their binding proteins and other factors. The emphasis of this presentation is on protein secretion of the secretory endometrium, in which progesterone plays a pivotal role. Insulin-like growth factors have receptors on the endometrium, and IGF-binding proteins, stimulated by progesterone, modulate the effects of IGFs locally. Also other protein products of the secretory endometrium have been reviewed in this communication, with special emphasis on studies of a progesterone-associated endometrial protein which has many names in the literature, such as PEP, PP14, alpha 2-PEG and AUP. Extensive studies are ongoing in many laboratories to elucidate the regulation, function, interplay at tissue and cellular levels, and clinical significance of these proteins.

  4. Protein trapping of nanoparticles

    International Nuclear Information System (INIS)

    Ang, Joo C.; Lin, Jack M.; Yaron, Peter N.; White, John W.

    2009-01-01

    Full text: We have observed the formation of protein-nanoparticle complexes at the air-water interfaces from three different methods of presenting the nanoparticles to proteins. The structures formed resemble the 'protein-nanoparticle corona' proposed by Lynch et al. [1-3) in relation to a possible route for nanoparticle entry into living cells. To do this, the methods of x-ray and neutron reflectivity (with isotopic contrast variation between the protein and nanoparticles) have been used to study the structures formed at the air-water interface of l 3 - casein presented to silica nanoparticle dispersions. Whilst the silica dispersions showed no observable reflectivity, strong signals appear in the reflectivity when protein is present. Drop-wise spreading of a small amount of protein at the air-silica sol interface and presentation of the silica sol to an isolated monomolecular protein film (made by the 'flow-trough' method [4]) gave an immediate signal. Mixing the components in solution only produces a slow response but in all cases a similar structure is formed. The different responses are interpreted in structural and stoichiometric ways.

  5. Intercellular protein-protein interactions at synapses.

    Science.gov (United States)

    Yang, Xiaofei; Hou, Dongmei; Jiang, Wei; Zhang, Chen

    2014-06-01

    Chemical synapses are asymmetric intercellular junctions through which neurons send nerve impulses to communicate with other neurons or excitable cells. The appropriate formation of synapses, both spatially and temporally, is essential for brain function and depends on the intercellular protein-protein interactions of cell adhesion molecules (CAMs) at synaptic clefts. The CAM proteins link pre- and post-synaptic sites, and play essential roles in promoting synapse formation and maturation, maintaining synapse number and type, accumulating neurotransmitter receptors and ion channels, controlling neuronal differentiation, and even regulating synaptic plasticity directly. Alteration of the interactions of CAMs leads to structural and functional impairments, which results in many neurological disorders, such as autism, Alzheimer's disease and schizophrenia. Therefore, it is crucial to understand the functions of CAMs during development and in the mature neural system, as well as in the pathogenesis of some neurological disorders. Here, we review the function of the major classes of CAMs, and how dysfunction of CAMs relates to several neurological disorders.

  6. Functional aspects of protein flexibility

    DEFF Research Database (Denmark)

    Teilum, Kaare; Olsen, Johan G; Kragelund, Birthe B

    2009-01-01

    this into an intuitive perception of protein function is challenging. Flexibility is of overwhelming importance for protein function, and the changes in protein structure during interactions with binding partners can be dramatic. The present review addresses protein flexibility, focusing on protein-ligand interactions...

  7. Alpha Shapes and Proteins

    DEFF Research Database (Denmark)

    Winter, Pawel; Sterner, Henrik; Sterner, Peter

    2009-01-01

    We provide a unified description of (weighted) alpha shapes, beta shapes and the corresponding simplicialcomplexes. We discuss their applicability to various protein-related problems. We also discuss filtrations of alpha shapes and touch upon related persistence issues.We claim that the full...... potential of alpha-shapes and related geometrical constructs in protein-related problems yet remains to be realized and verified. We suggest parallel algorithms for (weighted) alpha shapes, and we argue that future use of filtrations and kinetic variants for larger proteins will need such implementation....

  8. The Pentapeptide Repeat Proteins

    OpenAIRE

    Vetting, Matthew W.; Hegde, Subray S.; Fajardo, J. Eduardo; Fiser, Andras; Roderick, Steven L.; Takiff, Howard E.; Blanchard, John S.

    2006-01-01

    The Pentapeptide Repeat Protein (PRP) family has over 500 members in the prokaryotic and eukaryotic kingdoms. These proteins are composed of, or contain domains composed of, tandemly repeated amino acid sequences with a consensus sequence of [S,T,A,V][D,N][L,F]-[S,T,R][G]. The biochemical function of the vast majority of PRP family members is unknown. The three-dimensional structure of the first member of the PRP family was determined for the fluoroquinolone resistance protein (MfpA) from Myc...

  9. Pierced Lasso Proteins

    Science.gov (United States)

    Jennings, Patricia

    Entanglement and knots are naturally occurring, where, in the microscopic world, knots in DNA and homopolymers are well characterized. The most complex knots are observed in proteins which are harder to investigate, as proteins are heteropolymers composed of a combination of 20 different amino acids with different individual biophysical properties. As new-knotted topologies and new proteins containing knots continue to be discovered and characterized, the investigation of knots in proteins has gained intense interest. Thus far, the principle focus has been on the evolutionary origin of tying a knot, with questions of how a protein chain `self-ties' into a knot, what the mechanism(s) are that contribute to threading, and the biological relevance and functional implication of a knotted topology in vivo gaining the most insight. Efforts to study the fully untied and unfolded chain indicate that the knot is highly stable, remaining intact in the unfolded state orders of magnitude longer than first anticipated. The persistence of ``stable'' knots in the unfolded state, together with the challenge of defining an unfolded and untied chain from an unfolded and knotted chain, complicates the study of fully untied protein in vitro. Our discovery of a new class of knotted proteins, the Pierced Lassos (PL) loop topology, simplifies the knotting approach. While PLs are not easily recognizable by the naked eye, they have now been identified in many proteins in the PDB through the use of computation tools. PL topologies are diverse proteins found in all kingdoms of life, performing a large variety of biological responses such as cell signaling, immune responses, transporters and inhibitors (http://lassoprot.cent.uw.edu.pl/). Many of these PL topologies are secreted proteins, extracellular proteins, as well as, redox sensors, enzymes and metal and co-factor binding proteins; all of which provide a favorable environment for the formation of the disulphide bridge. In the PL

  10. Protein digestion in ruminants

    African Journals Online (AJOL)

    a balance between synthesis and hydrolysis. Aside from .... be used to follow the synthesis of this protein fraction. (Clarke, 1977a) .... form of digestive enzymes, urea and ammonia (Egan, ..... decreasing urine-nitrogen excretion (Thornton, Bird,.

  11. Dietary Proteins and Angiogenesis

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Medina

    2014-01-01

    Full Text Available Both defective and persistent angiogenesis are linked to pathological situations in the adult. Compounds able to modulate angiogenesis have a potential value for the treatment of such pathologies. Several small molecules present in the diet have been shown to have modulatory effects on angiogenesis. This review presents the current state of knowledge on the potential modulatory roles of dietary proteins on angiogenesis. There is currently limited available information on the topic. Milk contains at least three proteins for which modulatory effects on angiogenesis have been previously demonstrated. On the other hand, there is some scarce information on the potential of dietary lectins, edible plant proteins and high protein diets to modulate angiogenesis.

  12. Electron transfer in proteins

    DEFF Research Database (Denmark)

    Farver, O; Pecht, I

    1991-01-01

    Electron migration between and within proteins is one of the most prevalent forms of biological energy conversion processes. Electron transfer reactions take place between active centers such as transition metal ions or organic cofactors over considerable distances at fast rates and with remarkable...... specificity. The electron transfer is attained through weak electronic interaction between the active sites, so that considerable research efforts are centered on resolving the factors that control the rates of long-distance electron transfer reactions in proteins. These factors include (in addition......-containing proteins. These proteins serve almost exclusively in electron transfer reactions, and as it turns out, their metal coordination sites are endowed with properties uniquely optimized for their function....

  13. Markers of protein oxidation

    DEFF Research Database (Denmark)

    Headlam, Henrietta A; Davies, Michael Jonathan

    2004-01-01

    Exposure of proteins to radicals in the presence of O2 gives both side-chain oxidation and backbone fragmentation. These processes can be interrelated, with initial side-chain oxidation giving rise to backbone damage via transfer reactions. We have shown previously that alkoxyl radicals formed...... of this process depends on the extent of oxidation at C-3 compared with other sites. HO*, generated by gamma radiolysis, gave the highest total carbonyl yield, with protein-bound carbonyls predominating over released. In contrast, metal ion/H2O2 systems, gave more released than bound carbonyls, with this ratio...... modulated by EDTA. This is ascribed to metal ion-protein interactions affecting the sites of initial oxidation. Hypochlorous acid gave low concentrations of released carbonyls, but high yields of protein-bound material. The peroxyl radical generator 2,2'-azobis(2-amidinopropane) hydrochloride...

  14. Protein Colloidal Aggregation Project

    Science.gov (United States)

    Oliva-Buisson, Yvette J. (Compiler)

    2014-01-01

    To investigate the pathways and kinetics of protein aggregation to allow accurate predictive modeling of the process and evaluation of potential inhibitors to prevalent diseases including cataract formation, chronic traumatic encephalopathy, Alzheimer's Disease, Parkinson's Disease and others.

  15. Protein Polymers and Amyloids

    DEFF Research Database (Denmark)

    Risør, Michael Wulff

    2014-01-01

    Several human disorders are caused by a common general disease mechanism arising from abnormal folding and aggregation of the underlying protein. These include the prevalent dementias like Alzheimer’s and Parkinson’s, where accumulation of protein fibrillar structures, known as amyloid fibrils......, is a general hallmark. They also include the α1-antitrypsin deficiency, where disease-causing mutations in the serine protease inhibitor, α1-antitrypsin (α1AT), leads to accumulation of the aberrant protein in the liver of these patients. The native metastable structure of α1AT constitutes a molecular trap...... that inhibits its target protease through a large conformational change but mutations compromise this function and cause premature structural collapse into hyperstable polymers. Understanding the conformational disorders at a molecular level is not only important for our general knowledge on protein folding...

  16. Protein turnover in sheep

    International Nuclear Information System (INIS)

    Buttery, P.J.

    1981-01-01

    Considerable advances have been made in the knowledge of the mechanisms and control of synthesis and degradation of proteins in animal tissues during the last decade. Most of the work on the measurement of synthetic and degradative rates of the mixed protein fraction from tissues has been conducted in the rat. There have, unfortunately, been few publications describing results of protein turnover studies with ruminants. Consideration is given here to the techniques used to measure protein turnover, and some of the results obtained, particularly with sheep, are summarized. No attempt has been made to discuss directly the situation in parasitized animals; rather the aim is to provide background information which complements other work dealing with the effects of parasites on the nitrogen metabolism of ruminants. (author)

  17. MicroProteins

    DEFF Research Database (Denmark)

    Eguen, Teinai Ebimienere; Straub, Daniel; Graeff, Moritz

    2015-01-01

    MicroProteins (miPs) are short, usually single-domain proteins that, in analogy to miRNAs, heterodimerize with their targets and exert a dominant-negative effect. Recent bioinformatic attempts to identify miPs have resulted in a list of potential miPs, many of which lack the defining...... characteristics of a miP. In this opinion article, we clearly state the characteristics of a miP as evidenced by known proteins that fit the definition; we explain why modulatory proteins misrepresented as miPs do not qualify as true miPs. We also discuss the evolutionary history of miPs, and how the miP concept...

  18. Interactive protein manipulation

    Energy Technology Data Exchange (ETDEWEB)

    SNCrivelli@lbl.gov

    2003-07-01

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures.

  19. Interactive protein manipulation

    International Nuclear Information System (INIS)

    2003-01-01

    We describe an interactive visualization and modeling program for the creation of protein structures ''from scratch''. The input to our program is an amino acid sequence -decoded from a gene- and a sequence of predicted secondary structure types for each amino acid-provided by external structure prediction programs. Our program can be used in the set-up phase of a protein structure prediction process; the structures created with it serve as input for a subsequent global internal energy minimization, or another method of protein structure prediction. Our program supports basic visualization methods for protein structures, interactive manipulation based on inverse kinematics, and visualization guides to aid a user in creating ''good'' initial structures

  20. The protein protocols handbook

    National Research Council Canada - National Science Library

    Walker, John M

    2002-01-01

    .... The new chapters cover with many rapidly developing areas, particularly the application of mass spectrometry in protein characterization, as well as the now well-established 2-D PAGE technique in proteomics...

  1. Polymers for Protein Conjugation

    Directory of Open Access Journals (Sweden)

    Gianfranco Pasut

    2014-01-01

    Full Text Available Polyethylene glycol (PEG at the moment is considered the leading polymer for protein conjugation in view of its unique properties, as well as to its low toxicity in humans, qualities which have been confirmed by its extensive use in clinical practice. Other polymers that are safe, biodegradable and custom-designed have, nevertheless, also been investigated as potential candidates for protein conjugation. This review will focus on natural polymers and synthetic linear polymers that have been used for protein delivery and the results associated with their use. Genetic fusion approaches for the preparation of protein-polypeptide conjugates will be also reviewed and compared with the best known chemical conjugation ones.

  2. The effect of protein-protein and protein-membrane interactions on membrane fouling in ultrafiltration

    NARCIS (Netherlands)

    Huisman, I.H.; Prádanos, P.; Hernández, A.

    2000-01-01

    It was studied how protein-protein and protein-membrane interactions influence the filtration performance during the ultrafiltration of protein solutions over polymeric membranes. This was done by measuring flux, streaming potential, and protein transmission during filtration of bovine serum albumin

  3. Recombinant Collagenlike Proteins

    Science.gov (United States)

    Fertala, Andzej

    2007-01-01

    A group of collagenlike recombinant proteins containing high densities of biologically active sites has been invented. The method used to express these proteins is similar to a method of expressing recombinant procollagens and collagens described in U. S. Patent 5,593,859, "Synthesis of human procollagens and collagens in recombinant DNA systems." Customized collagenous proteins are needed for biomedical applications. In particular, fibrillar collagens are attractive for production of matrices needed for tissue engineering and drug delivery. Prior to this invention, there was no way of producing customized collagenous proteins for these and other applications. Heretofore, collagenous proteins have been produced by use of such biological systems as yeasts, bacteria, and transgenic animals and plants. These products are normal collagens that can also be extracted from such sources as tendons, bones, and hides. These products cannot be made to consist only of biologically active, specific amino acid sequences that may be needed for specific applications. Prior to this invention, it had been established that fibrillar collagens consist of domains that are responsible for such processes as interaction with cells, binding of growth factors, and interaction with a number of structural proteins present in the extracellular matrix. A normal collagen consists of a sequence of domains that can be represented by a corresponding sequence of labels, e.g., D1D2D3D4. A collagenlike protein of the present invention contains regions of collagen II that contain multiples of a single domain (e.g., D1D1D1D1 or D4D4D4D4) chosen for its specific biological activity. By virtue of the multiplicity of the chosen domain, the density of sites having that specific biological activity is greater than it is in a normal collagen. A collagenlike protein according to this invention can thus be made to have properties that are necessary for tissue engineering.

  4. Occupational protein contact dermatitis.

    Science.gov (United States)

    Barbaud, Annick; Poreaux, Claire; Penven, Emmanuelle; Waton, Julie

    2015-01-01

    Occupational contact dermatitis is generally caused by haptens but can also be induced by proteins causing mainly immunological contact urticaria (ICU); chronic hand eczema in the context of protein contact dermatitis (PCD). In a monocentric retrospective study, from our database, only 31 (0.41%) of patients with contact dermatitis had positive skin tests with proteins: 22 had occupational PCD, 3 had non-occupational PCD, 5 occupational ICU and 1 cook had a neutrophilic fixed food eruption (NFFE) due to fish. From these results and analysis of literature, the characteristics of PCD can be summarized as follows. It is a chronic eczematous dermatitis, possibly exacerbated by work, suggestive if associated with inflammatory perionyxix and immediate erythema with pruritis, to be investigated when the patient resumes work after a period of interruption. Prick tests with the suspected protein-containing material are essential, as patch tests have negative results. In case of multisensitisation revealed by prick tests, it is advisable to analyse IgE against recombinant allergens. A history of atopy, found in 56 to 68% of the patients, has to be checked for. Most of the cases are observed among food-handlers but PCD can also be due to non-edible plants, latex, hydrolysed proteins or animal proteins. Occupational exposure to proteins can thus lead to the development of ICU. Reflecting hypersensitivity to very low concentrations of allergens, investigating ICU therefore requires caution and prick tests should be performed with a diluted form of the causative protein-containing product. Causes are food, especially fruit peel, non-edible plants, cosmetic products, latex, animals.

  5. Proteins and their crystals

    Czech Academy of Sciences Publication Activity Database

    Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, Dalibor

    2003-01-01

    Roč. 10, č. 1 (2003), s. 31-32 ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:AV0Z5051902; CEZ:MSM 123100001 Keywords : pokeweed antiviral protein * flavodoxin-like protein * PSII Subject RIV: EB - Genetics ; Molecular Biology

  6. The tubby family proteins

    OpenAIRE

    Mukhopadhyay, Saikat; Jackson, Peter K

    2011-01-01

    The tubby mouse shows a tripartite syndrome characterized by maturity-onset obesity, blindness and deafness. The causative gene Tub is the founding member of a family of related proteins present throughout the animal and plant kingdoms, each characterized by a signature carboxy-terminal tubby domain. This domain consists of a β barrel enclosing a central α helix and binds selectively to specific membrane phosphoinositides. The vertebrate family of tubby-like proteins (TULPs) includes the foun...

  7. The caveolin proteins

    OpenAIRE

    Williams, Terence M; Lisanti, Michael P

    2004-01-01

    The caveolin gene family has three members in vertebrates: caveolin-1, caveolin-2, and caveolin-3. So far, most caveolin-related research has been conducted in mammals, but the proteins have also been found in other animals, including Xenopus laevis, Fugu rubripes, and Caenorhabditis elegans. Caveolins can serve as protein markers of caveolae ('little caves'), invaginations in the plasma membrane 50-100 nanometers in diameter. Caveolins are found predominantly at the plasma membrane but also ...

  8. More protein in cereals?

    International Nuclear Information System (INIS)

    1969-01-01

    Ways in which the protein content of plant crops may be raised by the use of nuclear radiation are to be discussed at a symposium in Vienna in June next year, organized by the joint Food and Agriculture Organization/Agency Division of Atomic Energy in Food and Agriculture. Plant crops - especially cereal grains - are the basic food and protein source of most of the world's population, particularly in less-developed countries. But their natural protein content is low; increasing the quantity and nutritional quality of plant protein is potentially the most feasible way to combat widespread protein malnutrition. This improvement in seed stock can be achieved by plant breeding methods in which nuclear irradiation techniques are used to induce mutations in grain, and other isotopic techniques can be used to select only those mutants which have the desired properties. The scientists who attend the symposium will have an opportunity to review what mutation plant breeders have achieved, the application of nuclear techniques to screening for protein and amino-acid content and nutritional value, and isotopic methods which contribute to research in plant nutrition and physiology. (author)

  9. Electrophoretic transfer protein zymography.

    Science.gov (United States)

    Pan, Daniel; Hill, Adam P; Kashou, Anthony; Wilson, Karl A; Tan-Wilson, Anna

    2011-04-15

    Zymography detects and characterizes proteolytic enzymes by electrophoresis of protease-containing samples into a nonreducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) gel containing a copolymerized protein substrate. The usefulness of zymography for molecular weight determination and proteomic analysis is hampered by the fact that some proteases exhibit slower migration through a gel that contains substrate protein. This article introduces electrophoretic transfer protein zymography as one solution to this problem. In this technique, samples containing proteolytic enzymes are first resolved in nonreducing SDS-PAGE on a gel without protein substrate. The proteins in the resolving gel are then electrophoretically transferred to a receiving gel previously prepared with a copolymerized protein substrate. The receiving gel is then developed as a zymogram to visualize clear or lightly stained bands in a dark background. Band intensities are linearly related to the amount of protease, extending the usefulness of the technique so long as conditions for transfer and development of the zymogram are kept constant. Conditions of transfer, such as the pore sizes of resolving and receiving gels and the transfer time relative to the molecular weight of the protease, are explored. Copyright © 2011 Elsevier Inc. All rights reserved.

  10. More protein in cereals?

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1969-07-01

    Ways in which the protein content of plant crops may be raised by the use of nuclear radiation are to be discussed at a symposium in Vienna in June next year, organized by the joint Food and Agriculture Organization/Agency Division of Atomic Energy in Food and Agriculture. Plant crops - especially cereal grains - are the basic food and protein source of most of the world's population, particularly in less-developed countries. But their natural protein content is low; increasing the quantity and nutritional quality of plant protein is potentially the most feasible way to combat widespread protein malnutrition. This improvement in seed stock can be achieved by plant breeding methods in which nuclear irradiation techniques are used to induce mutations in grain, and other isotopic techniques can be used to select only those mutants which have the desired properties. The scientists who attend the symposium will have an opportunity to review what mutation plant breeders have achieved, the application of nuclear techniques to screening for protein and amino-acid content and nutritional value, and isotopic methods which contribute to research in plant nutrition and physiology. (author)

  11. Disease specific protein corona

    Science.gov (United States)

    Rahman, M.; Mahmoudi, M.

    2015-03-01

    It is now well accepted that upon their entrance into the biological environments, the surface of nanomaterials would be covered by various biomacromolecules (e.g., proteins and lipids). The absorption of these biomolecules, so called `protein corona', onto the surface of (nano)biomaterials confers them a new `biological identity'. Although the formation of protein coronas on the surface of nanoparticles has been widely investigated, there are few reports on the effect of various diseases on the biological identity of nanoparticles. As the type of diseases may tremendously changes the composition of the protein source (e.g., human plasma/serum), one can expect that amount and composition of associated proteins in the corona composition may be varied, in disease type manner. Here, we show that corona coated silica and polystyrene nanoparticles (after interaction with in the plasma of the healthy individuals) could induce unfolding of fibrinogen, which promotes release of the inflammatory cytokines. However, no considerable releases of inflammatory cytokines were observed for corona coated graphene sheets. In contrast, the obtained corona coated silica and polystyrene nanoparticles from the hypofibrinogenemia patients could not induce inflammatory cytokine release where graphene sheets do. Therefore, one can expect that disease-specific protein coronas can provide a novel approach for applying nanomedicine to personalized medicine, improving diagnosis and treatment of different diseases tailored to the specific conditions and circumstances.

  12. Competitive protein binding assay

    International Nuclear Information System (INIS)

    Kaneko, Toshio; Oka, Hiroshi

    1975-01-01

    The measurement of cyclic GMP (cGMP) by competitive protein binding assay was described and discussed. The principle of binding assay was represented briefly. Procedures of our method by binding protein consisted of preparation of cGMP binding protein, selection of 3 H-cyclic GMP on market, and measurement procedures. In our method, binding protein was isolated from the chrysalis of silk worm. This method was discussed from the points of incubation medium, specificity of binding protein, the separation of bound cGMP from free cGMP, and treatment of tissue from which cGMP was extracted. cGMP existing in the tissue was only one tenth or one scores of cGMP, and in addition, cGMP competed with cGMP in binding with binding protein. Therefore, Murad's technique was applied to the isolation of cGMP. This method provided the measurement with sufficient accuracy; the contamination by cAMP was within several per cent. (Kanao, N.)

  13. Protein hydrolysates in sports nutrition

    Directory of Open Access Journals (Sweden)

    Manninen Anssi H

    2009-09-01

    Full Text Available Abstract It has been suggested that protein hydrolysates providing mainly di- and tripeptides are superior to intact (whole proteins and free amino acids in terms of skeletal muscle protein anabolism. This review provides a critical examination of protein hydrolysate studies conducted in healthy humans with special reference to sports nutrition. The effects of protein hydrolysate ingestion on blood amino acid levels, muscle protein anabolism, body composition, exercise performance and muscle glycogen resynthesis are discussed.

  14. Unique Features of Halophilic Proteins.

    Science.gov (United States)

    Arakawa, Tsutomu; Yamaguchi, Rui; Tokunaga, Hiroko; Tokunaga, Masao

    2017-01-01

    Proteins from moderate and extreme halophiles have unique characteristics. They are highly acidic and hydrophilic, similar to intrinsically disordered proteins. These characteristics make the halophilic proteins soluble in water and fold reversibly. In addition to reversible folding, the rate of refolding of halophilic proteins from denatured structure is generally slow, often taking several days, for example, for extremely halophilic proteins. This slow folding rate makes the halophilic proteins a novel model system for folding mechanism analysis. High solubility and reversible folding also make the halophilic proteins excellent fusion partners for soluble expression of recombinant proteins.

  15. Tumor cell surface proteins

    International Nuclear Information System (INIS)

    Kennel, S.J.; Braslawsky, G.R.; Flynn, K.; Foote, L.J.; Friedman, E.; Hotchkiss, J.A.; Huang, A.H.L.; Lankford, P.K.

    1982-01-01

    Cell surface proteins mediate interaction between cells and their environment. Unique tumor cell surface proteins are being identified and quantified in several tumor systems to address the following questions: (i) how do tumor-specific proteins arise during cell transformation; (ii) can these proteins be used as markers of tumor cell distribution in vivo; (iii) can cytotoxic drugs be targeted specifically to tumor cells using antibody; and (iv) can solid state radioimmunoassay of these proteins provide a means to quantify transformation frequencies. A tumor surface protein of 180,000 M/sub r/ (TSP-180) has been identified on cells of several lung carcinomas of BALB/c mice. TSP-180 was not detected on normal lung tissue, embryonic tissue, or other epithelial or sarcoma tumors, but it was found on lung carcinomas of other strains of mice. Considerable amino acid sequence homology exists among TSP-180's from several cell sources, indicating that TSP-180 synthesis is directed by normal cellular genes although it is not expressed in normal cells. The regulation of synthesis of TSP-180 and its relationship to normal cell surface proteins are being studied. Monoclonal antibodies (MoAb) to TSP-180 have been developed. The antibodies have been used in immunoaffinity chromatography to isolate TSP-180 from tumor cell sources. This purified tumor antigen was used to immunize rats. Antibody produced by these animals reacted at different sites (epitopes) on the TSP-180 molecule than did the original MoAb. These sera and MoAb from these animals are being used to identify normal cell components related to the TSP-180 molecule

  16. Bioinformatics and moonlighting proteins

    Directory of Open Access Journals (Sweden)

    Sergio eHernández

    2015-06-01

    Full Text Available Multitasking or moonlighting is the capability of some proteins to execute two or more biochemical functions. Usually, moonlighting proteins are experimentally revealed by serendipity. For this reason, it would be helpful that Bioinformatics could predict this multifunctionality, especially because of the large amounts of sequences from genome projects. In the present work, we analyse and describe several approaches that use sequences, structures, interactomics and current bioinformatics algorithms and programs to try to overcome this problem. Among these approaches are: a remote homology searches using Psi-Blast, b detection of functional motifs and domains, c analysis of data from protein-protein interaction databases (PPIs, d match the query protein sequence to 3D databases (i.e., algorithms as PISITE, e mutation correlation analysis between amino acids by algorithms as MISTIC. Programs designed to identify functional motif/domains detect mainly the canonical function but usually fail in the detection of the moonlighting one, Pfam and ProDom being the best methods. Remote homology search by Psi-Blast combined with data from interactomics databases (PPIs have the best performance. Structural information and mutation correlation analysis can help us to map the functional sites. Mutation correlation analysis can only be used in very specific situations –it requires the existence of multialigned family protein sequences - but can suggest how the evolutionary process of second function acquisition took place. The multitasking protein database MultitaskProtDB (http://wallace.uab.es/multitask/, previously published by our group, has been used as a benchmark for the all of the analyses.

  17. Modeling Mercury in Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Jeremy C [ORNL; Parks, Jerry M [ORNL

    2016-01-01

    Mercury (Hg) is a naturally occurring element that is released into the biosphere both by natural processes and anthropogenic activities. Although its reduced, elemental form Hg(0) is relatively non-toxic, other forms such as Hg2+ and, in particular, its methylated form, methylmercury, are toxic, with deleterious effects on both ecosystems and humans. Microorganisms play important roles in the transformation of mercury in the environment. Inorganic Hg2+ can be methylated by certain bacteria and archaea to form methylmercury. Conversely, bacteria also demethylate methylmercury and reduce Hg2+ to relatively inert Hg(0). Transformations and toxicity occur as a result of mercury interacting with various proteins. Clearly, then, understanding the toxic effects of mercury and its cycling in the environment requires characterization of these interactions. Computational approaches are ideally suited to studies of mercury in proteins because they can provide a detailed picture and circumvent issues associated with toxicity. Here we describe computational methods for investigating and characterizing how mercury binds to proteins, how inter- and intra-protein transfer of mercury is orchestrated in biological systems, and how chemical reactions in proteins transform the metal. We describe quantum chemical analyses of aqueous Hg(II), which reveal critical factors that determine ligand binding propensities. We then provide a perspective on how we used chemical reasoning to discover how microorganisms methylate mercury. We also highlight our combined computational and experimental studies of the proteins and enzymes of the mer operon, a suite of genes that confers mercury resistance in many bacteria. Lastly, we place work on mercury in proteins in the context of what is needed for a comprehensive multi-scale model of environmental mercury cycling.

  18. Protein (Cyanobacteria): 654346314 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available protein Mastigocoleus testarum MLEQIELKPNWERNQVAFLDFIVNGTSLHDQFDHPQVRDLCTVFTSDQYEFDGKSSAAIHASWFLGYGETPFPDDRIPVYICSSGDFDCGTVTAYLTVNDGTIKWSEFRIERLTEELQDQPIELTSVKQCVFERNAYEKLFQPFLRKVID

  19. Protein Correlation Profiles Identify Lipid Droplet Proteins with High Confidence*

    Science.gov (United States)

    Krahmer, Natalie; Hilger, Maximiliane; Kory, Nora; Wilfling, Florian; Stoehr, Gabriele; Mann, Matthias; Farese, Robert V.; Walther, Tobias C.

    2013-01-01

    Lipid droplets (LDs) are important organelles in energy metabolism and lipid storage. Their cores are composed of neutral lipids that form a hydrophobic phase and are surrounded by a phospholipid monolayer that harbors specific proteins. Most well-established LD proteins perform important functions, particularly in cellular lipid metabolism. Morphological studies show LDs in close proximity to and interacting with membrane-bound cellular organelles, including the endoplasmic reticulum, mitochondria, peroxisomes, and endosomes. Because of these close associations, it is difficult to purify LDs to homogeneity. Consequently, the confident identification of bona fide LD proteins via proteomics has been challenging. Here, we report a methodology for LD protein identification based on mass spectrometry and protein correlation profiles. Using LD purification and quantitative, high-resolution mass spectrometry, we identified LD proteins by correlating their purification profiles to those of known LD proteins. Application of the protein correlation profile strategy to LDs isolated from Drosophila S2 cells led to the identification of 111 LD proteins in a cellular LD fraction in which 1481 proteins were detected. LD localization was confirmed in a subset of identified proteins via microscopy of the expressed proteins, thereby validating the approach. Among the identified LD proteins were both well-characterized LD proteins and proteins not previously known to be localized to LDs. Our method provides a high-confidence LD proteome of Drosophila cells and a novel approach that can be applied to identify LD proteins of other cell types and tissues. PMID:23319140

  20. Integral UBL domain proteins: a family of proteasome interacting proteins

    DEFF Research Database (Denmark)

    Hartmann-Petersen, Rasmus; Gordon, Colin

    2004-01-01

    The family of ubiquitin-like (UBL) domain proteins (UDPs) comprises a conserved group of proteins involved in a multitude of different cellular activities. However, recent studies on UBL-domain proteins indicate that these proteins appear to share a common property in their ability to interact...

  1. Measuring protein breakdown rate in individual proteins in vivo

    DEFF Research Database (Denmark)

    Holm, Lars; Kjaer, Michael

    2010-01-01

    To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo.......To outline different approaches of how protein breakdown can be quantified and to present a new approach to determine the fractional breakdown rate of individual slow turnover proteins in vivo....

  2. Changes in protein composition and protein phosphorylation during ...

    African Journals Online (AJOL)

    Changes in protein profiles and protein phosphorylation were studied in various stages of germinating somatic and zygotic embryos. Many proteins, which were expressed in cotyledonary stage somatic embryos, were also present in the zygotic embryos obtained from mature dry seed. The intensity of 22 kDa protein was ...

  3. A Stevedore's protein knot.

    Directory of Open Access Journals (Sweden)

    Daniel Bölinger

    2010-04-01

    Full Text Available Protein knots, mostly regarded as intriguing oddities, are gradually being recognized as significant structural motifs. Seven distinctly knotted folds have already been identified. It is by and large unclear how these exceptional structures actually fold, and only recently, experiments and simulations have begun to shed some light on this issue. In checking the new protein structures submitted to the Protein Data Bank, we encountered the most complex and the smallest knots to date: A recently uncovered alpha-haloacid dehalogenase structure contains a knot with six crossings, a so-called Stevedore knot, in a projection onto a plane. The smallest protein knot is present in an as yet unclassified protein fragment that consists of only 92 amino acids. The topological complexity of the Stevedore knot presents a puzzle as to how it could possibly fold. To unravel this enigma, we performed folding simulations with a structure-based coarse-grained model and uncovered a possible mechanism by which the knot forms in a single loop flip.

  4. Protein Annotation from Protein Interaction Networks and Gene Ontology

    OpenAIRE

    Nguyen, Cao D.; Gardiner, Katheleen J.; Cios, Krzysztof J.

    2011-01-01

    We introduce a novel method for annotating protein function that combines Naïve Bayes and association rules, and takes advantage of the underlying topology in protein interaction networks and the structure of graphs in the Gene Ontology. We apply our method to proteins from the Human Protein Reference Database (HPRD) and show that, in comparison with other approaches, it predicts protein functions with significantly higher recall with no loss of precision. Specifically, it achieves 51% precis...

  5. Polarizable protein packing

    KAUST Repository

    Ng, Albert H.

    2011-01-24

    To incorporate protein polarization effects within a protein combinatorial optimization framework, we decompose the polarizable force field AMOEBA into low order terms. Including terms up to the third-order provides a fair approximation to the full energy while maintaining tractability. We represent the polarizable packing problem for protein G as a hypergraph and solve for optimal rotamers with the FASTER combinatorial optimization algorithm. These approximate energy models can be improved to high accuracy [root mean square deviation (rmsd) < 1 kJ mol -1] via ridge regression. The resulting trained approximations are used to efficiently identify new, low-energy solutions. The approach is general and should allow combinatorial optimization of other many-body problems. © 2011 Wiley Periodicals, Inc. J Comput Chem, 2011 Copyright © 2011 Wiley Periodicals, Inc.

  6. Sound of proteins

    DEFF Research Database (Denmark)

    2007-01-01

    In my group we work with Molecular Dynamics to model several different proteins and protein systems. We submit our modelled molecules to changes in temperature, changes in solvent composition and even external pulling forces. To analyze our simulation results we have so far used visual inspection...... and statistical analysis of the resulting molecular trajectories (as everybody else!). However, recently I started assigning a particular sound frequency to each amino acid in the protein, and by setting the amplitude of each frequency according to the movement amplitude we can "hear" whenever two aminoacids...... example of soundfile was obtained from using Steered Molecular Dynamics for stretching the neck region of the scallop myosin molecule (in rigor, PDB-id: 1SR6), in such a way as to cause a rotation of the myosin head. Myosin is the molecule responsible for producing the force during muscle contraction...

  7. Can infrared spectroscopy provide information on protein-protein interactions?

    Science.gov (United States)

    Haris, Parvez I

    2010-08-01

    For most biophysical techniques, characterization of protein-protein interactions is challenging; this is especially true with methods that rely on a physical phenomenon that is common to both of the interacting proteins. Thus, for example, in IR spectroscopy, the carbonyl vibration (1600-1700 cm(-1)) associated with the amide bonds from both of the interacting proteins will overlap extensively, making the interpretation of spectral changes very complicated. Isotope-edited infrared spectroscopy, where one of the interacting proteins is uniformly labelled with (13)C or (13)C,(15)N has been introduced as a solution to this problem, enabling the study of protein-protein interactions using IR spectroscopy. The large shift of the amide I band (approx. 45 cm(-1) towards lower frequency) upon (13)C labelling of one of the proteins reveals the amide I band of the unlabelled protein, enabling it to be used as a probe for monitoring conformational changes. With site-specific isotopic labelling, structural resolution at the level of individual amino acid residues can be achieved. Furthermore, the ability to record IR spectra of proteins in diverse environments means that isotope-edited IR spectroscopy can be used to structurally characterize difficult systems such as protein-protein complexes bound to membranes or large insoluble peptide/protein aggregates. In the present article, examples of application of isotope-edited IR spectroscopy for studying protein-protein interactions are provided.

  8. Ubiquitin domain proteins in disease

    DEFF Research Database (Denmark)

    Klausen, Louise Kjær; Schulze, Andrea; Seeger, Michael

    2007-01-01

    The human genome encodes several ubiquitin-like (UBL) domain proteins (UDPs). Members of this protein family are involved in a variety of cellular functions and many are connected to the ubiquitin proteasome system, an essential pathway for protein degradation in eukaryotic cells. Despite...... and cancer. Publication history: Republished from Current BioData's Targeted Proteins database (TPdb; http://www.targetedproteinsdb.com)....

  9. Protein: FBA7 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FBA7 claudin-zona occluden Tjp1 Zo1 Tight junction protein ZO-1 Tight junction protein 1, Zona occludens pr...otein 1, Zonula occludens protein 1 10090 Mus musculus 21872 P39447 2RRM P39447 21431884 ...

  10. Protein: FEA3 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available FEA3 AREB pathway: Signaling proteins At4g11890/T26M18_100 At4g11890, Protein kinase family pr...otein, Putative uncharacterized protein At4g11890/T26M18_100 3702 Arabidopsis thaliana 826796 Q8GY82 22225700 ...

  11. Cold gelation of globular proteins

    NARCIS (Netherlands)

    Alting, A.C.

    2003-01-01

    Keywords : globular proteins, whey protein, ovalbumin, cold gelation, disulfide bonds, texture, gel hardnessProtein gelation in food products is important to obtain desirable sensory and textural properties. Cold gelation is a novel method to produce protein-based gels. It is a two step process in

  12. Vibrational spectroscopy of proteins

    International Nuclear Information System (INIS)

    Schwaighofer, A.

    2013-01-01

    Two important steps for the development of a biosensor are the immobilization of the biological component (e.g. protein) on a surface and the enhancement of the signal to improve the sensitivity of detection. To address these subjects, the present work describes Fourier transform infrared (FTIR) investigations of several proteins bound to the surface of an attenuated total reflection (ATR) crystal. Furthermore, new nanostructured surfaces for signal enhancement were developed for use in FTIR microscopy. The mitochondrial redox-protein cytochrome c oxidase (CcO) was incorporated into a protein-tethered bilayer lipid membrane (ptBLM) on an ATR crystal featuring a roughened two-layer gold surface for signal enhancement. Electrochemical excitation by periodic potential pulses at different modulation frequencies was followed by time-resolved FTIR spectroscopy. Phase sensitive detection was used for deconvolution of the IR spectra into vibrational components. A model based on protonation-dependent chemical reaction kinetics could be fitted to the time evolution of IR bands attributed to several different redox centers of the CcO. Further investigations involved the odorant binding protein 14 (OBP14) of the honey bee (Apis mellifera), which was studied using ATR-FTIR spectroscopy and circular dichroism. OBP14 was found to be thermally stable up to 45 °C, thus permitting the potential application of this protein for the fabrication of biosensors. Thermal denaturation measurements showed that odorant binding increases the thermal stability of the OBP-odorant complex. In another project, plasmonic nanostructures were fabricated that enhance the absorbance in FTIR microscopy measurements. The nanostructures are composed of an array of round-shaped insulator and gold discs on top of a continuous gold layer. Enhancement factors of up to ⁓125 could be observed with self-assembled monolayers of dodecanethiol molecules immobilized on the gold surface (author) [de

  13. Urinary Protein Biomarker Analysis

    Science.gov (United States)

    2017-10-01

    silica emitter via a Valco stainless steel union. Four μL of individual peptide fractions (total volume 20 μL) following PRISM were injected for LC...secreted cement gland protein XAG-2 homolog, AGR2 belongs to the protein disulfide 5 isomerase (PDI) family. The strongest AGR2 expression has...µm C18 column (75 µm i.d. × 10 cm), which was connected to a chemically etched 20 µm i.d. fused-silica emitter via a Valco stainless steel union

  14. Protein energy malnutrition.

    Science.gov (United States)

    Grover, Zubin; Ee, Looi C

    2009-10-01

    Protein energy malnutrition (PEM) is a common problem worldwide and occurs in both developing and industrialized nations. In the developing world, it is frequently a result of socioeconomic, political, or environmental factors. In contrast, protein energy malnutrition in the developed world usually occurs in the context of chronic disease. There remains much variation in the criteria used to define malnutrition, with each method having its own limitations. Early recognition, prompt management, and robust follow up are critical for best outcomes in preventing and treating PEM.

  15. Heme Sensor Proteins*

    Science.gov (United States)

    Girvan, Hazel M.; Munro, Andrew W.

    2013-01-01

    Heme is a prosthetic group best known for roles in oxygen transport, oxidative catalysis, and respiratory electron transport. Recent years have seen the roles of heme extended to sensors of gases such as O2 and NO and cell redox state, and as mediators of cellular responses to changes in intracellular levels of these gases. The importance of heme is further evident from identification of proteins that bind heme reversibly, using it as a signal, e.g. to regulate gene expression in circadian rhythm pathways and control heme synthesis itself. In this minireview, we explore the current knowledge of the diverse roles of heme sensor proteins. PMID:23539616

  16. Protein-protein interactions: an application of Tus-Ter mediated protein microarray system.

    Science.gov (United States)

    Sitaraman, Kalavathy; Chatterjee, Deb K

    2011-01-01

    In this chapter, we present a novel, cost-effective microarray strategy that utilizes expression-ready plasmid DNAs to generate protein arrays on-demand and its use to validate protein-protein interactions. These expression plasmids were constructed in such a way so as to serve a dual purpose of synthesizing the protein of interest as well as capturing the synthesized protein. The microarray system is based on the high affinity binding of Escherichia coli "Tus" protein to "Ter," a 20 bp DNA sequence involved in the regulation of DNA replication. The protein expression is carried out in a cell-free protein synthesis system, with rabbit reticulocyte lysates, and the target proteins are detected either by labeled incorporated tag specific or by gene-specific antibodies. This microarray system has been successfully used for the detection of protein-protein interaction because both the target protein and the query protein can be transcribed and translated simultaneously in the microarray slides. The utility of this system for detecting protein-protein interaction is demonstrated by a few well-known examples: Jun/Fos, FRB/FKBP12, p53/MDM2, and CDK4/p16. In all these cases, the presence of protein complexes resulted in the localization of fluorophores at the specific sites of the immobilized target plasmids. Interestingly, during our interactions studies we also detected a previously unknown interaction between CDK2 and p16. Thus, this Tus-Ter based system of protein microarray can be used for the validation of known protein interactions as well as for identifying new protein-protein interactions. In addition, it can be used to examine and identify targets of nucleic acid-protein, ligand-receptor, enzyme-substrate, and drug-protein interactions.

  17. Truly Absorbed Microbial Protein Synthesis, Rumen Bypass Protein, Endogenous Protein, and Total Metabolizable Protein from Starchy and Protein-Rich Raw Materials

    NARCIS (Netherlands)

    Parand, Ehsan; Vakili, Alireza; Mesgaran, Mohsen Danesh; Duinkerken, Van Gert; Yu, Peiqiang

    2015-01-01

    This study was carried out to measure truly absorbed microbial protein synthesis, rumen bypass protein, and endogenous protein loss, as well as total metabolizable protein, from starchy and protein-rich raw feed materials with model comparisons. Predictions by the DVE2010 system as a more

  18. Interaction between plate make and protein in protein crystallisation screening.

    Directory of Open Access Journals (Sweden)

    Gordon J King

    Full Text Available BACKGROUND: Protein crystallisation screening involves the parallel testing of large numbers of candidate conditions with the aim of identifying conditions suitable as a starting point for the production of diffraction quality crystals. Generally, condition screening is performed in 96-well plates. While previous studies have examined the effects of protein construct, protein purity, or crystallisation condition ingredients on protein crystallisation, few have examined the effect of the crystallisation plate. METHODOLOGY/PRINCIPAL FINDINGS: We performed a statistically rigorous examination of protein crystallisation, and evaluated interactions between crystallisation success and plate row/column, different plates of same make, different plate makes and different proteins. From our analysis of protein crystallisation, we found a significant interaction between plate make and the specific protein being crystallised. CONCLUSIONS/SIGNIFICANCE: Protein crystal structure determination is the principal method for determining protein structure but is limited by the need to produce crystals of the protein under study. Many important proteins are difficult to crystallize, so that identification of factors that assist crystallisation could open up the structure determination of these more challenging targets. Our findings suggest that protein crystallisation success may be improved by matching a protein with its optimal plate make.

  19. HIV protein sequence hotspots for crosstalk with host hub proteins.

    Directory of Open Access Journals (Sweden)

    Mahdi Sarmady

    Full Text Available HIV proteins target host hub proteins for transient binding interactions. The presence of viral proteins in the infected cell results in out-competition of host proteins in their interaction with hub proteins, drastically affecting cell physiology. Functional genomics and interactome datasets can be used to quantify the sequence hotspots on the HIV proteome mediating interactions with host hub proteins. In this study, we used the HIV and human interactome databases to identify HIV targeted host hub proteins and their host binding partners (H2. We developed a high throughput computational procedure utilizing motif discovery algorithms on sets of protein sequences, including sequences of HIV and H2 proteins. We identified as HIV sequence hotspots those linear motifs that are highly conserved on HIV sequences and at the same time have a statistically enriched presence on the sequences of H2 proteins. The HIV protein motifs discovered in this study are expressed by subsets of H2 host proteins potentially outcompeted by HIV proteins. A large subset of these motifs is involved in cleavage, nuclear localization, phosphorylation, and transcription factor binding events. Many such motifs are clustered on an HIV sequence in the form of hotspots. The sequential positions of these hotspots are consistent with the curated literature on phenotype altering residue mutations, as well as with existing binding site data. The hotspot map produced in this study is the first global portrayal of HIV motifs involved in altering the host protein network at highly connected hub nodes.

  20. Protein Molecular Structures, Protein SubFractions, and Protein Availability Affected by Heat Processing: A Review

    International Nuclear Information System (INIS)

    Yu, P.

    2007-01-01

    The utilization and availability of protein depended on the types of protein and their specific susceptibility to enzymatic hydrolysis (inhibitory activities) in the gastrointestine and was highly associated with protein molecular structures. Studying internal protein structure and protein subfraction profiles leaded to an understanding of the components that make up a whole protein. An understanding of the molecular structure of the whole protein was often vital to understanding its digestive behavior and nutritive value in animals. In this review, recently obtained information on protein molecular structural effects of heat processing was reviewed, in relation to protein characteristics affecting digestive behavior and nutrient utilization and availability. The emphasis of this review was on (1) using the newly advanced synchrotron technology (S-FTIR) as a novel approach to reveal protein molecular chemistry affected by heat processing within intact plant tissues; (2) revealing the effects of heat processing on the profile changes of protein subfractions associated with digestive behaviors and kinetics manipulated by heat processing; (3) prediction of the changes of protein availability and supply after heat processing, using the advanced DVE/OEB and NRC-2001 models, and (4) obtaining information on optimal processing conditions of protein as intestinal protein source to achieve target values for potential high net absorbable protein in the small intestine. The information described in this article may give better insight in the mechanisms involved and the intrinsic protein molecular structural changes occurring upon processing.

  1. 24-hour urine protein

    Science.gov (United States)

    ... your provider may be able to order a test that is done on just one urine sample (protein-to-creatinine ratio). Normal Results The normal ... Some labs use different measurements or test different samples. Talk to your provider about the meaning of your specific test ... Abnormal results may be due to: A group ...

  2. Disorder in Protein Crystals.

    Science.gov (United States)

    Clarage, James Braun, II

    1990-01-01

    Methods have been developed for analyzing the diffuse x-ray scattering in the halos about a crystal's Bragg reflections as a means of determining correlations in atomic displacements in protein crystals. The diffuse intensity distribution for rhombohedral insulin, tetragonal lysozyme, and triclinic lysozyme crystals was best simulated in terms of exponential displacement correlation functions. About 90% of the disorder can be accounted for by internal movements correlated with a decay distance of about 6A; the remaining 10% corresponds to intermolecular movements that decay in a distance the order of size of the protein molecule. The results demonstrate that protein crystals fit into neither the Einstein nor the Debye paradigms for thermally fluctuating crystalline solids. Unlike the Einstein model, there are correlations in the atomic displacements, but these correlations decay more steeply with distance than predicted by the Debye-Waller model for an elastic solid. The observed displacement correlations are liquid -like in the sense that they decay exponentially with the distance between atoms, just as positional correlations in a liquid. This liquid-like disorder is similar to the disorder observed in 2-D crystals of polystyrene latex spheres, and similar systems where repulsive interactions dominate; hence, these colloidal crystals appear to provide a better analogy for the dynamics of protein crystals than perfectly elastic lattices.

  3. Optimization of fluorescent proteins

    NARCIS (Netherlands)

    Bindels, D.S.; Goedhart, J.; Hink, M.A.; van Weeren, L.; Joosen, L.; Gadella (jr.), T.W.J.; Engelborghs, Y.; Visser, A.J.W.G.

    2014-01-01

    Nowadays, fluorescent protein (FP) variants have been engineered to fluoresce in all different colors; to display photoswitchable, or photochromic, behavior; or to show yet other beneficial properties that enable or enhance a still growing set of new fluorescence spectroscopy and microcopy

  4. Cellulose binding domain proteins

    Science.gov (United States)

    Shoseyov, Oded; Shpiegl, Itai; Goldstein, Marc; Doi, Roy

    1998-01-01

    A cellulose binding domain (CBD) having a high affinity for crystalline cellulose and chitin is disclosed, along with methods for the molecular cloning and recombinant production thereof. Fusion products comprising the CBD and a second protein are likewise described. A wide range of applications are contemplated for both the CBD and the fusion products, including drug delivery, affinity separations, and diagnostic techniques.

  5. Tuber storage proteins.

    Science.gov (United States)

    Shewry, Peter R

    2003-06-01

    A wide range of plants are grown for their edible tubers, but five species together account for almost 90 % of the total world production. These are potato (Solanum tuberosum), cassava (Manihot esculenta), sweet potato (Ipomoea batatus), yams (Dioscorea spp.) and taro (Colocasia, Cyrtosperma and Xanthosoma spp.). All of these, except cassava, contain groups of storage proteins, but these differ in the biological properties and evolutionary relationships. Thus, patatin from potato exhibits activity as an acylhydrolase and esterase, sporamin from sweet potato is an inhibitor of trypsin, and dioscorin from yam is a carbonic anhydrase. Both sporamin and dioscorin also exhibit antioxidant and radical scavenging activity. Taro differs from the other three crops in that it contains two major types of storage protein: a trypsin inhibitor related to sporamin and a mannose-binding lectin. These characteristics indicate that tuber storage proteins have evolved independently in different species, which contrasts with the highly conserved families of storage proteins present in seeds. Furthermore, all exhibit biological activities which could contribute to resistance to pests, pathogens or abiotic stresses, indicating that they may have dual roles in the tubers.

  6. Mobility of photosynthetic proteins

    Czech Academy of Sciences Publication Activity Database

    Kaňa, Radek

    2013-01-01

    Roč. 116, 2-3 (2013), s. 465-479 ISSN 0166-8595 R&D Projects: GA ČR GAP501/12/0304; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Photosynthesis * Protein mobility * FRAP Subject RIV: EE - Microbiology, Virology Impact factor : 3.185, year: 2013

  7. Proteins and their crystals

    Czech Academy of Sciences Publication Activity Database

    Kutá-Smatanová, Ivana; Hogg, T.; Hilgenfeld, R.; Grandori, R.; Carey, J.; Vácha, František; Štys, D.

    2003-01-01

    Roč. 10, - (2003), s. 30-31 ISSN 1211-5894 R&D Projects: GA MŠk LN00A141; GA ČR GA206/00/D007 Institutional research plan: CEZ:MSM 123100001 Keywords : antiviral proteins Subject RIV: CD - Macromolecular Chemistry

  8. Antifreeze Proteins of Bacteria

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 12. Antifreeze Proteins of Bacteria. M K Chattopadhyay. General Article Volume 12 Issue 12 December 2007 pp 25-30. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/12/0025-0030 ...

  9. Radioimmunoassay of protein hormones

    International Nuclear Information System (INIS)

    Talas, M.; Fingerova, H.

    1976-01-01

    A survey is presented of the history of RIA methods for FSH, LH, HCG, HPL and prolactin determinations with special regard to the double antibody method in a kinetic system. Problems are shown in 125 I-labelling protein hormones in preparing own antisera. (L.O.)

  10. Allosteric Regulation of Proteins

    Indian Academy of Sciences (India)

    ... Lecture Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 1. Allosteric Regulation of Proteins: A Historical Perspective on the Development of Concepts and Techniques. General Article Volume 22 Issue 1 January 2017 pp 37-50 ...

  11. High quality protein microarray using in situ protein purification

    Directory of Open Access Journals (Sweden)

    Fleischmann Robert D

    2009-08-01

    Full Text Available Abstract Background In the postgenomic era, high throughput protein expression and protein microarray technologies have progressed markedly permitting screening of therapeutic reagents and discovery of novel protein functions. Hexa-histidine is one of the most commonly used fusion tags for protein expression due to its small size and convenient purification via immobilized metal ion affinity chromatography (IMAC. This purification process has been adapted to the protein microarray format, but the quality of in situ His-tagged protein purification on slides has not been systematically evaluated. We established methods to determine the level of purification of such proteins on metal chelate-modified slide surfaces. Optimized in situ purification of His-tagged recombinant proteins has the potential to become the new gold standard for cost-effective generation of high-quality and high-density protein microarrays. Results Two slide surfaces were examined, chelated Cu2+ slides suspended on a polyethylene glycol (PEG coating and chelated Ni2+ slides immobilized on a support without PEG coating. Using PEG-coated chelated Cu2+ slides, consistently higher purities of recombinant proteins were measured. An optimized wash buffer (PBST composed of 10 mM phosphate buffer, 2.7 mM KCl, 140 mM NaCl and 0.05% Tween 20, pH 7.4, further improved protein purity levels. Using Escherichia coli cell lysates expressing 90 recombinant Streptococcus pneumoniae proteins, 73 proteins were successfully immobilized, and 66 proteins were in situ purified with greater than 90% purity. We identified several antigens among the in situ-purified proteins via assays with anti-S. pneumoniae rabbit antibodies and a human patient antiserum, as a demonstration project of large scale microarray-based immunoproteomics profiling. The methodology is compatible with higher throughput formats of in vivo protein expression, eliminates the need for resin-based purification and circumvents

  12. Dairy Proteins and Energy Balance

    DEFF Research Database (Denmark)

    Bendtsen, Line Quist

    High protein diets affect energy balance beneficially through decreased hunger, enhanced satiety and increased energy expenditure. Dairy products are a major source of protein. Dairy proteins are comprised of two classes, casein (80%) and whey proteins (20%), which are both of high quality......, but casein is absorbed slowly and whey is absorbed rapidly. The present PhD study investigated the effects of total dairy proteins, whey, and casein, on energy balance and the mechanisms behind any differences in the effects of the specific proteins. The results do not support the hypothesis that dairy...... proteins, whey or casein are more beneficial than other protein sources in the regulation of energy balance, and suggest that dairy proteins, whey or casein seem to play only a minor role, if any, in the prevention and treatment of obesity....

  13. Phosphorylation of human link proteins

    International Nuclear Information System (INIS)

    Oester, D.A.; Caterson, B.; Schwartz, E.R.

    1986-01-01

    Three link proteins of 48, 44 and 40 kDa were purified from human articular cartilage and identified with monoclonal anti-link protein antibody 8-A-4. Two sets of lower molecular weight proteins of 30-31 kDa and 24-26 kDa also contained link protein epitopes recognized by the monoclonal antibody and were most likely degradative products of the intact link proteins. The link proteins of 48 and 40 kDa were identified as phosphoproteins while the 44 kDa link protein did not contain 32 P. The phosphorylated 48 and 40 kDa link proteins contained approximately 2 moles PO 4 /mole link protein

  14. Coevolution study of mitochondria respiratory chain proteins: toward the understanding of protein--protein interaction.

    Science.gov (United States)

    Yang, Ming; Ge, Yan; Wu, Jiayan; Xiao, Jingfa; Yu, Jun

    2011-05-20

    Coevolution can be seen as the interdependency between evolutionary histories. In the context of protein evolution, functional correlation proteins are ever-present coordinated evolutionary characters without disruption of organismal integrity. As to complex system, there are two forms of protein--protein interactions in vivo, which refer to inter-complex interaction and intra-complex interaction. In this paper, we studied the difference of coevolution characters between inter-complex interaction and intra-complex interaction using "Mirror tree" method on the respiratory chain (RC) proteins. We divided the correlation coefficients of every pairwise RC proteins into two groups corresponding to the binary protein--protein interaction in intra-complex and the binary protein--protein interaction in inter-complex, respectively. A dramatical discrepancy is detected between the coevolution characters of the two sets of protein interactions (Wilcoxon test, p-value = 4.4 × 10(-6)). Our finding reveals some critical information on coevolutionary study and assists the mechanical investigation of protein--protein interaction. Furthermore, the results also provide some unique clue for supramolecular organization of protein complexes in the mitochondrial inner membrane. More detailed binding sites map and genome information of nuclear encoded RC proteins will be extraordinary valuable for the further mitochondria dynamics study. Copyright © 2011. Published by Elsevier Ltd.

  15. Fluorogen-activating proteins: beyond classical fluorescent proteins

    Directory of Open Access Journals (Sweden)

    Shengnan Xu

    2018-05-01

    Full Text Available Fluorescence imaging is a powerful technique for the real-time noninvasive monitoring of protein dynamics. Recently, fluorogen activating proteins (FAPs/fluorogen probes for protein imaging were developed. Unlike the traditional fluorescent proteins (FPs, FAPs do not fluoresce unless bound to their specific small-molecule fluorogens. When using FAPs/fluorogen probes, a washing step is not required for the removal of free probes from the cells, thus allowing rapid and specific detection of proteins in living cells with high signal-to-noise ratio. Furthermore, with different fluorogens, living cell multi-color proteins labeling system was developed. In this review, we describe about the discovery of FAPs, the design strategy of FAP fluorogens, the application of the FAP technology and the advances of FAP technology in protein labeling systems. KEY WORDS: Fluorogen activating proteins, Fluorogens, Genetically encoded sensors, Fluorescence imaging, Molecular imaging

  16. Utilization of soya protein as an alternative protein source in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-05

    Jan 5, 2009 ... For carcass trait, ash, crude fat, and energy varied significantly with soya protein ... high-protein content, relatively well-balanced amino acid profile ..... and organoleptic quality of flesh of brook char (Salvelinus fontinalis).

  17. Analysis of protein folds using protein contact networks

    Indian Academy of Sciences (India)

    is a well-recognized classification system of proteins, which is based on manual in- ... can easily correspond to the information in the 2D matrix. ..... [7] U K Muppirala and Zhijun Li, Protein Engineering, Design & Selection 19, 265 (2006).

  18. Competitive Protein Adsorption - Multilayer Adsorption and Surface Induced Protein Aggregation

    DEFF Research Database (Denmark)

    Holmberg, Maria; Hou, Xiaolin

    2009-01-01

    In this study, competitive adsorption of albumin and IgG (immunoglobulin G) from human serum solutions and protein mixtures onto polymer surfaces is studied by means of radioactive labeling. By using two different radiolabels (125I and 131I), albumin and IgG adsorption to polymer surfaces...... is monitored simultaneously and the influence from the presence of other human serum proteins on albumin and IgG adsorption, as well as their mutual influence during adsorption processes, is investigated. Exploring protein adsorption by combining analysis of competitive adsorption from complex solutions...... of high concentration with investigation of single protein adsorption and interdependent adsorption between two specific proteins enables us to map protein adsorption sequences during competitive protein adsorption. Our study shows that proteins can adsorb in a multilayer fashion onto the polymer surfaces...

  19. A Mesoscopic Model for Protein-Protein Interactions in Solution

    OpenAIRE

    Lund, Mikael; Jönsson, Bo

    2003-01-01

    Protein self-association may be detrimental in biological systems, but can be utilized in a controlled fashion for protein crystallization. It is hence of considerable interest to understand how factors like solution conditions prevent or promote aggregation. Here we present a computational model describing interactions between protein molecules in solution. The calculations are based on a molecular description capturing the detailed structure of the protein molecule using x-ray or nuclear ma...

  20. Protein Functionalized Nanodiamond Arrays

    Directory of Open Access Journals (Sweden)

    Liu YL

    2010-01-01

    Full Text Available Abstract Various nanoscale elements are currently being explored for bio-applications, such as in bio-images, bio-detection, and bio-sensors. Among them, nanodiamonds possess remarkable features such as low bio-cytotoxicity, good optical property in fluorescent and Raman spectra, and good photostability for bio-applications. In this work, we devise techniques to position functionalized nanodiamonds on self-assembled monolayer (SAMs arrays adsorbed on silicon and ITO substrates surface using electron beam lithography techniques. The nanodiamond arrays were functionalized with lysozyme to target a certain biomolecule or protein specifically. The optical properties of the nanodiamond-protein complex arrays were characterized by a high throughput confocal microscope. The synthesized nanodiamond-lysozyme complex arrays were found to still retain their functionality in interacting with E. coli.