WorldWideScience

Sample records for discharge summary db

  1. Surgical discharge summaries: improving the record.

    Science.gov (United States)

    Adams, D C; Bristol, J B; Poskitt, K R

    1993-03-01

    The problem area of communication between hospital and general practitioners may potentially be improved by the advent of new information technology. The introduction of a regional computer database for general surgery allows the rapid automated production of discharge summaries and has provided us with the opportunity for auditing the quality of old and new styles of discharge communication. A total of 118 general practitioners were sent a postal questionnaire to establish their views on the relative importance of various aspects of patient information and management after discharge. A high response rate (97%) indicated the interest of general practitioners in this topic. The majority (73%) believed that summaries should be delayed no more than 3 days. The structured and shortened new format was preferred to the older style of discharge summary. The older format rarely arrived within an appropriate time and its content was often felt to be either inadequate (35%) or excessive (7%) compared with the new format (8% and 1%, respectively). The diagnosis, information given to the patient, clinic date, list of medications and investigations were considered the more important details in the summary. Improvements in the discharge information were suggested and have subsequently been incorporated in our discharge policy. The use of new information technology, intended to facilitate clinical audit, has improved our ability to generate prompt, well-structured discharge summaries which are accepted by the general practitioners.

  2. Facilitating the Information Exchange Using a Modular Electronic Discharge Summary.

    Science.gov (United States)

    Denecke, Kerstin; Dittli, Pascal A; Kanagarasa, Niveadha; Nüssli, Stephan

    2018-01-01

    Discharge summaries are a standard communication tool delivering important clinical information from inpatient to ambulatory care. To ensure a high quality, correctness and completeness, the generation process is time consuming. It requires also contributions of multiple persons. This is problematic since the primary care provider needs the information from the discharge summary for continuing the intended treatment. To address this challenge, we developed a concept for exchanging a modular electronic discharge summary. Through a literature review and interviews with multiple stakeholders, we analysed existing processes and derived requirements for an improved communication of the discharge summary. In this paper, we suggest a concept of a modular electronic discharge summary that is exchanged through the electronic patient dossier in CDA CH level 2 documents. Until 2020, all Swiss hospitals are obliged to connect to the electronic patient dossier. Our concept allows to access already completed modules of the discharge summary from the primary care side, before the entire report is entirely finalised. The data is automatically merged with the local patient record on the physician side and prepared for data integration into the practice information system. Our concept offers the opportunity not only to improve the information exchange between hospital and primary care, but it also provides a potential use case and demonstrates a benefit of the electronic patient dossier for primary care providers who are so far not obliged to connect to the patient dossier in Switzerland.

  3. Pending laboratory tests and the hospital discharge summary in patients discharged to sub-acute care.

    Science.gov (United States)

    Walz, Stacy E; Smith, Maureen; Cox, Elizabeth; Sattin, Justin; Kind, Amy J H

    2011-04-01

    Previous studies have noted a high (41%) prevalence and poor discharge summary communication of pending laboratory (lab) tests at the time of hospital discharge for general medical patients. However, the prevalence and communication of pending labs within a high-risk population, specifically those patients discharged to sub-acute care (i.e., skilled nursing, rehabilitation, long-term care), remains unknown. To determine the prevalence and nature of lab tests pending at hospital discharge and their inclusion within hospital discharge summaries, for common sub-acute care populations. Retrospective cohort study. Stroke, hip fracture, and cancer patients discharged from a single large academic medical center to sub-acute care, 2003-2005 (N = 564) Pending lab tests were abstracted from the laboratory information system (LIS) and from each patient's discharge summary, then grouped into 14 categories and compared. Microbiology tests were sub-divided by culture type and number of days pending prior to discharge. Of sub-acute care patients, 32% (181/564) were discharged with pending lab tests per the LIS; however, only 11% (20/181) of discharge summaries documented these. Patients most often left the hospital with pending microbiology tests (83% [150/181]), particularly blood and urine cultures, and reference lab tests (17% [30/181]). However, 82% (61/74) of patients' pending urine cultures did not have 24-hour preliminary results, and 19% (13/70) of patients' pending blood cultures did not have 48-hour preliminary results available at the time of hospital discharge. Approximately one-third of the sub-acute care patients in this study had labs pending at discharge, but few were documented within hospital discharge summaries. Even after considering the availability of preliminary microbiology results, these omissions remain common. Future studies should focus on improving the communication of pending lab tests at discharge and evaluating the impact that this improved

  4. Improving the accuracy of operation coding in surgical discharge summaries

    Science.gov (United States)

    Martinou, Eirini; Shouls, Genevieve; Betambeau, Nadine

    2014-01-01

    Procedural coding in surgical discharge summaries is extremely important; as well as communicating to healthcare staff which procedures have been performed, it also provides information that is used by the hospital's coding department. The OPCS code (Office of Population, Censuses and Surveys Classification of Surgical Operations and Procedures) is used to generate the tariff that allows the hospital to be reimbursed for the procedure. We felt that the OPCS coding on discharge summaries was often incorrect within our breast and endocrine surgery department. A baseline measurement over two months demonstrated that 32% of operations had been incorrectly coded, resulting in an incorrect tariff being applied and an estimated loss to the Trust of £17,000. We developed a simple but specific OPCS coding table in collaboration with the clinical coding team and breast surgeons that summarised all operations performed within our department. This table was disseminated across the team, specifically to the junior doctors who most frequently complete the discharge summaries. Re-audit showed 100% of operations were accurately coded, demonstrating the effectiveness of the coding table. We suggest that specifically designed coding tables be introduced across each surgical department to ensure accurate OPCS codes are used to produce better quality surgical discharge summaries and to ensure correct reimbursement to the Trust. PMID:26734286

  5. The Ideal Hospital Discharge Summary: A Survey of U.S. Physicians.

    Science.gov (United States)

    Sorita, Atsushi; Robelia, Paul M; Kattel, Sharma B; McCoy, Christopher P; Keller, Allan Scott; Almasri, Jehad; Murad, Mohammad Hassan; Newman, James S; Kashiwagi, Deanne T

    2017-09-06

    Hospital discharge summaries enable communication between inpatient and outpatient physicians. Despite existing guidelines for discharge summaries, they are frequently suboptimal. The aim of this study was to assess physicians' perspectives about discharge summaries and the differences between summaries' authors (hospitalists) and readers (primary care physicians [PCPs]). A national survey of 1600 U.S. physicians was undertaken. Primary measures included physicians' preferences in discharge summary standardization, content, format, and audience. A total of 815 physicians responded (response rate = 51%). Eighty-nine percent agreed that discharge summaries "should have a standardized format." Most agreed that summaries should "document everything that was done, found, and recommended in the hospital" (64%) yet "only include details that are highly pertinent to the hospitalization" (66%). Although 74% perceived patients as an important audience of discharge summaries, only 43% agreed that summaries "should be written in language that patients…can easily understand," and 68% agreed that it "should be written solely for provider-to-provider communication." Compared with hospitalists, PCPs preferred comprehensive summaries (68% versus 59%, P = 0.002). More PCPs agreed that separate summaries should be created for patients and for provider-to-provider communication than hospitalists (60% versus 47%, P summary" (44% versus 23%, P summary" (60% versus 38%, P summaries should have a standardized format but do not agree on how comprehensive or in what format they should be. Efforts are necessary to build consensus toward the ideal discharge summary.

  6. From Patient Discharge Summaries to an Ontology for Psychiatry.

    Science.gov (United States)

    Richard, Marion; Aimé, Xavier; Jaulent, Marie-Christine; Krebs, Marie-Odile; Charlet, Jean

    2017-01-01

    Psychiatry aims at detecting symptoms, providing diagnoses and treating mental disorders. We developed ONTOPSYCHIA, an ontology for psychiatry in three modules: social and environmental factors of mental disorders, mental disorders, and treatments. The use of ONTOPSYCHIA, associated with dedicated tools, will facilitate semantic research in Patient Discharge Summaries (PDS). To develop the first module of the ontology we propose a PDS text analysis in order to explicit psychiatry concepts. We decided to set aside classifications during the construction of the modu le, to focus only on the information contained in PDS (bottom-up approach) and to return to domain classifications solely for the enrichment phase (top-down approach). Then, we focused our work on the development of the LOVMI methodology (Les Ontologies Validées par Méthode Interactive - Ontologies Validated by Interactive Method), which aims to provide a methodological framework to validate the structure and the semantic of an ontology.

  7. The Development and Evaluation of a Novel Instrument Assessing Residents' Discharge Summaries.

    Science.gov (United States)

    Hommos, Musab S; Kuperman, Ethan F; Kamath, Aparna; Kreiter, Clarence D

    2017-04-01

    To develop and determine the reliability of a novel measurement instrument assessing the quality of residents' discharge summaries. In 2014, the authors created a discharge summary evaluation instrument based on consensus recommendations from national regulatory bodies and input from primary care providers at their institution. After a brief pilot, they used the instrument to evaluate discharge summaries written by first-year internal medicine residents (n = 24) at a single U.S. teaching hospital during the 2013-2014 academic year. They conducted a generalizability study to determine the reliability of the instrument and a series of decision studies to determine the number of discharge summaries and raters needed to achieve a reliable evaluation score. The generalizability study demonstrated that 37% of the variance reflected residents' ability to generate an adequate discharge summary (true score variance). The decision studies estimated that the mean score from six discharge summary reviews completed by a unique rater for each review would yield a reliability coefficient of 0.75. Because of high interrater reliability, multiple raters per discharge summary would not significantly enhance the reliability of the mean rating. This evaluation instrument reliably measured residents' performance writing discharge summaries. A single rating of six discharge summaries can achieve a reliable mean evaluation score. Using this instrument is feasible even for programs with a limited number of inpatient encounters and a small pool of faculty preceptors.

  8. A de-identifier for medical discharge summaries.

    Science.gov (United States)

    Uzuner, Ozlem; Sibanda, Tawanda C; Luo, Yuan; Szolovits, Peter

    2008-01-01

    Clinical records contain significant medical information that can be useful to researchers in various disciplines. However, these records also contain personal health information (PHI) whose presence limits the use of the records outside of hospitals. The goal of de-identification is to remove all PHI from clinical records. This is a challenging task because many records contain foreign and misspelled PHI; they also contain PHI that are ambiguous with non-PHI. These complications are compounded by the linguistic characteristics of clinical records. For example, medical discharge summaries, which are studied in this paper, are characterized by fragmented, incomplete utterances and domain-specific language; they cannot be fully processed by tools designed for lay language. In this paper, we show that we can de-identify medical discharge summaries using a de-identifier, Stat De-id, based on support vector machines and local context (F-measure=97% on PHI). Our representation of local context aids de-identification even when PHI include out-of-vocabulary words and even when PHI are ambiguous with non-PHI within the same corpus. Comparison of Stat De-id with a rule-based approach shows that local context contributes more to de-identification than dictionaries combined with hand-tailored heuristics (F-measure=85%). Comparison with two well-known named entity recognition (NER) systems, SNoW (F-measure=94%) and IdentiFinder (F-measure=36%), on five representative corpora show that when the language of documents is fragmented, a system with a relatively thorough representation of local context can be a more effective de-identifier than systems that combine (relatively simpler) local context with global context. Comparison with a Conditional Random Field De-identifier (CRFD), which utilizes global context in addition to the local context of Stat De-id, confirms this finding (F-measure=88%) and establishes that strengthening the representation of local context may be more

  9. Novel combined patient instruction and discharge summary tool improves timeliness of documentation and outpatient provider satisfaction

    Directory of Open Access Journals (Sweden)

    Meredith Gilliam

    2017-03-01

    Full Text Available Background: Incomplete or delayed access to discharge information by outpatient providers and patients contributes to discontinuity of care and poor outcomes. Objective: To evaluate the effect of a new electronic discharge summary tool on the timeliness of documentation and communication with outpatient providers. Methods: In June 2012, we implemented an electronic discharge summary tool at our 145-bed university-affiliated Veterans Affairs hospital. The tool facilitates completion of a comprehensive discharge summary note that is available for patients and outpatient medical providers at the time of hospital discharge. Discharge summary note availability, outpatient provider satisfaction, and time between the decision to discharge a patient and discharge note completion were all evaluated before and after implementation of the tool. Results: The percentage of discharge summary notes completed by the time of first post-discharge clinical contact improved from 43% in February 2012 to 100% in September 2012 and was maintained at 100% in 2014. A survey of 22 outpatient providers showed that 90% preferred the new summary and 86% found it comprehensive. Despite increasing required documentation, the time required to discharge a patient, from physician decision to discharge note completion, improved from 5.6 h in 2010 to 4.1 h in 2012 (p = 0.04, and to 2.8 h in 2015 (p < 0.001. Conclusion: The implementation of a novel discharge summary tool improved the timeliness and comprehensiveness of discharge information as needed for the delivery of appropriate, high-quality follow-up care, without adversely affecting the efficiency of the discharge process.

  10. Hospital discharge summary scorecard: a quality improvement tool used in a tertiary hospital general medicine service.

    Science.gov (United States)

    Singh, G; Harvey, R; Dyne, A; Said, A; Scott, I

    2015-12-01

    We assessed the impact of completion and feedback of discharge summary scorecards on the quality of discharge summaries written by interns in a general medicine service of a tertiary hospital. The scorecards significantly improved summary quality in the first three rotations of the intern year and could be readily adopted by other units as a quality improvement intervention for optimizing clinical handover to primary care providers. © 2015 Royal Australasian College of Physicians.

  11. Quality of medication information in discharge summaries from hospitals: an audit of electronic patient records.

    Science.gov (United States)

    Garcia, Beate Hennie; Djønne, Berit Svendsen; Skjold, Frode; Mellingen, Ellen Marie; Aag, Trine Iversen

    2017-12-01

    Background Low quality of medication information in discharge summaries from hospitals may jeopardize optimal therapy and put the patient at risk for medication errors and adverse drug events. Objective To audit the quality of medication information in discharge summaries and explore factors associated with the quality. Setting Helgelandssykehuset Mo i Rana, a rural hospital in central Norway. Method For each month in 2013, we randomly selected 60 discharge summaries from the Department of Medicine and Surgery (totally 720) and evaluated the medication information using eight Norwegian quality criteria. Main outcome measure Mean score per discharge summary ranging from 0 (lowest quality) to 16 (highest quality). Results Mean score per discharge summary was 7.4 (SD 2.8; range 0-14), significantly higher when evaluating medications used regularly compared to mediations used as needed (7.80 vs. 6.52; p < 0.001). Lowest score was achieved for quality criteria concerning generic names, indications for medication use, reasons why changes had been made and information about the source for information. Factors associated with increased quality scores are increasing numbers of medications and male patients. Increasing age seemed to be associated with a reduced score, while type of department was not associated with the quality. Conclusion In discharge summaries from 2013, we identified a low quality of medication information in accordance with the Norwegian quality criteria. Actions for improvement are necessary and follow-up studies to monitor quality are needed.

  12. Communication at the interface between hospitals and primary care - a general practice audit of hospital discharge summaries.

    Science.gov (United States)

    Belleli, Esther; Naccarella, Lucio; Pirotta, Marie

    2013-12-01

    Timeliness and quality of hospital discharge summaries are crucial for patient safety and efficient health service provision after discharge. We audited receipt rates, timeliness and the quality of discharge summaries for 49 admissions among 38 patients in an urban general practice. For missing discharge summaries, a hospital medical record search was performed. Discharge summaries were received for 92% of identified admissions; 73% were received within three days and 55% before the first post-discharge visit to the general practitioner (GP). Administrative information and clinical content, including diagnosis, treatment and follow-up plans, were well reported. However, information regarding tests, referrals and discharge medication was often missing; 57% of summaries were entirely typed and 13% had legibility issues. Completion rates were good but utility was compromised by delays, content omissions and formatting. Digital searching enables extraction of information from rich existing datasets contained in GP records for accurate measurement of discharge summary receipt rate and timing.

  13. Discharge communication from inpatient care: an audit of written medical discharge summary procedure against the new National Health Service Standard for clinical handover.

    Science.gov (United States)

    Reid, Daniel Brooks; Parsons, Shaun R; Gill, Stephen D; Hughes, Andrew J

    2015-04-01

    To audit written medical discharge summary procedure and practice against Standard Six (clinical handover) of the Australian National Safety and Quality Health Service Standards at a major regional Victorian health service. Department heads were invited to complete a questionnaire about departmental discharge summary practices. Twenty-seven (82%) department heads completed the questionnaire. Seven (26%) departments had a documented discharge summary procedure. Fourteen (52%) departments monitored discharge summary completion and 13 (48%) departments monitored the timeliness of completion. Seven (26%) departments informed the patient of the content of the discharge summary and six (22%) departments provided the patient with a copy. Seven (26%) departments provided training for staff members on how to complete discharge summaries. Completing discharge summaries was usually delegated to the medical intern. The introduction of the National Service Standards prompted an organisation-wide audit of discharge summary practices against the external criterion. There was substantial variation in the organisation's practices. The Standards and the current audit results highlight an opportunity for the organisation to enhance and standardise discharge summary practices and improve communication with general practice.

  14. Effluent Information System (EIS) / Onsite Discharge Information System (ODIS): 1986 executive summary

    International Nuclear Information System (INIS)

    Watanabe, T.

    1987-09-01

    Department of Energy (DOE) data base systems aid DOE-Headquarters and Field Offices in managing the radioactive air and liquid effluents from DOE facilities. Data on effluents released offsite are entered into effluent information system (EIS) and data on effluents discharged onsite and retained onsite are entered into Onsite Discharge Information System (ODIS). This document is a summary of information obtained from the CY 1986 effluent data received from all DOE and DOE contractor facilities and entered in the data bases. Data from previous years are also included. The summary consists of information for effluents released offsite, and information for effluents retained onsite

  15. Summary of personnel doses and discharge of radioactivity at Swedish nuclear power plants 1971-1975

    International Nuclear Information System (INIS)

    Malmqvist, L.; Persson, Aa.

    1977-01-01

    The report is a summary of personnel doses and activity discharges from Swedish nuclear power plants during the first five years of electric power production by nuclear plants. The personnel doses for the Sweedish plants are lower than the corresponding values for American plants. The highest Swedish value is o,13 manrem per MWE and year. The discharge of radioactivity to the atmosphere from the Swedish plants has been for below the maximum permissible limits. The discharge of radioactivity to the water recipients was less than 1 % of what is permissible

  16. Actinide discharges from Sellafield - a summary of behaviour in the environment and the radiological implications

    International Nuclear Information System (INIS)

    Coughtrey, P.J.; Jackson, D.; Martin, A.; Thorne, M.C.

    1985-05-01

    This report provides a summary of: information on the quantities of actinides discharged from Sellafield, their distribution in the environment and the radiological implications; potential long-term trends and exposure pathways that may require investigation; and research in progress and requirements for further research. (author)

  17. Latent topic discovery of clinical concepts from hospital discharge summaries of a heterogeneous patient cohort.

    Science.gov (United States)

    Lehman, Li-Wei; Long, William; Saeed, Mohammed; Mark, Roger

    2014-01-01

    Patients in critical care often exhibit complex disease patterns. A fundamental challenge in clinical research is to identify clinical features that may be characteristic of adverse patient outcomes. In this work, we propose a data-driven approach for phenotype discovery of patients in critical care. We used Hierarchical Dirichlet Process (HDP) as a non-parametric topic modeling technique to automatically discover the latent "topic" structure of diseases, symptoms, and findings documented in hospital discharge summaries. We show that the latent topic structure can be used to reveal phenotypic patterns of diseases and symptoms shared across subgroups of a patient cohort, and may contain prognostic value in stratifying patients' post hospital discharge mortality risks. Using discharge summaries of a large patient cohort from the MIMIC II database, we evaluate the clinical utility of the discovered topic structure in identifying patients who are at high risk of mortality within one year post hospital discharge. We demonstrate that the learned topic structure has statistically significant associations with mortality post hospital discharge, and may provide valuable insights in defining new feature sets for predicting patient outcomes.

  18. Electronic discharge summary and prescription: improving communication between hospital and primary care.

    Science.gov (United States)

    Murphy, S F; Lenihan, L; Orefuwa, F; Colohan, G; Hynes, I; Collins, C G

    2017-05-01

    The discharge letter is a key component of the communication pathway between the hospital and primary care. Accuracy and timeliness of delivery are crucial to ensure continuity of patient care. Electronic discharge summaries (EDS) and prescriptions have been shown to improve quality of discharge information for general practitioners (GPs). The aim of this study was to evaluate the effect of a new EDS on GP satisfaction levels and accuracy of discharge diagnosis. A GP survey was carried out whereby semi-structured interviews were conducted with 13 GPs from three primary care centres who receive a high volume of discharge letters from the hospital. A chart review was carried out on 90 charts to compare accuracy of ICD-10 coding of Non-Consultant Hospital Doctors (NCHDs) with that of trained Hopital In-Patient Enquiry (HIPE) coders. GP satisfaction levels were over 90 % with most aspects of the EDS, including amount of information (97 %), accuracy (95 %), GP information and follow-up (97 %) and medications (91 %). 70 % of GPs received the EDS within 2 weeks. ICD-10 coding of discharge diagnosis by NCHDs had an accuracy of 33 %, compared with 95.6 % when done by trained coders (p communication with primary care. It has led to a very high satisfaction rating with GPs. ICD-10 coding was found to be grossly inaccurate when carried out by NCHDs and it is more appropriate for this task to be carried out by trained coders.

  19. [Does the nutritional care plan and report upon discharge under the health care system substitute the nutrition support team summary at patient discharge?].

    Science.gov (United States)

    Hidaka, Kumi; Matsuoka, Mio; Kajiwara, Kanako; Hinokiyama, Hiromi; Mito, Saori; Doi, Seiko; Konishi, Eriko; Ibata, Takeshi; Komuro, Ryutaro; lijima, Shohei

    2013-12-01

    Our nutrition support team (NST) designed the NST summary for cooperation among personnel providing medical care for nutritional management of high-need patients in our area. After the introduction of the NST fee under the health care system, the number of summary publications decreased. The requested NST fee is necessary for publication of a nutritional care plan and report upon patient discharge. We hypothesized that the nutritional care plan and discharge report were being substituted for the NST summary at the time of patient discharge. We retrospectively investigated 192 cases with NST fee. There were only 13 cases of overlapping publication, and the NST summary was necessary for 107 of 179 cases in which no NST summary had been prepared. Since the space on the report form is limited, it can provide only limited information. However, the NST summary can convey detailed supplementary information. Therefore, there is a high need for the NST summary, and publication of NST summaries for the appropriate cases must continue.

  20. Effluent information system (EIS)/onsite discharge information system (ODIS) 1985 executive summary

    International Nuclear Information System (INIS)

    Watanabe, T.

    1986-09-01

    The Effluent Information System (EIS) and Onsite Discharge Information System (ODIS) are Department of Energy (DOE) data base systems that aid DOE-Headquarters and Field Offices in managing the radioactive air and liquid effluents from DOE facilities. Data on effluents released offsite are entered into EIS and data on effluents discharged onsite and retained onsite are entered into ODIS. This document is a summary of information obtained from the CY 1985 effluent data received from all DOE and DOE contractor facilities and entered in the data bases. Data from previous years are also included. The summary consists of two parts. The first part summarizes information for effluents released offsite, and the second part summarizes information for effluents retained onsite. These summaries are taken from the routine annual reports sent to each DOE Operations Office. Special tabulations or specific data can be supplied upon request. Explanations of the significant changes are included in the EIS and ODIS graphic sections. Only those changes in activity greater than a factor of two and having a magnitude greater than 0.1 Ci are considered significant and are addressed in the explanation

  1. Regulation, characterization and treatment of discharge waters from pipelines. Volume 1. Topical report, January 1989-April 1992. Executive summary

    International Nuclear Information System (INIS)

    Tallon, J.T.; Fillo, J.P.

    1992-04-01

    The report examines environmental issues related to hydrostatic testing of discharge waters generated from integrity testing of natural gas pipelines. Hydrostatic testing, and proper environmental management of the discharge waters, can be required by DOT regulations. However, disposal of water used to conduct a hydrostatic pipeline test is regulated on a state-by-state basis. State-specific requirements vary widely, ranging from an authorization letter to a complete NPDES permit. Monitoring may be required before and during discharge, include a variety of analyses, have varying protocols for obtaining samples, and may be required either to obtain data or to ascertain compliance with stipulated discharge limits. The composition of the discharge and state-specific discharge limitations dictate treatment needs on a case-by-case basis. The volume consists of the Executive Summary of a five-volume report series

  2. Validity of Principal Diagnoses in Discharge Summaries and ICD-10 Coding Assessments Based on National Health Data of Thailand.

    Science.gov (United States)

    Sukanya, Chongthawonsatid

    2017-10-01

    This study examined the validity of the principal diagnoses on discharge summaries and coding assessments. Data were collected from the National Health Security Office (NHSO) of Thailand in 2015. In total, 118,971 medical records were audited. The sample was drawn from government hospitals and private hospitals covered by the Universal Coverage Scheme in Thailand. Hospitals and cases were selected using NHSO criteria. The validity of the principal diagnoses listed in the "Summary and Coding Assessment" forms was established by comparing data from the discharge summaries with data obtained from medical record reviews, and additionally, by comparing data from the coding assessments with data in the computerized ICD (the data base used for reimbursement-purposes). The summary assessments had low sensitivities (7.3%-37.9%), high specificities (97.2%-99.8%), low positive predictive values (9.2%-60.7%), and high negative predictive values (95.9%-99.3%). The coding assessments had low sensitivities (31.1%-69.4%), high specificities (99.0%-99.9%), moderate positive predictive values (43.8%-89.0%), and high negative predictive values (97.3%-99.5%). The discharge summaries and codings often contained mistakes, particularly the categories "Endocrine, nutritional, and metabolic diseases", "Symptoms, signs, and abnormal clinical and laboratory findings not elsewhere classified", "Factors influencing health status and contact with health services", and "Injury, poisoning, and certain other consequences of external causes". The validity of the principal diagnoses on the summary and coding assessment forms was found to be low. The training of physicians and coders must be strengthened to improve the validity of discharge summaries and codings.

  3. National Hospital Discharge Survey: 2005 annual summary with detailed diagnosis and procedure data.

    Science.gov (United States)

    DeFrances, Carol J; Cullen, Karen A; Kozak, Lola Jean

    2007-12-01

    This report presents 2005 national estimates and selected trend data on the use of nonfederal short-stay hospitals in the United States. Estimates are provided by selected patient and hospital characteristics, diagnoses, and surgical and nonsurgical procedures performed. Estimates of diagnoses and procedures are presented according to International Classification of Diseases, Ninth Revision, Clinical Modification codes. The estimates are based on data collected through the National Hospital Discharge Survey. The survey has been conducted annually since 1965. In 2005, data were collected for approximately 375,000 discharges. Of the 473 eligible nonfederal short-stay hospitals in the sample, 444 (94 percent) responded to the survey. An estimated 34.7 million discharges from nonfederal short-stay hospitals occurred in 2005. Discharges used 165.9 million days of care and had an average length of stay of 4.8 days. Persons 65 years and over accounted for 38 percent of the hospital discharges and 44 percent of the days of care. The proportion of discharges whose status was described as routine discharge or discharged to the patient's home declined with age, from 91 percent for inpatients under 45 years of age to 41 percent for those 85 years and over. Hospitalization for malignant neoplasms decreased from 1990-2005. The hospitalization rate for asthma was the highest for children under 15 years of age and those 65 years of age and over. The rate was lowest for those 15-44 years of age. Thirty-eight percent of hospital discharges had no procedures performed, whereas 12 percent had four or more procedures performed. An episiotomy was performed during a majority of vaginal deliveries in 1980 (64 percent), but by 2005, it was performed during less than one of every five vaginal deliveries (19 percent).

  4. Semantic-Web Architecture for Electronic Discharge Summary Based on OWL 2.0 Standard.

    Science.gov (United States)

    Tahmasebian, Shahram; Langarizadeh, Mostafa; Ghazisaeidi, Marjan; Safdari, Reza

    2016-06-01

    Patients' electronic medical record contains all information related to treatment processes during hospitalization. One of the most important documents in this record is the record summary. In this document, summary of the whole treatment process is presented which is used for subsequent treatments and other issues pertaining to the treatment. Using suitable architecture for this document, apart from the aforementioned points we can use it in other fields such as data mining or decision making based on the cases. In this study, at first, a model for patient's medical record summary has been suggested using semantic web-based architecture. Then, based on service-oriented architecture and using Java programming language, a software solution was designed and run in a way to generate medical record summary with this structure and at the end, new uses of this structure was explained. in this study a structure for medical record summaries along with corrective points within semantic web has been offered and a software running within Java along with special ontologies are provided. After discussing the project with the experts of medical/health data management and medical informatics as well as clinical experts, it became clear that suggested design for medical record summary apart from covering many issues currently faced in the medical records has also many advantages including its uses in research projects, decision making based on the cases etc.

  5. [Summary of the practice guideline 'Vaginal discharge' (first revision) from the Dutch College of General Practitioners].

    Science.gov (United States)

    Boukes, F S; Boeke, A J P; Dekker, J H; Wiersma, T; Goudswaard, A N

    2007-06-16

    The 1996 practice guideline of the Dutch College of General Practitioners (NHG) on vaginal discharge has been updated. Most women who visit their doctor with complaints about vaginal discharge do not have an increased risk of a sexually-transmitted disease. Investigations into vaginal discharge comprise history taking, physical examination and microscopic analysis in the laboratory of the general practitioner. Additional investigation into Chlamydia, gonorrhoea and Trichomonas infection is only necessary if the patient history reveals an increased risk of a sexually-transmitted disease. A Candida infection or bacterial vaginosis should only be treated if the patient experiences bothersome complaints. Treatment of a Candida infection consists of a vaginally applied imidazole compound. Bacterial vaginosis can be treated with oral administration of metronidazole. Patients with vaginal fluor can be examined and, if necessary, treated by their general practitioner. Referral to a gynaecologist is rarely necessary.

  6. Summary of energy and particle confinement in pellet-fuelled auxiliary-heated discharges on JET

    International Nuclear Information System (INIS)

    Milora, S.L.; Baylor, L.R.; Bartlett, D.V.

    1989-01-01

    A transient improvement in plasma performance and central confinement has been observed in auxiliary heated JET limiter plasmas associated with a peaking of the plasma density profile and strong centralized heating. Suitable target plasmas for ICRF and NBI heating experiments are created by deuterium pellet injection with a multi pellet injector system developed jointly by ORNL and JETZ . Two types of discharge conditions have been observed. In the first (type A), the density profiles decay gradually during the first 1.3s of the heating pulse while maintaining an elevated density core plasma inside r/a < 0.6 superimposed on a flat density pedestal. During this phase the central electron and ion temperatures increase rapidly (up to 12 keV and 10 keV respectively in the best discharges). This results in an increase in the central plasma pressure by approximately a factor of three (β(0) 5%) above gas fuelled discharges and gives rise to sharply increased pressure gradients in the plasma. An abrupt collapse of the central electron and ion temperatures terminates the enhanced phase at 1.3 s and leads eventually to a 20% decrease in plasma stored energy. While these discharges are predicted to be stable to kink modes, they approach the first stability boundary for ballooning modes in the region of steepest pressure gradient. The pressure and q profiles inferred from transport analysis are also close to those for which intermediate-n mode instability is predicted. (author) 11 refs., 4 figs

  7. National Hospital Discharge Survey: 2002 annual summary with detailed diagnosis and procedure data.

    Science.gov (United States)

    Kozak, Lola J; Owings, Maria F; Hall, Margaret J

    2005-03-01

    This report presents 2002 national estimates and selected trend data on the use of non-Federal short-stay hospitals in the United States. Estimates are provided by selected patient and hospital characteristics, diagnoses, and surgical and nonsurgical procedures performed. Estimates of diagnoses and procedures are presented according to International Classification of Diseases, 9th Revision, Clinical Modification (ICD-9-CM) codes. The estimates are based on data collected through the National Hospital Discharge Survey (NHDS). The survey has been conducted annually since 1965. In 2002, data were collected for approximately 327,000 discharges. Of the 474 eligible non-Federal short-stay hospitals in the sample, 445 (94 percent) responded to the survey. An estimated 33.7 million inpatients were discharged from non-Federal short-stay hospitals in 2002. They used 164.2 million days of care and had an average length of stay of 4.9 days. Common first-listed discharge diagnoses included delivery, ischemic heart disease, psychoses, pneumonia, and malignant neoplasms. Inpatients had 6.8 million cardiovascular procedures and 6.6 million obstetric procedures. Males had higher rates for cardiac procedures such as cardiac catheterization and coronary artery bypass graft, but males and females had similar rates of pacemaker procedures. The number and rate of all cesarean deliveries, primary and repeat, rose from 1995 to 2002; the rate of vaginal birth after cesarean delivery dropped from 35.5 in 1995 to 15.8 in 2002.

  8. National hospital discharge survey: 2004 annual summary with detailed diagnosis and procedure data.

    Science.gov (United States)

    Kozak, Lola Jean; DeFrances, Carol Jean; Hall, Margaret Jean

    2006-10-01

    This report presents 2004 national estimates and selected trend data on the use of nonfederal short-stay hospitals in the United States. Estimates are provided by selected patient and hospital characteristics, diagnoses, and surgical and nonsurgical procedures performed. Estimates of diagnoses and procedures are presented according to International Classification of Diseases, 9th Revision, Clinical Modification (ICD-9-CM) codes. The estimates are based on data collected through the National Hospital Discharge Survey (NHDS). The survey has been conducted annually since 1965. In 2004, data were collected for approximately 371,000 discharges. Of the 476 eligible nonfederal short-stay hospitals in the sample, 439 (92 percent) responded to the survey. An estimated 34.9 million inpatients were discharged from nonfederal short-stay hospitals in 2004. They used 167.9 million days of care and had an average length of stay of 4.8 days. Hospital use by age ranged from 4.3 million days of care for patients 5-14 years of age to 31.8 million days of care for 75-84 year olds. Almost a third of patients 85 years and over were discharged from hospitals to long-term care institutions. Diseases of the circulatory system was the leading diagnostic category for males. Childbirth was the leading category for females, followed by circulatory diseases. The proportion of HIV discharges who were 40 years of age and over increased from 40 percent in 1995 to 67 percent in 2004. The rate of cardiac catheterizations was higher for males than for females and higher for patients 65-74 and 75-84 years of age than for older or younger groups. The average length of stay for both vaginal and cesarean deliveries decreased from 1980 through 1995 but stays for vaginal deliveries increased 24 percent during the period from 1995 to 2004.

  9. National Hospital Discharge Survey: 2003 annual summary with detailed diagnosis and procedure data.

    Science.gov (United States)

    Kozak, Lola Jean; Lees, Karen A; DeFrances, Carol J

    2006-05-01

    This report presents 2003 national estimates and trend data on the use of non-Federal short-stay hospitals in the United States. Estimates are provided by patient and hospital characteristics, diagnoses, and surgical and nonsurgical procedures performed. Estimates of diagnoses and procedures are presented according to the International Classification of Diseases, 9th Revision, Clinical Modification (ICD-9-CM) codes. The estimates are based on data collected through the National Hospital Discharge Survey (NHDS). The survey has been conducted annually since 1965. In 2003, data were collected for approximately 320,000 discharges. Of the 479 eligible non-Federal short-stay hospitals in the sample, 426 (89 percent) responded to the survey. An estimated 34.7 million inpatients were discharged from non-Federal short-stay hospitals in 2003. They used 167.3 million days of care and had an average length of stay of 4.8 days. Females used almost one-third more days of hospital care than males. Patients with five or more diagnoses rose from 29 percent of discharges in 1990 to 57 percent in 2003. The leading diagnostic category was respiratory diseases for children under 15 years, childbirth for 15-44 year olds, and circulatory diseases for patients 45 years of age and over. Only surgical procedures were performed for 27 percent of discharges, 18 percent had surgical and nonsurgical procedures, and 16 percent had only nonsurgical procedures. A total of 664,000 coronary angioplasties were performed, and stents were inserted during 86 percent of these procedures with drug-eluting stents used in 28 percent. The number and rate of total and primary cesarean deliveries rose from 1995 to 2003. The rate of vaginal birth after cesarean delivery dropped 58 percent, from 35.5 in 1995 to 14.8 in 2003.

  10. National Hospital Discharge Survey: 2001 annual summary with detailed diagnosis and procedure data.

    Science.gov (United States)

    Kozak, Lola Jean; Owings, Maria F; Hall, Margaret J

    2004-06-01

    This report presents 2001 national estimates and selected trend data on the use of non-Federal short-stay hospitals in the United States. Estimates are provided by selected patient and hospital characteristics, diagnoses, and surgical and nonsurgical procedures performed. Admission source and type, collected for the first time in the 2001 National Hospital Discharge Survey, are shown. The estimates are based on data collected through the National Hospital Discharge Survey (NHDS). The survey has been conducted annually since 1965. In 2001, data were collected for approximately 330,000 discharges. Of the 477 eligible non-Federal short-stay hospitals in the sample, 448 (94 percent) responded to the survey. Estimates of diagnoses and procedures are presented according to International Classification of Diseases, 9th Revision, Clinical Modification (ICD-9-CM) code numbers. Rates are computed with 2001 population estimates based on the 2000 census. The appendix includes a comparison of rates computed with 1990 and 2000 census-based population estimates. An estimated 32.7 million inpatients were discharged from non-Federal short-stay hospitals in 2001. They used 159.4 million days of care and had an average length of stay of 4.9 days. Common first-listed discharge diagnoses included delivery, psychoses, pneumonia, malignant neoplasm, and coronary atherosclerosis. Males had higher rates for procedures such as cardiac catheterization and coronary artery bypass graft, and females had higher rates for procedures such as cholecystectomy and total knee replacement. The rates of all cesarean deliveries, primary and repeat, rose from 1995 to 2001; the rate of vaginal birth after cesarean delivery dropped 37 percent during this period.

  11. Summary

    International Nuclear Information System (INIS)

    2004-01-01

    The fourth workshop of the OECD/NEA Forum on Stakeholder Confidence (FSC) was hosted by ONDRAF/NIRAS, the Belgian Agency for Radioactive Waste Management and enriched fissile materials. The central theme of the workshop was ''Dealing with interests, values and knowledge in managing risk''within the Belgian context of local partnerships for the long term management of low-level, short-lived radioactive waste. The four-day workshop started with a half-day session in Brussels giving a general introduction on the Belgian context and the local partnership methodology. This was followed by community visits to three local partnerships, PaLoFF in Fleurus-Farciennes, MONA in Mol, and STOLA in Dessel. After the visits, the workshop continued with two full-day sessions in Brussels. One hundred and nineteen registered participants, representing 13 countries, attended the workshop or participated in the community visits. About two thirds were Belgian stakeholders; the remainder came from FSC member organisations. The participants included representatives of municipal governments, civil society organisations, government agencies, industrial companies, the media, and international organisations as well as private citizens, consultants and academics. This Executive Summary gives an overview of the presentations and discussions that took place at the workshop and the community visits. The structure of the Executive Summary follows the structure of the workshop itself. Complementary to this Executive Summary and also provided with this document, is a NEA Secretariat's reflection aiming to place the main lessons of the workshop into an international perspective. (author)

  12. TEMPTING system: a hybrid method of rule and machine learning for temporal relation extraction in patient discharge summaries.

    Science.gov (United States)

    Chang, Yung-Chun; Dai, Hong-Jie; Wu, Johnny Chi-Yang; Chen, Jian-Ming; Tsai, Richard Tzong-Han; Hsu, Wen-Lian

    2013-12-01

    Patient discharge summaries provide detailed medical information about individuals who have been hospitalized. To make a precise and legitimate assessment of the abundant data, a proper time layout of the sequence of relevant events should be compiled and used to drive a patient-specific timeline, which could further assist medical personnel in making clinical decisions. The process of identifying the chronological order of entities is called temporal relation extraction. In this paper, we propose a hybrid method to identify appropriate temporal links between a pair of entities. The method combines two approaches: one is rule-based and the other is based on the maximum entropy model. We develop an integration algorithm to fuse the results of the two approaches. All rules and the integration algorithm are formally stated so that one can easily reproduce the system and results. To optimize the system's configuration, we used the 2012 i2b2 challenge TLINK track dataset and applied threefold cross validation to the training set. Then, we evaluated its performance on the training and test datasets. The experiment results show that the proposed TEMPTING (TEMPoral relaTion extractING) system (ranked seventh) achieved an F-score of 0.563, which was at least 30% better than that of the baseline system, which randomly selects TLINK candidates from all pairs and assigns the TLINK types. The TEMPTING system using the hybrid method also outperformed the stage-based TEMPTING system. Its F-scores were 3.51% and 0.97% better than those of the stage-based system on the training set and test set, respectively. Copyright © 2013 Elsevier Inc. All rights reserved.

  13. Impaired Muscle Regeneration in Ob/ob and Db/db Mice

    Directory of Open Access Journals (Sweden)

    Mai-Huong Nguyen

    2011-01-01

    Full Text Available In obesity and type 2 diabetes, efficient skeletal muscle repair following injury may be required, not only for restoring muscle structure and function, but also for maintaining exercise capacity and insulin sensitivity. The hypothesis of this study was that muscle regeneration would be impaired in ob/ob and db/db mice, which are common mouse models of obesity and type 2 diabetes. Muscle injury was produced by cardiotoxin injection, and regeneration was assessed by morphological and immunostaining techniques. Muscle regeneration was delayed in ob/ob and db/db mice, but not in a less severe model of insulin resistance – feeding a high-fat diet to wild-type mice. Angiogenesis, cell proliferation, and myoblast accumulation were also impaired in ob/ob and db/db mice, but not the high-fat diet mice. The impairments in muscle regeneration were associated with impaired macrophage accumulation; macrophages have been shown previously to be required for efficient muscle regeneration. Impaired regeneration in ob/ob and db/db mice could be due partly to the lack of leptin signaling, since leptin is expressed both in damaged muscle and in cultured muscle cells. In summary, impaired muscle regeneration in ob/ob and db/db mice was associated with reduced macrophage accumulation, angiogenesis, and myoblast activity, and could have implications for insulin sensitivity in the skeletal muscle of obese and type 2 diabetic patients.

  14. Review of medical discharge summaries and medical documentation in a metropolitan hospital: impact on diagnostic-related groups and Weighted Inlier Equivalent Separation.

    Science.gov (United States)

    Chin, N; Perera, P; Roberts, A; Nagappan, R

    2013-07-01

    Accurate and comprehensive clinical documentation is crucial for effective ongoing patient care, follow up and to optimise case mix-based funding. Each Diagnostic Related Group (DRG) is assigned a 'weight', leading to Weighted Inlier Equivalent Separation (WIES), a system many public and private hospitals in Australia subscribe to. To identify the top DRG in a general medical inpatient service, the completeness of medical discharge documentation, commonly missed comorbidities and system-related issues and subsequent impact on DRG and WIES allocation. One hundred and fifty completed discharge summaries were randomly selected from the top 10 medical DRG in our health service. From a detailed review of the clinical documentation, principal diagnoses, associated comorbidities and complications, where appropriate, the DRG and WIES were modified. Seventy-two (48%) of the 150 reviewed admissions resulted in a revision of DRG and WIES equivalent to an increase of AUD 142,000. Respiratory-based DRG generated the largest revision of DRG and WIES, while 'Cellulitis' DRG had the largest relative change. Twenty-seven per cent of summaries reviewed necessitated a change in coding with no subsequent change in DRG allocation or WIES. Acute renal failure, anaemia and electrolyte disturbances were the most commonly underrepresented entities in clinical discharge documentation. Seven patients had their WIES downgraded. Comprehensive documentation of principal diagnosis/diagnoses, comorbidities and their complications is imperative to optimal DRG and WIES allocation. Regular meetings between clinical and coding staff improve the quality and timeliness of medical documentation, ensure adequate communication with general practitioners and lead to appropriate funding. © 2013 The Authors; Internal Medicine Journal © 2013 Royal Australasian College of Physicians.

  15. Angina - discharge

    Science.gov (United States)

    Chest pain - discharge; Stable angina - discharge; Chronic angina - discharge; Variant angina - discharge; Angina pectoris - discharge; Accelerating angina - discharge; New-onset angina - discharge; Angina-unstable - discharge; ...

  16. Hospital Nurses' and Physicians' Use of Information Sources during their Production of Discharge Summaries: A Cross-Sectional Study

    OpenAIRE

    Hellesø, Ragnhild; Sogstad, Maren Kristine Raknes

    2014-01-01

    Hospital nurses' and physicians' production and exchange of accurate information between levels of care are crucial for ensuring safe and seamless care for patients in transition. We report on a study in which we explored hospital providers' use of information sources when they prepared discharge information for colleges in the community health-care sector. In this cross-sectional study, 510 nurses and 236 physicians responded through a questionnaire. Our findings show that nurses and physici...

  17. Instant InnoDB

    CERN Document Server

    Reid, Matt

    2013-01-01

    This book is a complete reference guide, designed to provide you with answers and solutions to all the common problems you encounter within InnoDB, helping you achieve higher performance and greater stability in your InnoDB databases.The ""InnoDB Quick Reference Guide"" features content for all skill levels of MySQL administrators, developers, and engineers.

  18. Mastering MariaDB

    CERN Document Server

    Razzoli, Federico

    2014-01-01

    This book is intended for intermediate users who want to learn how to administrate a MariaDB server or a set of servers. It is aimed at MariaDB users, and hence working knowledge of MariaDB is a prerequisite.

  19. Summary of experimental core turbulence characteristics in ohmic and electron cyclotron resonance heated discharges in T-10 tokamak plasmas

    International Nuclear Information System (INIS)

    Vershkov, V.A.; Shelukhin, D.A.; Soldatov, S.V.; Urazbaev, A.O.; Grashin, S.A.; Eliseev, L.G.; Melnikov, A.V.

    2005-01-01

    This report summarizes the results of experimental turbulence investigations carried out at T-10 for more than 10 years. The turbulence characteristics were investigated using correlation reflectometry, multipin Langmuir probe (MLP) and heavy ion beam probe diagnostics. The reflectometry capabilities were analysed using 2D full-wave simulations and verified by direct comparison using a MLP. The ohmic and electron cyclotron resonance heated discharges show the distinct transition from the core turbulence, having complex spectral structure, to the unstructured one in the scrape-off layer. The core turbulence includes 'broad band, quasi-coherent' features, arising due to the excitation of rational surfaces with high poloidal m-numbers, with a low frequency near zero and specific oscillations at 15-30 kHz. All experimentally measured properties of low frequency and high frequency quasi-coherent oscillations are in good agreement with predictions of linear theory for the ion temperature gradient/dissipative trapped electron mode instabilities. Significant local changes in the turbulence characteristics were observed at the edge velocity shear layer and in the core near q = 1 radius after switching off the electron cyclotron resonance heating (ECRH). The local decrease in the electron heat conductivity and decrease in the turbulence level could be evidence of the formation of an electron internal transport barrier. The dynamic behaviour of the core turbulence was also investigated for the case of fast edge cooling and the beginning phase of ECRH

  20. Scaling CouchDB

    CERN Document Server

    Holt, Bradley

    2011-01-01

    This practical guide offers a short course on scaling CouchDB to meet the capacity needs of your distributed application. Through a series of scenario-based examples, this book lets you explore several methods for creating a system that can accommodate growth and meet expected demand. In the process, you learn about several tools that can help you with replication, load balancing, clustering, and load testing and monitoring. Apply performance tips for tuning your databaseReplicate data, using Futon and CouchDB's RESTful interfaceDistribute CouchDB's workload through load balancingLearn option

  1. dbSNP

    Data.gov (United States)

    U.S. Department of Health & Human Services — dbSNP is a database of single nucleotide polymorphisms (SNPs) and multiple small-scale variations that include insertions/deletions, microsatellites, and...

  2. dbVar

    Data.gov (United States)

    U.S. Department of Health & Human Services — dbVar is a database of genomic structural variation. It accepts data from all species and includes clinical data. It can accept diverse types of events, including...

  3. Scaling MongoDB

    CERN Document Server

    Chodorow, Kristina

    2011-01-01

    Create a MongoDB cluster that will to grow to meet the needs of your application. With this short and concise book, you'll get guidelines for setting up and using clusters to store a large volume of data, and learn how to access the data efficiently. In the process, you'll understand how to make your application work with a distributed database system. Scaling MongoDB will help you: Set up a MongoDB cluster through shardingWork with a cluster to query and update dataOperate, monitor, and backup your clusterPlan your application to deal with outages By following the advice in this book, you'l

  4. XMetDB

    DEFF Research Database (Denmark)

    Spjuth, Ola; Rydberg, Patrik; Willighagen, Egon L

    2016-01-01

    Xenobiotic metabolism is an active research topic but the limited amount of openly available high-quality biotransformation data constrains predictive modeling. Current database often default to commonly available information: which enzyme metabolizes a compound, but neither experimental conditions...... nor the atoms that undergo metabolization are captured. We present XMetDB, an open access database for drugs and other xenobiotics and their respective metabolites. The database contains chemical structures of xenobiotic biotransformations with substrate atoms annotated as reaction centra...... is also available. The database is open for data deposition, and a curation scheme is in place for quality control. An extensive guide on how to enter experimental data into is available from the XMetDB wiki. XMetDB formalizes how biotransformation data should be reported, and the openly available...

  5. MELCOR DB Construction for the Severe Accident Analysis DB

    International Nuclear Information System (INIS)

    Song, Y. M.; Ahn, K. I.

    2011-01-01

    The Korea Atomic Energy Research Institute (KAERI) has been constructing a severe accident analysis database (DB) under a National Nuclear R and D Program. In particular, an MAAP (commercial code being widely used in industries for integrated severe accident analysis) DB for many scenarios including a station blackout (SBO) has been completed. This paper shows the MELCOR DB construction process with examples of SBO scenarios, and the results will be used for a comparison with the MAAP DB

  6. ProteomicsDB.

    Science.gov (United States)

    Schmidt, Tobias; Samaras, Patroklos; Frejno, Martin; Gessulat, Siegfried; Barnert, Maximilian; Kienegger, Harald; Krcmar, Helmut; Schlegl, Judith; Ehrlich, Hans-Christian; Aiche, Stephan; Kuster, Bernhard; Wilhelm, Mathias

    2018-01-04

    ProteomicsDB (https://www.ProteomicsDB.org) is a protein-centric in-memory database for the exploration of large collections of quantitative mass spectrometry-based proteomics data. ProteomicsDB was first released in 2014 to enable the interactive exploration of the first draft of the human proteome. To date, it contains quantitative data from 78 projects totalling over 19k LC-MS/MS experiments. A standardized analysis pipeline enables comparisons between multiple datasets to facilitate the exploration of protein expression across hundreds of tissues, body fluids and cell lines. We recently extended the data model to enable the storage and integrated visualization of other quantitative omics data. This includes transcriptomics data from e.g. NCBI GEO, protein-protein interaction information from STRING, functional annotations from KEGG, drug-sensitivity/selectivity data from several public sources and reference mass spectra from the ProteomeTools project. The extended functionality transforms ProteomicsDB into a multi-purpose resource connecting quantification and meta-data for each protein. The rich user interface helps researchers to navigate all data sources in either a protein-centric or multi-protein-centric manner. Several options are available to download data manually, while our application programming interface enables accessing quantitative data systematically. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

  7. Comparisons of estimates of annual exceedance-probability discharges for small drainage basins in Iowa, based on data through water year 2013 : [summary].

    Science.gov (United States)

    2015-01-01

    Traditionally, the Iowa DOT has used the Iowa Runoff Chart and single-variable regional regression equations (RREs) from a USGS report : (published in 1987) as the primary methods to estimate annual exceedance-probability discharge : (AEPD) for small...

  8. MongoDB high availability

    CERN Document Server

    Mehrabani, Afshin

    2014-01-01

    This book has a perfect balance of concepts and their practical implementation along with solutions to make a highly available MongoDB server with clear instructions and guidance. If you are using MongoDB in a production environment and need a solution to make a highly available MongoDB server, this book is ideal for you. Familiarity with MongoDB is expected so that you understand the content of this book.

  9. A feasibility study of the provision of a personalized interdisciplinary audiovisual summary to facilitate care transfer care at hospital discharge: Care Transfer Video (CareTV).

    Science.gov (United States)

    Newnham, Harvey H; Gibbs, Harry H; Ritchie, Edward S; Hitchcock, Karen I; Nagalingam, Vathy; Hoiles, Andrew; Wallace, Ed; Georgeson, Elizabeth; Holton, Sara

    2015-04-01

    To assess the feasibility and patient acceptance of a personalized interdisciplinary audiovisual record to facilitate effective communication with patients, family, carers and other healthcare workers at hospital discharge. Descriptive pilot study utilizing a study-specific patient feedback questionnaire conducted from October 2013 to June 2014. Twenty General Medical inpatients being discharged from an Acute General Medical Ward in a metropolitan teaching hospital. Audiovisual record of a CareTV filmed at the patient's bedside by a consultant-led interdisciplinary team, within 24 h prior to discharge from the ward, provided immediately for the patient to take home. Patient surveys were completed within 2 weeks of discharge. Technical quality, utilization, acceptability, patient satisfaction and recall of diagnosis, medication changes and post-discharge review arrangements. All patients had watched their CareTV either alone or in the presence of a variety of others: close family, their GP, a medical specialist, friends or other health personnel. Participating patients had good understanding of the video content and recall of their diagnosis, medication changes and post-discharge plans. Patient feedback was overwhelmingly positive. In the context of a General Medical Unit with extensive experience in interdisciplinary bedside rounding and teamwork, CareTV is simple to implement, inexpensive, technically feasible, requires minimal staff training and is acceptable to patients. The results of this pilot study will inform and indicate the feasibility of conducting a larger randomized control trial of the impact of CareTV on patient satisfaction, medication adherence and recall of key information, and primary healthcare provider satisfaction. © The Author 2015. Published by Oxford University Press in association with the International Society for Quality in Health Care; all rights reserved.

  10. MariaDB cookbook

    CERN Document Server

    Bartholomew, Daniel

    2014-01-01

    A practical cookbook, filled with advanced recipes , and plenty of code and commands used for illustration,which will make your learning curve easy and quick.This book is for anyone who wants to learn more about databases in general or MariaDB in particular. Some familiarity with SQL databases is assumed, but the recipes are approachable to almost anyone with basic database skills.

  11. Pancreatitis - discharge

    Science.gov (United States)

    Chronic pancreatitis - discharge; Pancreatitis - chronic - discharge; Pancreatic insufficiency - discharge; Acute pancreatitis - discharge ... You were in the hospital because you have pancreatitis. This is a swelling of the pancreas. You ...

  12. Heart pacemaker - discharge

    Science.gov (United States)

    Cardiac pacemaker implantation - discharge; Artificial pacemaker - discharge; Permanent pacemaker - discharge; Internal pacemaker - discharge; Cardiac resynchronization therapy - discharge; CRT - discharge; ...

  13. RavenDB high performance

    CERN Document Server

    Ritchie, Brian

    2013-01-01

    RavenDB High Performance is comprehensive yet concise tutorial that developers can use to.This book is for developers & software architects who are designing systems in order to achieve high performance right from the start. A basic understanding of RavenDB is recommended, but not required. While the book focuses on advanced topics, it does not assume that the reader has a great deal of prior knowledge of working with RavenDB.

  14. Nipple Discharge

    Science.gov (United States)

    ... any unexpected nipple discharge evaluated by a doctor. Nipple discharge in men under any circumstances could be a problem and needs further evaluation. One or both breasts may produce a nipple discharge, either spontaneously or when you squeeze your ...

  15. MongoDB and PHP

    CERN Document Server

    Francia, Steve

    2012-01-01

    What would happen if you optimized a data store for the operations application developers actually use? You'd arrive at MongoDB, the reliable document-oriented database. With this concise guide, you'll learn how to build elegant database applications with MongoDB and PHP. Written by the Chief Solutions Architect at 10gen-the company that develops and supports this open source database-this book takes you through MongoDB basics such as queries, read-write operations, and administration, and then dives into MapReduce, sharding, and other advanced topics. Get out of the relational database rut,

  16. DB Energie 2020. Implementation of sustainability strategy DB2020; DB Energie 2020. Die Umsetzung der Nachhaltigkeitsstrategie DB2020

    Energy Technology Data Exchange (ETDEWEB)

    Witschke, Hans-Juergen [DB Energie GmbH, Frankfurt am Main (Germany)

    2013-06-15

    As a worldwide provider of mobility and logistics services and one of the biggest employers in Germany, Deutsche Bahn (DB) bears a special responsibility for customers, its own staff, the environment and society as a whole. In order to meet this responsibility, it has made the consistent implementation of the DB Energie 2020 sustainability concept an essential element of its business strategy. Following this line of business provides DB with good opportunities on the one hand but also carries risks and challenges on the other. (orig.)

  17. Shoulder replacement - discharge

    Science.gov (United States)

    Total shoulder arthroplasty - discharge; Endoprosthetic shoulder replacement - discharge; Partial shoulder replacement - discharge; Partial shoulder arthroplasty - discharge; Replacement - shoulder - discharge; Arthroplasty - shoulder - discharge

  18. Alkannin Inhibited Hepatic Inflammation in Diabetic Db/Db Mice

    Directory of Open Access Journals (Sweden)

    Wenhua Xue

    2018-03-01

    Full Text Available Background/Aims: The current study was designed to investigate the protective role of alkannin (ALK on liver injury in diabetic C57BL/KsJ-db/db mice and explore its potential mechanisms. Methods: An oral glucose tolerance test (OGTT was performed. The levels of insulin, alanine aminotransferase (ALT, aspartate aminotransaminase (AST, total cholesterol (TC and triglyceride (TG were determined by commercial kits. The pro-inflammatory cytokines interleukin (IL-1β, IL-6 and tumour necrosis factor (TNF-α were determined by ELISA. The levels of the ROCK/NF-κB pathway were determined by Western blotting. Results: The contents of pro-inflammatory cytokines interleukin (IL-1β, IL-6 and tumour necrosis factor (TNF-α were inhibited by ALK, metformin or fasudil in diabetic db/db mice. Further, Western blotting analysis showed that the expression of Rho, ROCK1, ROCK2, p-NF-κBp65, and p-IκBα was significantly reversed by ALK treatment. In human hepatic HepG2 cells, the hepatoprotective effects of ALK were further characterized. With response to palmitic acid-challenge, increased amounts of insulin, ALT, AST, TG, and TC were observed, whereas ALK pretreatment significantly inhibited their leakage in HepG2 cells without appreciable cytotoxic effects. The inflammation condition was recovered with ALK treatment as shown by changes of IL-1β, IL-6 and TNF-α. Further, Western blotting analysis also suggested that ALK improves hepatic inflammation in a Rho-kinase pathway. Conclusion: The present study successfully investigated the role of Rho-kinase signalling in diabetic liver injury. ALK exhibited hepatoprotective effects in diabetic db/db mice, and it might act through improving hepatic inflammation through the Rho-kinase pathway.

  19. Dicty_cDB: SLJ310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5' similar to Arabidopsis thaliana sequence At1g48030 lipoamide dehydrogenase precursor see http://mips... At1g48030 lipoamide dehydrogenase precursor see http://mips.gsf.de/proj/thal/db/index.html, mRNA sequence.

  20. Basalt aquifer identification, correlation and sampling activities. History of Wells DB-8, DB-9, DB-10 and DB-11

    International Nuclear Information System (INIS)

    Webster, C.T.

    1979-07-01

    Research core wells have been completed to assist in the characterization of the groundwater regime of the upper confined aquifers found within the basalts of the Hanford Site. These wells were drilled on the Hanford Site for the Long-Term Transuranic Defense Waste Program. They were constructed to assure the Department of Energy that waste management operations will not provide an avenue for offsite migration of radionuclides. This second report details results of confined aquifer drilling activities. The purpose of this report is to document the drilling history of the wells by presenting as-built well construction diagrams and tables listing hole history data, coring records and bit records. Four wells were cored to a maximum depth of 1100 feet and water samples were taken from selected confined aquifers. Full depth was reached on all wells and core recovery was 94% of all formations drilled. Well DB-8 was abandoned after a well screen was destroyed while setting it in the well. Two wells, DB-9 and DB-10 were screened in the Mabton interbed and water was produced from this interval in both wells. Well DB-11 was used to explore for artesian water from the Priest Rapids flow unit on the western edge of the Hanford Site. The water was found at a depth of 1045 feet and now produces makeup water for all Hanford drilling

  1. Mergeable summaries

    DEFF Research Database (Denmark)

    Agarwal, Pankaj K.; Graham, Graham; Huang, Zengfeng

    2013-01-01

    We study the mergeability of data summaries. Informally speaking, mergeability requires that, given two summaries on two datasets, there is a way to merge the two summaries into a single summary on the two datasets combined together, while preserving the error and size guarantees. This property m...

  2. NIPPLE DISCHARGE

    Directory of Open Access Journals (Sweden)

    T. N. Bukharova

    2008-01-01

    Full Text Available According to the data available in the literature, as high as 50% of women have benign breast tumors frequently accompanied by nip- ple discharge. Nipple discharge may be serous, bloody, purulent, and colostric. The most common causes are breast abscess, injury, drugs, prolactinoma, intraductal pappiloma, ductal ectasia, intraductal cancer (not more than 10%.

  3. The IRPVM-DB database

    International Nuclear Information System (INIS)

    Davies, L.M.; Gillemot, F.; Yanko, L.; Lyssakov, V.

    1997-01-01

    The IRPVM-DB (International Reactor Pressure Vessel Material Database) initiated by the IAEA IWG LMNPP is going to collect the available surveillance and research data world-wide on RPV material ageing. This paper presents the purpose of the database; it summarizes the type and the relationship of data included; it gives information about the data access and protection; and finally, it summarizes the state of art of the database. (author). 1 ref., 2 figs

  4. The IRPVM-DB database

    Energy Technology Data Exchange (ETDEWEB)

    Davies, L M [Davies Consultants, Oxford (United Kingdom); Gillemot, F [Atomic Energy Research Inst., Budapest (Hungary); Yanko, L [Minatom (Russian Federation); Lyssakov, V [International Atomic Energy Agency, Vienna (Austria)

    1997-09-01

    The IRPVM-DB (International Reactor Pressure Vessel Material Database) initiated by the IAEA IWG LMNPP is going to collect the available surveillance and research data world-wide on RPV material ageing. This paper presents the purpose of the database; it summarizes the type and the relationship of data included; it gives information about the data access and protection; and finally, it summarizes the state of art of the database. (author). 1 ref., 2 figs.

  5. Ileostomy - discharge

    Science.gov (United States)

    ... dried fruits (such as raisins), mushrooms, chunky relishes, coconut, and some Chinese vegetables. Tips for when no ... ask your doctor Living with your ileostomy Low-fiber diet Small bowel resection - discharge Total colectomy or ...

  6. Discharge Dialogue

    DEFF Research Database (Denmark)

    Horsbøl, Anders

    2012-01-01

    For several years, efforts have been made to strengthen collaboration between health professionals with different specializations and to improve patient transition from hospital to home (care). In the Danish health care system, these efforts have concentrated on cancer and heart diseases, whereas...... coordinator, employed at the hospital, is supposed to anticipate discharge and serve as mediator between the hospital and the municipal home care system. Drawing on methods from discourse and interaction analysis, the paper studies the practice of the discharge coordinator in two encounters between patients...... how the home context provides different resources for identification of patient needs and mutual decision making....

  7. Getting started with MariaDB

    CERN Document Server

    Bartholomew, Daniel

    2013-01-01

    A practical, hands-on, beginner-friendly guide to installing and using MariaDB.Getting Started with MariaDB is for anyone who wants to learn more about databases in general or MariaDB in particular. No prior database experience is required. It is assumed that you have basic knowledge of software installation, editing files with a text editor, and using the command line and terminal.

  8. CouchDB the definitive guide

    CERN Document Server

    Anderson, J; Slater, Noah

    2010-01-01

    Three of CouchDB's creators show you how to use this document-oriented database as a standalone application framework or with high-volume, distributed applications. With its simple model for storing, processing, and accessing data, CouchDB is ideal for web applications that handle huge amounts of loosely structured data. That alone would stretch the limits of a relational database, yet CouchDB offers an open source solution that's reliable, scales easily, and responds quickly. CouchDB works with self-contained data that has loose or ad-hoc connections. It's a model that fits many real-world

  9. Exendin-4 improves resistance to Listeria monocytogenes infection in diabetic db/db mice

    OpenAIRE

    Liu, Hsien Yueh; Chung, Chih-Yao; Yang, Wen-Chin; Liang, Chih-Lung; Wang, Chi-Young; Chang, Chih-Yu; Chang, Cicero Lee-Tian

    2012-01-01

    The incidence of diabetes mellitus is increasing among companion animals. This disease has similar characteristics in both humans and animals. Diabetes is frequently identified as an independent risk factor for infections associated with increased mortality. In the present study, homozygous diabetic (db/db) mice were infected with Listeria (L.) monocytogenes and then treated with the anti-diabetic drug exendin-4, a glucagon-like peptide 1 analogue. In aged db/db mice, decreased CD11b+ macroph...

  10. RefDB: The Reference Database for CMS Monte Carlo Production

    CERN Document Server

    Lefébure, V

    2003-01-01

    RefDB is the CMS Monte Carlo Reference Database. It is used for recording and managing all details of physics simulation, reconstruction and analysis requests, for coordinating task assignments to world-wide distributed Regional Centers, Grid-enabled or not, and trace their progress rate. RefDB is also the central database that the workflow-planner contacts in order to get task instructions. It is automatically and asynchronously updated with book-keeping run summaries. Finally it is the end-user interface to data catalogues.

  11. Portulaca oleracea Ameliorates Diabetic Vascular Inflammation and Endothelial Dysfunction in db/db Mice

    Science.gov (United States)

    Lee, An Sook; Lee, Yun Jung; Lee, So Min; Yoon, Jung Joo; Kim, Jin Sook; Kang, Dae Gill; Lee, Ho Sub

    2012-01-01

    Type 2 diabetes is associated with significantly accelerated rates of micro- and macrovascular complications such as diabetic vascular inflammation and endothelial dysfunction. In the present study, we investigated the protective effect of the aqueous extract of Portulaca oleracea L. (AP), an edible plant used as a folk medicine, on diabetic vascular complications. The db/db mice were treated with AP (300 mg/kg/day, p.o.) for 10 weeks, and AP treatment markedly lowered blood glucose, plasma triglyceride, plasma level of LDL-cholesterol, and systolic blood pressure in diabetic db/db mice. Furthermore, AP significantly increased plasma level of HDL-cholesterol and insulin level. The impairment of ACh- and SNP-induced vascular relaxation of aortic rings were ameliorated by AP treatment in diabetic db/db mice. This study also showed that overexpression of VCAM-1, ICAM-1, E-selectin, MMP-2, and ET-1 were observed in aortic tissues of untreated db/db mice, which were significantly suppressed by treatment with AP. We also found that the insulin immunoreactivity of the pancreatic islets remarkably increased in AP treated db/db mice compared with untreated db/db mice. Taken together, AP suppresses hyperglycemia and diabetic vascular inflammation, and prevents the development of diabetic endothelial dysfunction for the development of diabetes and its vascular complications. PMID:22474522

  12. Antidiabetic and Antiobesity Effects of Artemether in db/db Mice

    Directory of Open Access Journals (Sweden)

    Yu Guo

    2018-01-01

    Full Text Available This study is designed to investigate the effect of artemether on type 2 diabetic db/db mice. The experiments consisted of three groups: normal control (NC, db/+, 1% methylcellulose, intragastric administration, diabetic control (DM, db/db, 1% methylcellulose, intragastric administration, and artemether treated (artemether, db/db, 200 mg/kg of artemether, intragastric administration. The treatment lasted for two weeks. The food intake, body weight, and fasting blood glucose of mice were measured every three days. At the start and end of the experiment, the intraperitoneal glucose tolerance test (IPGTT and insulin tolerance test (IPITT were performed. We determined the serum insulin and glucagon levels by ELISA kits and calculated insulin resistance index (HOME-IR. HE staining was used to observe the morphologies of pancreas and liver in mice. The damage of pancreatic beta cells was evaluated by TUNEL staining and immunofluorescence. We found the following: (1 compared with the DM group, the food intake and weight increase rate of artemether group significantly reduced (P<0.05; (2 compared with pretreatment, artemether significantly reduced the fasting blood glucose levels, and the areas under the curves (AUCs of IPGTT were decreased significantly, increasing the tolerance to glucose of db/db mice. (P<0.05; (3 artemether improved hyperinsulinemia and decreased the AUCs of IPITT and HOME-IR, increasing the insulin sensitivity of db/db mice. (4 Artemether significantly ameliorated islet vacuolar degeneration and hepatic steatosis in db/db mice. (5 Artemether reduced the apoptosis of pancreatic beta cells and increased insulin secretion in db/db mice compared with DM group (P<0.05. Our results indicated that artemether significantly improved glucose homeostasis and insulin resistance and had the potential activity to prevent obesity, reduced the severity of fatty liver, and protected pancreatic beta cells, promising to treat type 2 diabetes.

  13. Angioplasty and stent - heart - discharge

    Science.gov (United States)

    Drug-eluting stents - discharge; PCI - discharge; Percutaneous coronary intervention - discharge; Balloon angioplasty - discharge; Coronary angioplasty - discharge; Coronary artery angioplasty - discharge; Cardiac ...

  14. Radiological discharges

    International Nuclear Information System (INIS)

    Woodliffe, J.

    1990-01-01

    Current practice of North Sea States on the discharge and disposal of liquid radioactive wastes to the North Sea are based on the declaration issued at the Second International Conference on the Protection of the North Sea, known as the London Declaration. This has three main points the first of which emphasises the application of the Best Available Technology to protect the North Sea, the second provides a framework on which future controls on radioactive discharges should be based. The third identifies two parts of the framework; to take into account the recommendations of international organizations and that any repositories of radioactive waste which are built should not pollute the North Sea. This chapter looks at how the concensus based on the London Declaration is working, gauges the progress made in the implementation of the policy goal, identifies existing and future areas for concern and proposes ways of strengthening the control of radioactive discharges. The emphasis is on the United Kingdom practice and regulations for liquid wastes, most of which comes from the Sellafield Reprocessing Plant. (author)

  15. IBM DB2 97 Advanced Administration Cookbook

    CERN Document Server

    Neagu, Adrian

    2012-01-01

    This cookbook has recipes written in a simple, easy to understand format, with lots of screenshots and insightful tips and hints. If you are a DB2 Database Administrator who wants to understand and get hands on with the underlying aspects of database administration, then this book is for you. This book assumes that you have a basic understanding of DB2 database concepts.

  16. Getting started with OrientDB

    CERN Document Server

    Tesoriero, Claudio

    2013-01-01

    A standard tutorial aimed at making you an OrientDB expert, through the use of practical examples, explained in a step-by-step format.Getting Started with OrientDB 1.3.0 is great for database designers, developers, and systems engineers. It is assumed that you are familiar with NoSQL concepts, Java, and networking principles.

  17. Decommissioning Facility Characterization DB System

    International Nuclear Information System (INIS)

    Park, S. K.; Ji, Y. H.; Park, J. H.; Chung, U. S.

    2010-01-01

    Basically, when a decommissioning is planed for a nuclear facility, an investigation into the characterization of the nuclear facility is first required. The results of such an investigation are used for calculating the quantities of dismantled waste and estimating the cost of the decommissioning project. In this paper, it is presented a computer system for the characterization of nuclear facilities, called DEFACS (DEcommissioning FAcility Characterization DB System). This system consists of four main parts: a management coding system for grouping items, a data input system, a data processing system and a data output system. All data is processed in a simplified and formatted manner in order to provide useful information to the decommissioning planner. For the hardware, PC grade computers running Oracle software on Microsoft Windows OS were selected. The characterization data results for the nuclear facility under decommissioning will be utilized for the work-unit productivity calculation system and decommissioning engineering system as basic sources of information

  18. Decommissioning Facility Characterization DB System

    Energy Technology Data Exchange (ETDEWEB)

    Park, S. K.; Ji, Y. H.; Park, J. H.; Chung, U. S. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2010-10-15

    Basically, when a decommissioning is planed for a nuclear facility, an investigation into the characterization of the nuclear facility is first required. The results of such an investigation are used for calculating the quantities of dismantled waste and estimating the cost of the decommissioning project. In this paper, it is presented a computer system for the characterization of nuclear facilities, called DEFACS (DEcommissioning FAcility Characterization DB System). This system consists of four main parts: a management coding system for grouping items, a data input system, a data processing system and a data output system. All data is processed in a simplified and formatted manner in order to provide useful information to the decommissioning planner. For the hardware, PC grade computers running Oracle software on Microsoft Windows OS were selected. The characterization data results for the nuclear facility under decommissioning will be utilized for the work-unit productivity calculation system and decommissioning engineering system as basic sources of information

  19. Research Summaries

    Science.gov (United States)

    Brock, Stephen E., Ed.

    2011-01-01

    This article presents summaries of three articles relevant to school crisis response: (1) "Factors Contributing to Posttraumatic Growth," summarized by Steve DeBlois; (2) "Psychological Debriefing in Cross-Cultural Contexts" (Stacey Rice); and (3) "Brain Abnormalities in PTSD" (Sunny Windingstad). The first summary reports the findings of a…

  20. Hysterectomy - vaginal - discharge

    Science.gov (United States)

    Vaginal hysterectomy - discharge; Laparoscopically assisted vaginal hysterectomy - discharge; LAVH - discharge ... you were in the hospital, you had a vaginal hysterectomy. Your surgeon made a cut in your ...

  1. Ultrasonographic Characterization of the db/db Mouse: An Animal Model of Metabolic Abnormalities

    Directory of Open Access Journals (Sweden)

    Francesco Faita

    2018-01-01

    Full Text Available The availability of an animal model able to reliably mirror organ damage occurring in metabolic diseases is an urgent need. These models, mostly rodents, have not been fully characterized in terms of cardiovascular, renal, and hepatic ultrasound parameters, and only sparse values can be found in literature. Aim of this paper is to provide a detailed, noninvasive description of the heart, vessels, liver, and kidneys of the db/db mouse by ultrasound imaging. Sixteen wild type and thirty-four db/db male mice (11-week-old were studied. State-of-the-art ultrasound technology was used to acquire images of cardiovascular, renal, and hepatic districts. A set of parameters describing function of the selected organs was evaluated. db/db mice are characterized by systolic and diastolic dysfunction, confirmed by strain analysis. Abdominal aortic and carotid stiffness do not seem to be increased in diabetic rodents; furthermore, they are characterized by a smaller mean diameter for both vessels. Renal microcirculation is significantly compromised, while liver steatosis is only slightly higher in db/db mice than in controls. We offer here for the first time an in vivo detailed ultrasonographic characterization of the db/db mouse, providing a useful tool for a thoughtful choice of the right rodent model for any experimental design.

  2. MongoDB the definitive guide

    CERN Document Server

    Chodorow, Kristina

    2010-01-01

    How does MongoDB help you manage a huMONGOus amount of data collected through your web application? With this authoritative introduction, you'll learn the many advantages of using document-oriented databases, and discover why MongoDB is a reliable, high-performance system that allows for almost infinite horizontal scalability. Written by engineers from 10gen, the company that develops and supports this open source database, MongoDB: The Definitive Guide provides guidance for database developers, advanced configuration for system administrators, and an overview of the concepts and use cases f

  3. Meteorological Summaries

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Multi-year summaries of one or more meteorological elements at a station or in a state. Primarily includes Form 1078, a United States Weather Bureau form designed...

  4. Survey Summary

    Data.gov (United States)

    U.S. Department of Health & Human Services — Nursing home summary information for the Health and Fire Safety Inspections currently listed on Nursing Home Compare, including dates of the three most recent...

  5. Lung surgery - discharge

    Science.gov (United States)

    ... Lung biopsy - discharge; Thoracoscopy - discharge; Video-assisted thoracoscopic surgery - discharge; VATS - discharge ... milk) for 2 weeks after video-assisted thoracoscopic surgery and 6 to 8 weeks after open surgery. ...

  6. Pediatric heart surgery - discharge

    Science.gov (United States)

    ... discharge; Heart valve surgery - children - discharge; Heart surgery - pediatric - discharge; Heart transplant - pediatric - discharge ... Geme JW, Schor NF, eds. Nelson Textbook of Pediatrics . 20th ed. Philadelphia, PA: Elsevier; 2016:chap 434. ...

  7. Getting Started with CouchDB

    CERN Document Server

    Brown, MC

    2012-01-01

    CouchDB is a new breed of database for the Internet, geared to meet the needs of today's dynamic web applications. With this concise introduction, you'll learn how CouchDB's simple model for storing, processing, and accessing data makes it ideal for the type of data and rapid response users now demand from your applications-and how easy CouchDB is to set up, deploy, maintain, and scale. The code-packed examples in this book will help you learn how to work with documents, populate a simple database, replicate data from one database to another, and a host of other tasks. Install CouchDB on Lin

  8. Discharge Planning in Chronic Conditions

    Science.gov (United States)

    McMartin, K

    2013-01-01

    effective at improving HRQOL or patient satisfaction. Compared with usual care, there was low quality evidence that the discharge planning plus postdischarge support is more effective at reducing readmissions but not more effective at reducing hospital LOS or mortality. There was very low quality evidence that it is more effective at improving HRQOL or patient satisfaction. Plain Language Summary Chronically ill people experience frequent changes in their health status and multiple transitions between care settings and care providers (e.g., hospital to home). Discharge planning provides support services, follow-up activities and other interventions that span pre-hospital discharge to post-hospital settings. A review of the effects of different discharge plans was conducted. After searching for relevant studies, 11 studies were found that compared discharge planning with routine discharge care. This review indicates that: Individualized discharge planning reduces initial hospital length of stay and subsequent readmission to hospital but does not reduce mortality. The effect on health-related quality of life (HRQOL) or patient satisfaction is uncertain. Discharge planning plus postdischarge support reduces readmissions but does not reduce the initial hospital length of stay or mortality after discharge. The effect on HRQOL or patient satisfaction is uncertain. PMID:24167538

  9. Proteases in Plasma and Kidney of db/db Mice as Markers of Diabetes-Induced Nephropathy

    Science.gov (United States)

    Hadler-Olsen, E.; Winberg, J.-O.; Reinholt, F. P.; Larsen, T.; Uhlin-Hansen, L.; Jenssen, T.; Berg, E.; Kolset, S. O.

    2011-01-01

    Db/db mice are overweight, dyslipidemic and develop diabetic complications, relevant for similar complications in human type 2 diabetes. We have used db/db and db/+ control mice to investigate alterations in proteinase expression and activity in circulation and kidneys by SDS-PAGE zymography, electron microscopy, immunohistochemistry, Western blotting, and in situ zymography. Plasma from db/db mice contained larger amounts of serine proteinases compared to db/+ mice. Kidneys from the db/db mice had a significantly larger glomerular surface area and somewhat thicker glomerular basement membranes compared to the db/+ mice. Furthermore, kidney extracts from db/+ mice contained metalloproteinases with M r of approximately 92000, compatible with MMP-9, not observed in db/db mice. These results indicate that higher levels of serine proteinases in plasma may serve as potential markers for kidney changes in db/db mice, whereas a decrease in MMP-9 in the kidney may be related to the glomerular changes. PMID:22363890

  10. Efficacy of Acetylshikonin in Preventing Obesity and Hepatic Steatosis in db/db Mice

    Directory of Open Access Journals (Sweden)

    Mei-Ling Su

    2016-07-01

    Full Text Available Zicao (Lithospermum erythrorhizon has been used in clinics as a traditional Chinese medicine for thousands of years. Acetylshikonin (AS is the main ingredient of Zicao, Xinjiang, China. The objective of this study was to investigate the anti-obesity and anti-nonalcoholic fatty liver disease (NAFLD efficacy of AS in a model of spontaneous obese db/db mice. Mice were divided into Wild Type (WT groups and db/db groups, which received no treatment or treatment with 100 mg/kg/day clenbuterol (CL hydrochloride or 540 mg/kg/day AS by oral gavage for eight weeks. The results provided the evidence that AS prevented obesity and NAFLD including reduction in body weight, food efficiency ratio, serum triglyceride (TG and free fatty acid (FFA levels in db/db mice. Administration of AS markedly suppressed the levels of hepatic alanine aminotransferase (ALT, aspartate aminotransferase (AST and pro-inflammatory cytokines in treated groups when compared with that of db/db groups. Further investigation of the lipid synthesis-related protein using Western blotting revealed that hepatic protein expression of sterol regulatory element-binding protein-1 (SREBP-1, fatty acid synthetase (FAS and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR were significantly downregulated by AS treatment. These findings suggest that AS exerts anti-obesity and anti-NAFLD effects through the regulation of lipid metabolism and anti-inflammatory effects.

  11. Research Summaries

    Science.gov (United States)

    Brock, Stephen E., Ed.

    2010-01-01

    This column features summaries of research articles from 3 recent crisis management publications. The first, "School Shootings and Counselor Leadership: Four Lessons from the Field" summarized by Kristi Fenning, was conducted as the result of the increased demand for trained crisis personnel on school campuses. Survey participants were…

  12. Conference summaries

    International Nuclear Information System (INIS)

    1986-01-01

    This volume contains conference summaries of the international conference on radioactive waste management of the Canadian Nuclear Society. Topics of discussion include: storage and disposal; hydrogeology and geochemistry; transportation; buffers and backfill; public attitudes; tailings; site investigations and geomechanics; concrete; economics; licensing; matrix materials and container design; durability of fuel; biosphere modelling; radioactive waste processing; and, future options

  13. Executive summary

    NARCIS (Netherlands)

    van Nimwegen, N.; van Nimwegen, N.; van der Erf, R.

    2009-01-01

    The Demography Monitor 2008 gives a concise overview of current demographic trends and related developments in education, the labour market and retirement for the European Union and some other countries. This executive summary highlights the major findings of the Demography Monitor 2008 and further

  14. Validity of leptin receptor-deficiency (db/db) type 2 diabetes mellitus mice as a model of secondary osteoporosis

    Science.gov (United States)

    Huang, Le; You, Yong-Ke; Zhu, Tracy Y.; Zheng, Li-Zhen; Huang, Xiao-Ru; Chen, Hai-Yong; Yao, Dong; Lan, Hui-Yao; Qin, Ling

    2016-06-01

    This study aimed to evaluate the validation of the leptin receptor-deficient mice model for secondary osteoporosis associated with type 2 diabetes mellitus (T2DM) at bone micro-architectural level. Thirty three 36-week old male mice were divided into four groups: normal control (db/m) (n = 7), leptin receptor-deficient T2DM (db/db) (n = 8), human C-reactive protein (CRP) transgenic normal control (crp/db/m) (n = 7), and human CRP transgenic T2DM (crp/db/db) (n = 11). Lumber vertebrae (L5) and bilateral lower limbs were scanned by micro-CT to analyze trabecular and cortical bone quality. Right femora were used for three-point bending to analyze the mechanical properties. Trabecular bone quality at L5 was better in db/db or crp/db/db group in terms of bone mineral density (BMD), bone volume fraction, connectivity density, trabecular number and separation (all p  0.05). Maximum loading and energy yield in mechanical test were similar among groups while the elastic modulus in db/db and crp/db/db significantly lower than db/m. The leptin-receptor mice is not a proper model for secondary osteoporosis associated with T2DM.

  15. Zinc Prevents the Development of Diabetic Cardiomyopathy in db/db Mice

    Directory of Open Access Journals (Sweden)

    Shudong Wang

    2017-03-01

    Full Text Available Diabetic cardiomyopathy (DCM is highly prevalent in type 2 diabetes (T2DM patients. Zinc is an important essential trace metal, whose deficiency is associated with various chronic ailments, including vascular diseases. We assessed T2DM B6.BKS(D-Leprdb/J (db/db mice fed for six months on a normal diet containing three zinc levels (deficient, adequate, and supplemented, to explore the role of zinc in DCM development and progression. Cardiac function, reflected by ejection fraction, was significantly decreased, along with increased left ventricle mass and heart weight to tibial length ratio, in db/db mice. As a molecular cardiac hypertrophy marker, atrial natriuretic peptide levels were also significantly increased. Cardiac dysfunction and hypertrophy were accompanied by significantly increased fibrotic (elevated collagen accumulation as well as transforming growth factor β and connective tissue growth factor levels and inflammatory (enhanced expression of tumor necrosis factor alpha, interleukin-1β, caspase recruitment domain family member 9, and B-cell lymphoma/leukemia 10, and activated p38 mitogen-activated protein kinase responses in the heart. All these diabetic effects were exacerbated by zinc deficiency, and not affected by zinc supplementation, respectively. Mechanistically, oxidative stress and damage, mirrored by the accumulation of 3-nitrotyrosine and 4-hydroxy-2-nonenal, was significantly increased along with significantly decreased expression of Nrf2 and its downstream antioxidants (NQO-1 and catalase. This was also exacerbated by zinc deficiency in the db/db mouse heart. These results suggested that zinc deficiency promotes the development and progression of DCM in T2DM db/db mice. The exacerbated effects by zinc deficiency on the heart of db/db mice may be related to further suppression of Nrf2 expression and function.

  16. Impact of Pharmacist Facilitated Discharge Medication Reconciliation

    Directory of Open Access Journals (Sweden)

    Todd M. Super

    2014-07-01

    Full Text Available Preventable adverse drug events occur frequently at transitions in care and are a problem for many patients following hospital discharge. Many of these problems can be attributed to poor medication reconciliation. The purpose of this study was to assess the impact that direct pharmacist involvement in the discharge medication reconciliation process had on medication discrepancies, patient outcomes, and satisfaction. A cohort study of 70 patients was designed to assess the impact of pharmacist facilitated discharge medication reconciliation at a 204-bed community hospital in Battle Creek, Michigan, USA. Discharge summaries were analyzed to compare patients who received standard discharge without pharmacist involvement to those having pharmacist involvement. The total number of discrepancies in the group without pharmacist involvement was significantly higher than that of the pharmacist facilitated group.

  17. Getting started with LevelDB

    CERN Document Server

    Dent, Andy

    2013-01-01

    The book is a concise guide for using LevelDB. It explains database concepts and the use of C++, ranging from the basics all the way to high level topics in an easy to follow, step-by-step format.The book is meant for developers who want an embedded database for their applications. Experienced programmers can pick up on the sophisticated data mapping patterns and tuning tips.Getting Started with LevelDB requires a minimal background in programming in C++ or Objective-C for OS/X or iOS and familiarity with XCode. Therefore it teaches enough C++ to use LevelDB without presuming any C++ knowledge

  18. Tennis elbow surgery - discharge

    Science.gov (United States)

    ... epicondylitis surgery - discharge; Lateral tendinosis surgery - discharge; Lateral tennis elbow surgery - discharge ... long as you are told. This helps ensure tennis elbow will not return. You may be prescribed a ...

  19. Ankle replacement - discharge

    Science.gov (United States)

    ... total - discharge; Total ankle arthroplasty - discharge; Endoprosthetic ankle replacement - discharge; Osteoarthritis - ankle ... You had an ankle replacement. Your surgeon removed and reshaped ... an artificial ankle joint. You received pain medicine and were ...

  20. Hip fracture - discharge

    Science.gov (United States)

    ... neck fracture repair - discharge; Trochanteric fracture repair - discharge; Hip pinning surgery - discharge ... in the hospital for surgery to repair a hip fracture, a break in the upper part of ...

  1. Asthma - child - discharge

    Science.gov (United States)

    Pediatric asthma - discharge; Wheezing - discharge; Reactive airway disease - discharge ... Your child has asthma , which causes the airways of the lungs to swell and narrow. In the hospital, the doctors and nurses helped ...

  2. Conference Summary

    International Nuclear Information System (INIS)

    Tinkham, M.

    1991-01-01

    This summary will begin with short remarks, trying to recall some of the spirit of the presentations of each of the speakers during the first day, with no attempt at detail or completeness, given the need for a 20:1 compression relative to the original talk. The author hopes these idiosyncratic recollections do not infuriate the speakers too much. Since the speakers on the second day presented such interlocking topics, he simply tries to present some sort of consensus report, to which he adds some comments of his own. The two talks preceding this Summary on the final day dealt with the prospects for applications; since he had no chance to attempt to prepare a proper report on these, he says only a few words about those presentations

  3. Conference summaries

    International Nuclear Information System (INIS)

    1987-01-01

    This volume contains summaries of 28 papers presented at the 27. conference of the Canadian Nuclear Association. These papers discuss the general situation of the Canadian nuclear industry and the CANDU reactor; dialogue with the public; the International Atomic Energy Agency; and economic goals and operating lessons. It also contains summaries of 70 papers presented at the 8. conference of the Canadian Nuclear Society, which discuss plant life extension; safety and the environment; reactor physics; thermalhydraulics; risk assessment; the CANDU spacer location and repositioning project; CANDU operations; safety research after Chernobyl; fuel channels; and nuclear technology developments. The individual papers are also available in INIS-mf--13673 (CNA), and INIS-mf--12909 (CNS). (L.L.)

  4. Summary talk

    International Nuclear Information System (INIS)

    Harari, H.

    1978-10-01

    A general overview is given in this high energy physics conference summary. Quantum chromodynamics as a theory of strong interactions and studied by experimental tests, SU(2) x U(1) theory of weak and electromagnetic interactions and its experimental tests, weak interactions above 100 GeV, simple unification of weak and electromagnetic interactions, and the grand and the ultimate unifications with extended supergravity are discussed. 28 references

  5. Summary talk

    International Nuclear Information System (INIS)

    Johnson, R.C.

    1981-01-01

    In this summary talk some implications of points raised during the Daresbury Study Weekend on heavy-ion reactions are examined and discussed in particular those concerning polarized heavy ions, the connection between analyzing powers and dynamics, transfer reactions, total reaction cross section measurements with polarized beams, and the implications of break-up reaction results for theories of nuclear reactions involving loosely bound projectiles. (U.K.)

  6. Conference summaries

    International Nuclear Information System (INIS)

    1991-01-01

    This volume contains conference summaries for the 31. annual conference of the Canadian Nuclear Association and the 12. annual conference of the Canadian Nuclear Society. Topics of discussion include: reactor physics; thermalhydraulics; industrial irradiation; computer applications; fuel channel analysis; small reactors; severe accidents; fuel behaviour under accident conditions; reactor components, safety related computer software; nuclear fuel management; fuel behaviour and performance; reactor safety; reactor engineering; nuclear waste management; and, uranium mining and processing

  7. Prostate brachytherapy - discharge

    Science.gov (United States)

    Implant therapy - prostate cancer - discharge; Radioactive seed placement - discharge ... You had a procedure called brachytherapy to treat prostate cancer. Your treatment lasted 30 minutes or more, ...

  8. Protective effects of astragaloside IV on db/db mice with diabetic retinopathy.

    Directory of Open Access Journals (Sweden)

    Yuzhi Ding

    Full Text Available Diabetic retinopathy (DR is a common diabetic eye disease which is well-known as the result of microvascular retinal changes. Although the potential biological functions of astragaloside IV (AS IV have long been described in traditional system of medicine, its protective effect on DR remains unclear. This study aims to investigate the function and mechanism of AS IV on type 2 diabetic db/db mice.Db/db mice were treated with AS IV (4.5 mg/kg or 9 mg/kg or physiological saline by oral gavage for 20 weeks along with db/m mice. In each group, retinal ganglion cell (RGC function was measured by pattern electroretinogram (ERG and apoptosis was determined by Terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL staining. Blood and retina aldose reductase (AR activity were quantified by chemiluminescence analysis. The expressions of phosporylated-ERK1/2, NF-κB were determined by Western blot analysis. Furthermore, the expression of related downstream proteins were quantified by Label-based Mouse Antibody Array.Administration of AS IV significantly improved the amplitude in pattern ERG and reduced the apoptosis of RGCs.in db/db mice. Furthermore, downregulation of AR activity, ERK1/2 phosphorylation, NF-κB and related cytokine were observed in AS IV treatment group.Our study indicated that AS IV, as an inhibitor of AR, could prevent the activation of ERK1/2 phosporylation and NF-kB and further relieve the RGCs disfunction in db/db mice with DR. It has provided a basis for investigating the clinical efficacy of AR inhibitors in preventing DR.

  9. Executive summary

    International Nuclear Information System (INIS)

    2002-01-01

    On 18 May 2001, the Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, within the municipality of Eurajoki. The Municipality Council and the government has made positive decisions earlier, at the end of 2000, and in compliance with the Nuclear Energy Act, Parliament's ratification was then required. The decision is valid for the spent fuel generated by the existing Finnish nuclear power plants and means that the construction of the final disposal facility is considered to be in line with the overall good of society. Earlier steps included, amongst others, the approval of the technical project by the Safety Authority. Future steps include construction of an underground rock characterisation facility, ONKALO (2003-2004), and application for separate construction and operating licences for the final disposal facility (from about 2010). How did this political and societal decision come about? The FSC Workshop provided the opportunity to present the history leading up to the Decision in Principle (DiP), and to examine future perspectives with an emphasis on stakeholder involvement. This Executive Summary gives an overview of the presentations and discussions that took place at the workshop. It presents, for the most part, a factual account of the individual presentations and of the discussions that took place. It relies importantly on the notes that were taken at the meeting. Most materials are elaborated upon in a fuller way in the texts that the various speakers and session moderators contributed for these proceedings. The structure of the Executive Summary follows the structure of the workshop itself. Complementary to this Summary and also provided with this document, is a NEA Secretariat's perspective aiming to place the results of all discussions, feedback and site visit into an international perspective. (authors)

  10. Executive summary

    International Nuclear Information System (INIS)

    1981-02-01

    This paper is an 'executive summary' of work undertaken to review proposals for transport, handling and emplacement of high level radioactive wastes in an underground repository, appropriate to the U.K. context, with particular reference to: waste block size and configuration; self-shielded or partially-shielded block; stages of disposal; transportation within the repository; emplacement in vertical holes or horizontal tunnels; repository access by adit, incline or shaft; and costs. The paper contains a section on general conclusions and recommendations. (U.K.)

  11. Summary guidelines

    Energy Technology Data Exchange (ETDEWEB)

    Halsnaes, K.; Painuly, J.P.; Turkson, J.; Meyer, H.J.; Markandya, A.

    1999-09-01

    This document is a summary version of the methodological guidelines for climate change mitigation assessment developed as part of the Global Environment Facility (GEF) project Economics of Greenhouse Gas Limitations; Methodological Guidelines. The objectives of this project have been to develop a methodology, an implementing framework and a reporting system which countries can use in the construction of national climate change mitigation policies and in meeting their future reporting obligations under the FCCC. The methodological framework developed in the Methodological Guidelines covers key economic concepts, scenario building, modelling tools and common assumptions. It was used by several country studies included in the project. (au) 13 refs.

  12. Conference summaries

    International Nuclear Information System (INIS)

    1988-01-01

    This volume contains conference summaries of the 28. annual conference of the Canadian Nuclear Association, and the 9. annual conference of the Canadian Nuclear Society. Topics of discussion include: power reactors; fuel cycles; nuclear power and public understanding; future trends; applications of nuclear technology; CANDU reactors; operational enhancements; design of small reactors; accident behaviour in fuel channels; fuel storage and waste management; reactor commissioning/decommissioning; nuclear safety experiments and modelling; the next generation reactors; advances in nuclear engineering education in Canada; safety of small reactors; current position and improvements of fuel channels; current issues in nuclear safety; and radiation applications - medical and industrial

  13. Elevated Steroid Hormone Production in the db/db Mouse Model of Obesity and Type 2 Diabetes.

    Science.gov (United States)

    Hofmann, Anja; Peitzsch, Mirko; Brunssen, Coy; Mittag, Jennifer; Jannasch, Annett; Frenzel, Annika; Brown, Nicholas; Weldon, Steven M; Eisenhofer, Graeme; Bornstein, Stefan R; Morawietz, Henning

    2017-01-01

    Obesity and type 2 diabetes have become a major public health problem worldwide. Steroid hormone dysfunction appears to be linked to development of obesity and type 2 diabetes and correction of steroid abnormalities may offer new approaches to therapy. We therefore analyzed plasma steroids in 15-16 week old obese and diabetic db/db mice using liquid chromatography-tandem mass spectrometry. Lean db/+ served as controls. Db/db mice developed obesity, hyperglycemia, hyperleptinemia, and hyperlipidemia. Hepatic triglyceride storage was increased and adiponectin and pancreatic insulin were lowered. Aldosterone, corticosterone, 11-deoxycorticosterone, and progesterone were respectively increased by 3.6-, 2.9-, 3.4, and 1.7-fold in db/db mice compared to controls. Ratios of aldosterone-to-progesterone and corticosterone-to-progesterone were respectively 2.0- and 1.5-fold higher in db/db mice. Genes associated with steroidogenesis were quantified in the adrenal glands and gonadal adipose tissues. In adrenals, Cyp11b2 , Cyp11b1 , Cyp21a1 , Hsd3b1 , Cyp11a1 , and StAR were all significantly increased in db/db mice compared with db/+ controls. In adipose tissue, no Cyp11b2 or Cyp11b1 transcripts were detected and no differences in Cyp21a1 , Hsd3b1 , Cyp11a1 , or StAR expression were found between db/+ and db/db mice. In conclusion, the present study showed an elevated steroid hormone production and adrenal steroidogenesis in the db/db model of obesity and type 2 diabetes. © Georg Thieme Verlag KG Stuttgart · New York.

  14. Impairment of the vascular relaxation and differential expression of caveolin-1 of the aorta of diabetic +db/+db mice.

    Science.gov (United States)

    Lam, Tze Yan; Seto, Sai Wang; Lau, Yee Man; Au, Lai Shan; Kwan, Yiu Wa; Ngai, Sai Ming; Tsui, Kwong Wing

    2006-09-28

    In this study, we compared the endothelium-dependent and -independent relaxation of the isolated thoracic aorta of control (+db/+m) and diabetic (+db/+db) (C57BL/KsJ) mice. The gene expression (mRNA and protein) level of the muscarinic M(3) receptors, endothelial nitric oxide synthase (eNOS) and caveolin-1 of the aorta was also evaluated. Acetylcholine caused a concentration-dependent, N(G)-nitro-L-arginine methyl-ester (20 microM)-sensitive relaxation, with approximately 100% relaxation at 10 microM, in +db/+m mice. In +db/+db mice, the acetylcholine-induced relaxation was significantly smaller (maximum relaxation: approximately 80%). The sodium nitroprusside-mediated relaxation was slightly diminished in +db/+db mice, compared to +db/+m mice. However, there was no significant difference in the isoprenaline- and cromakalim-induced relaxation observed in both species. The mRNA and protein expression levels of caveolin-1 were significantly higher in the aorta of +db/+db mice. In contrast, there was no difference in the mRNA and protein expression levels of eNOS and muscarinic M(3) receptors between these mice. Our results demonstrate that the impairment of the acetylcholine-induced, endothelium-dependent aortic relaxation observed in +db/+db mice was probably associated with an enhanced expression of caveolin-1 mRNA and protein.

  15. Coordinate Transcriptomic and Metabolomic Effects of the Insulin Sensitizer Rosiglitazone on Fundamental Metabolic Pathways in Liver, Soleus Muscle, and Adipose Tissue in Diabetic db/db Mice

    Directory of Open Access Journals (Sweden)

    Sabrina Le Bouter

    2010-01-01

    Full Text Available Rosiglitazone (RSG, developed for the treatment of type 2 diabetes mellitus, is known to have potent effects on carbohydrate and lipid metabolism leading to the improvement of insulin sensitivity in target tissues. To further assess the capacity of RSG to normalize gene expression in insulin-sensitive tissues, we compared groups of 18-day-treated db/db mice with increasing oral doses of RSG (10, 30, and 100 mg/kg/d with untreated non-diabetic littermates (db/+. For this aim, transcriptional changes were measured in liver, inguinal adipose tissue (IAT and soleus muscle using microarrays and real-time PCR. In parallel, targeted metabolomic assessment of lipids (triglycerides (TGs and free fatty acids (FFAs in plasma and tissues was performed by UPLC-MS methods. Multivariate analyses revealed a relationship between the differential gene expressions in liver and liver trioleate content and between blood glucose levels and a combination of differentially expressed genes measured in liver, IAT, and muscle. In summary, we have integrated gene expression and targeted metabolomic data to present a comprehensive overview of RSG-induced changes in a diabetes mouse model and improved the molecular understanding of how RSG ameliorates diabetes through its effect on the major insulin-sensitive tissues.

  16. Dysregulation of the unfolded protein response in db/db mice with diet induced steatohepatitis

    OpenAIRE

    Rinella, Mary E.; Siddiqui, M. Shaddab; Gardikiotes, Konstantina; Gottstein, Jeanne; Elias, Marc; Green, Richard M.

    2011-01-01

    In humans with non-alcoholic fatty liver, diabetes is associated with more advanced disease. We have previously shown that diabetic db/db mice are highly susceptible to methionine choline deficient diet (MCD) induced hepatic injury. Since activation of the unfolded protein response (UPR) is an important adaptive cellular mechanism in diabetes, obesity and fatty liver, we hypothesized that dysregulation of the UPR may partially explain how diabetes could promote liver injury.

  17. Improved cerebral energetics and ketone body metabolism in db/db mice

    DEFF Research Database (Denmark)

    Andersen, Jens V; Christensen, Sofie K; Nissen, Jakob D

    2017-01-01

    It is becoming evident that type 2 diabetes mellitus is affecting brain energy metabolism. The importance of alternative substrates for the brain in type 2 diabetes mellitus is poorly understood. The aim of this study was to investigate whether ketone bodies are relevant candidates to compensate...... metabolism in type 2 diabetes mellitus. The increased hippocampal ketone body utilization and improved mitochondrial function in db/db mice, may act as adaptive mechanisms in order to maintain cerebral energetics during hampered glucose metabolism....

  18. Perivascular adipose tissue control of insulin-induced vasoreactivity in muscle is impaired in db/db mice

    DEFF Research Database (Denmark)

    Meijer, Rick I; Bakker, Wineke; Alta, Caro-Lynn A F

    2013-01-01

    in muscle, the underlying mechanisms, and how obesity disturbs this vasodilation. Insulin-induced vasoreactivity of resistance arteries was studied with PVAT from C57BL/6 or db/db mice. PVAT weight in muscle was higher in db/db mice compared with C57BL/6 mice. PVAT from C57BL/6 mice uncovered insulin......-induced vasodilation; this vasodilation was abrogated with PVAT from db/db mice. Blocking adiponectin abolished the vasodilator effect of insulin in the presence of C57BL/6 PVAT, and adiponectin secretion was lower in db/db PVAT. To investigate this interaction further, resistance arteries of AMPKa2(+/+) and AMPKa2......-induced vasodilation in an adiponectin-dependent manner. In conclusion, PVAT controls insulin-induced vasoreactivity in the muscle microcirculation through secretion of adiponectin and subsequent AMPKa2 signaling. PVAT from obese mice inhibits insulin-induced vasodilation, which can be restored by inhibition of JNK....

  19. IPPS Provider Summary for the Top 100 DRGs - FY2011

    Data.gov (United States)

    U.S. Department of Health & Human Services — A provider level summary of Inpatient Prospective Payment System (IPPS) discharges, average charges and average Medicare payments for the Top 100 Diagnosis-Related...

  20. HIVsirDB: a database of HIV inhibiting siRNAs.

    Directory of Open Access Journals (Sweden)

    Atul Tyagi

    Full Text Available Human immunodeficiency virus (HIV is responsible for millions of deaths every year. The current treatment involves the use of multiple antiretroviral agents that may harm patients due to their toxic nature. RNA interference (RNAi is a potent candidate for the future treatment of HIV, uses short interfering RNA (siRNA/shRNA for silencing HIV genes. In this study, attempts have been made to create a database HIVsirDB of siRNAs responsible for silencing HIV genes.HIVsirDB is a manually curated database of HIV inhibiting siRNAs that provides comprehensive information about each siRNA or shRNA. Information was collected and compiled from literature and public resources. This database contains around 750 siRNAs that includes 75 partially complementary siRNAs differing by one or more bases with the target sites and over 100 escape mutant sequences. HIVsirDB structure contains sixteen fields including siRNA sequence, HIV strain, targeted genome region, efficacy and conservation of target sequences. In order to facilitate user, many tools have been integrated in this database that includes; i siRNAmap for mapping siRNAs on target sequence, ii HIVsirblast for BLAST search against database, iii siRNAalign for aligning siRNAs.HIVsirDB is a freely accessible database of siRNAs which can silence or degrade HIV genes. It covers 26 types of HIV strains and 28 cell types. This database will be very useful for developing models for predicting efficacy of HIV inhibiting siRNAs. In summary this is a useful resource for researchers working in the field of siRNA based HIV therapy. HIVsirDB database is accessible at http://crdd.osdd.net/raghava/hivsir/.

  1. DBA2J db/db mice are susceptible to early albuminuria and glomerulosclerosis that correlate with systemic insulin resistance.

    Science.gov (United States)

    Østergaard, Mette V; Pinto, Vanda; Stevenson, Kirsty; Worm, Jesper; Fink, Lisbeth N; Coward, Richard J M

    2017-02-01

    Diabetic nephropathy (DN) is the leading cause of kidney failure in the world. To understand important mechanisms underlying this condition, and to develop new therapies, good animal models are required. In mouse models of type 1 diabetes, the DBA/2J strain has been shown to be more susceptible to develop kidney disease than other common strains. We hypothesized this would also be the case in type 2 diabetes. We studied db/db and wild-type (wt) DBA/2J mice and compared these with the db/db BLKS/J mouse, which is currently the most widely used type 2 DN model. Mice were analyzed from age 6 to 12 wk for systemic insulin resistance, albuminuria, and glomerular histopathological and ultrastructural changes. Body weight and nonfasted blood glucose were increased by 8 wk in both genders, while systemic insulin resistance commenced by 6 wk in female and 8 wk in male db/db DBA/2J mice. The urinary albumin-to-creatinine ratio (ACR) was closely linked to systemic insulin resistance in both sexes and was increased ~50-fold by 12 wk of age in the db/db DBA/2J cohort. Glomerulosclerosis, foot process effacement, and glomerular basement membrane thickening were observed at 12 wk of age in db/db DBA/2J mice. Compared with db/db BLKS/J mice, db/db DBA/2J mice had significantly increased levels of urinary ACR, but similar glomerular histopathological and ultrastructural changes. The db/db DBA/2J mouse is a robust model of early-stage albuminuric DN, and its levels of albuminuria correlate closely with systemic insulin resistance. This mouse model will be helpful in defining early mechanisms of DN and ultimately the development of novel therapies. Copyright © 2017 the American Physiological Society.

  2. The db/db mouse: a useful model for the study of diabetic retinal neurodegeneration.

    Directory of Open Access Journals (Sweden)

    Patricia Bogdanov

    Full Text Available BACKGROUND: To characterize the sequential events that are taking place in retinal neurodegeneration in a murine model of spontaneous type 2 diabetes (db/db mouse. METHODS: C57BLKsJ-db/db mice were used as spontaneous type 2 diabetic animal model, and C57BLKsJ-db/+ mice served as the control group. To assess the chronological sequence of the abnormalities the analysis was performed at different ages (8, 16 and 24 weeks. The retinas were evaluated in terms of morphological and functional abnormalities [electroretinography (ERG]. Histological markers of neurodegeneration (glial activation and apoptosis were evaluated by immunohistochemistry. In addition glutamate levels and glutamate/aspartate transporter (GLAST expression were assessed. Furthermore, to define gene expression changes associated with early diabetic retinopathy a transcriptome analyses was performed at 8 week. Furthermore, an additional interventional study to lower blood glucose levels was performed. RESULTS: Glial activation was higher in diabetic than in non diabetic mice in all the stages (p<0.01. In addition, a progressive loss of ganglion cells and a significant reduction of neuroretinal thickness were also observed in diabetic mice. All these histological hallmarks of neurodegeneration were less pronounced at week 8 than at week 16 and 24. Significant ERG abnormalities were present in diabetic mice at weeks 16 and 24 but not at week 8. Moreover, we observed a progressive accumulation of glutamate in diabetic mice associated with an early downregulation of GLAST. Morphological and ERG abnormalities were abrogated by lowering blood glucose levels. Finally, a dysregulation of several genes related to neurotransmission and oxidative stress such as UCP2 were found at week 8. CONCLUSIONS: Our results suggest that db/db mouse reproduce the features of the neurodegenerative process that occurs in the human diabetic eye. Therefore, it seems an appropriate model for investigating the

  3. RavenDB 2.x beginner's guide

    CERN Document Server

    Tannir, Khaled

    2013-01-01

    Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions and examples that are designed to help you get started with RavenDB. If you are a .NET developer, new to document-oriented databases, and you wish to learn how to build applications using NoSQL databases, then this book is for you. Experience with relational database systems will be helpful, but not necessary.

  4. Conference summaries

    Energy Technology Data Exchange (ETDEWEB)

    Reynolds, Tim [Inta Communication Limited for European Service Network/ DG Research, Trillium House, 32 New Street, St. Neots, Cambridge PE19 1AJ (United Kingdom)

    2004-07-01

    The summaries were derived from presentations, interviews and discussions at the conference. The summaries are given at two levels, overall for the conference and for specific sessions as follows: 1) Overall Conference: 'A Sound Scientific Basis for Serious Decisions; 2) Sessions on EC Policy and Socio-Political Issues: 'Promoting Safety and Protecting Society'; 3) Session on P and T: 'Partitioning and Transmutation: A Technical Fix or Technical Training?'; 4) Sessions on Geological Disposal and Research Networking: 'No Technical Barriers to Geological Disposal'. First an overall summary of Euradwaste '04 is presented. Significant progress was made on the technical and scientific basis for geological disposal of radioactive waste during the European Commission's Fifth EURATOM Framework Programme for Research (FP5). Deep geological disposal is technically feasible now and can demonstrate the guarantees of long-term isolation and protection of the public. In parallel, socio-political studies have produced methodologies for constructive dialogue with potential host communities that reflect the honesty and openness expected by a democratic society. A harmonized legislative framework for nuclear safety and waste disposal across the enlarged European Union is currently being discussed. Disposal in deep (> 300 metre) geological repositories, the favoured strategy in Europe for long-lived high-level radioactive waste, is now possible. The Sessions on EC Policy and Socio-Political Issues are summarized as follows. The opening day of Euradwaste '04 focused on European Commission policy, including the proposed Directives on disposal of radioactive waste and nuclear safety and socio-political aspects including governance and decision making, public perception/acceptance of waste disposal and its sustainability. A decision on the proposed package will now be made after Union enlargement. Public agreement on the siting of

  5. Executive Summary

    International Nuclear Information System (INIS)

    2014-01-01

    Each session of the workshop consisted of a number of presentations followed by a panel discussion moderated by the session Chairs. A summary of each session and subsequent discussion that ensued are provided. Session 1: National approaches for long term interim storage facilities. Seven papers were presented during this session by representatives of research institutes in USA (EPRI) and in Norway (IFE), governmental authorities for the nuclear industry in Finland (STUK) and Slovak Republic (UJD), technical support organizations in Germany (GRS) and France (IRSN) and the public company in charge of waste management in Spain (ENRESA). The papers discussed the national policy, the regulatory framework and the current situation for storage of SF and HLW in various European countries (Germany, Spain, Finland, Norway and Slovak Republic). The main activities the EPRI is undertaking to establish the technical bases for extended (long-term) storage and the IRSN's definition of the safety principles and objectives for new storage facilities regarding long-term storage are also discussed. Session 2: Safety requirements, regulatory framework and implementation issues. Eleven papers were presented during this session by representatives from international groups (the International Atomic Energy Agency (IAEA) and the Nuclear Energy Agency (NEA)), representatives of regulatory bodies from the United States (Nuclear Regulatory Commission) and Germany (Bundesamt fuer Strahlenschutz (BfS)), German Federal Institute for Materials Research and Testing (BAM), operators from the United Kingdom (Sellafield Limited, UK) and France (EDF), vendors (AREVA), and representatives of TSOs in Germany (TUV and Oko-Institut). Session 3: Technical issues and operational experience, needs for R and D. This session was chaired by Karl Wasinger (AREVA, Germany) and Fumihisa Nagase (JAEA, Japan). Ten papers were presented during this session by representatives of research institutes of Japan (CRIEPI

  6. Vessel Sewage Discharges

    Science.gov (United States)

    Vessel sewage discharges are regulated under Section 312 of the Clean Water Act, which is jointly implemented by the EPA and Coast Guard. This homepage links to information on marine sanitation devices and no discharge zones.

  7. Symposium summary

    International Nuclear Information System (INIS)

    Wall, G.

    1990-01-01

    A summary is provided of the issues discussed at the climate change implications for water and ecological resources conference, and recommendations that came out of the conference. The objectives of the meeting were to present and discuss results of recent climate change experiments undertaken in Canada; evaluate a variety of climate models and impact analyses and to develop methods and strategies for future study; and to establish working linkages between modellers and analysts in the fields of climate, hydrology, and ecosystem research, as well as between social scientists and policy makers interested in the implications of climate change. Recommendations were made in the five areas of research, monitoring, risk assessment, policy and information dissemination. Additional research should be undertaken to foster improved understanding of relationships between climate, climate change, and ecological and human processes. A suitable monitoring program, including a national wetlands monitoring program, should be established. Risk assessments should be undertaken to evaluate vulnerabilities of ecosystem components, to assess options, and to provide the information required to develop and implement appropriate policy objectives. The impacts of a range of public policy responses and feedbacks should be assessed. The dissemination of well-targeted and accurate information is vital if basic societal attitudes regarding the value of water and ecosystems are to be changed

  8. Session summaries

    International Nuclear Information System (INIS)

    Sudo, Y.

    2002-01-01

    In the summary session, possible international activities in the field of basic studies on high-temperature engineering were discussed within the framework of the OECD/NEA Nuclear Science Committee (NSC). It was recommended to include topics relevant to fission-product behaviour and safety issues of HTGR in next meeting, in addition to the topics discussed in this meeting. The chairperson of the last session summarised the recommendations to be presented to the NSC into the following five topics as possible international activities: - Basic studies on behaviour of irradiated graphite/carbon and ceramic materials including their composites under both operation and storage conditions. - Development of in-core material characterisation and instrumentation methods. - Improvement in material properties through high-temperature irradiation. - Basic studies on HTGR fuel fabrication and performance including fission-product release. - Basic studies on safety issues of HTGR. It was also recommended that a further information exchange meeting focused on the organisation of the interactive collaboration activity with regard to the above topics be planned in 2003, tentatively in Oarai, Japan. (author)

  9. Management summary

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    A most pressing problem in many environmental assessments is determining the extent of contamination to the biosphere resulting from a given activity. This could result from the planned or accidental release of a contaminant to the environment and its subsequent transport through air, water, or the food chain. In either case, three critical questions need to be raised in the environmental assessment of the problem: Where are the contaminants; When will they arrive at a specific location; How much of the contaminant will be at the point of uptake. The location of the contaminant is important, since a contaminant isolated from man both now and in the future may represent little hazard, even in rather large quantities. Under other conditions, small amounts of contaminants arriving at critical locations over a short period may involve severe hazard. The problem of location is simplified by concentrating on those places where the contaminants will interface with the biosphere. Applications in evaluating the consequences of ground water contamination are discussed. Environmental consequences or impacts are most effectively and efficiently communicated by: Blending extensive technical results and reducing them to simple summary relationships, i.e., the arrival distributions; focusing on the arrival distributions as the central theme of communication efforts; and determining quantitative consequences or impacts to the biosphere through use of the arrival distributions. Appropriately applied, these principles can reduce a voluminous impact statement on subsurface pollution to a few pages that are directly useful to decision-makers and the public

  10. Theory summary

    International Nuclear Information System (INIS)

    Tang, W.M.

    2001-01-01

    This is a summary of the advances in magnetic fusion energy theory research presented at the 17th International Atomic Energy Agency Fusion Energy Conference from 19 24 October, 1998 in Yokohama, Japan. Theory and simulation results from this conference provided encouraging evidence of significant progress in understanding the physics of thermonuclear plasmas. Indeed, the grand challenge for this field is to acquire the basic understanding that can readily enable the innovations which would make fusion energy practical. In this sense, research in fusion energy is increasingly able to be categorized as fitting well the 'Pasteur's Quadrant' paradigm, where the research strongly couples basic science ('Bohr's Quadrant') to technological impact ('Edison's Quadrant'). As supported by some of the work presented at this conference, this trend will be further enhanced by advanced simulations. Eventually, realistic three-dimensional modeling capabilities, when properly combined with rapid and complete data interpretation of results from both experiments and simulations, can contribute to a greatly enhanced cycle of understanding and innovation. Plasma science theory and simulation have provided reliable foundations for this improved modeling capability, and the exciting advances in high-performance computational resources have further accelerated progress. There were 68 papers presented at this conference in the area of magnetic fusion energy theory

  11. Statistical summaries of selected Iowa streamflow data through September 2013

    Science.gov (United States)

    Eash, David A.; O'Shea, Padraic S.; Weber, Jared R.; Nguyen, Kevin T.; Montgomery, Nicholas L.; Simonson, Adrian J.

    2016-01-04

    Statistical summaries of streamflow data collected at 184 streamgages in Iowa are presented in this report. All streamgages included for analysis have at least 10 years of continuous record collected before or through September 2013. This report is an update to two previously published reports that presented statistical summaries of selected Iowa streamflow data through September 1988 and September 1996. The statistical summaries include (1) monthly and annual flow durations, (2) annual exceedance probabilities of instantaneous peak discharges (flood frequencies), (3) annual exceedance probabilities of high discharges, and (4) annual nonexceedance probabilities of low discharges and seasonal low discharges. Also presented for each streamgage are graphs of the annual mean discharges, mean annual mean discharges, 50-percent annual flow-duration discharges (median flows), harmonic mean flows, mean daily mean discharges, and flow-duration curves. Two sets of statistical summaries are presented for each streamgage, which include (1) long-term statistics for the entire period of streamflow record and (2) recent-term statistics for or during the 30-year period of record from 1984 to 2013. The recent-term statistics are only calculated for streamgages with streamflow records pre-dating the 1984 water year and with at least 10 years of record during 1984–2013. The streamflow statistics in this report are not adjusted for the effects of water use; although some of this water is used consumptively, most of it is returned to the streams.

  12. Hydrologic test results for the Rattlesnake Ridge interbed and Pomona basalt flow top at Borehole DB-15

    International Nuclear Information System (INIS)

    Strait, S.R.; Brown, W.R.

    1983-07-01

    This report presents results and description of hydrologic test activities for the Rattlesnake Ridge interbed and Pomona basalt flow top at Borehole DB-15. Hydrologic tests conducted include constant discharge air-lift and constant discharge submersible pumping tests. An observed hydraulic head for the test interval was 409 ± 1 feet above mean sea level. Transmissivity values determined from hydrologic tests performed, ranged between 493 and 469 ft 2 /day. The best estimate of transmissivity is 480 ft 2 /day. The best estimate of equivalent hydraulic conductivity, based on an effective test thickness of 56 feet is 8.6 ft/day. 4 refs., 7 figs., 2 tabs

  13. Early discharge following birth

    DEFF Research Database (Denmark)

    Nilsson, Ingrid M. S.; Kronborg, Hanne; Knight, Christopher H.

    2017-01-01

    .26–0.48) and primiparous compared to multiparous had an OR of 0.22 (CI 0.17–0.29) for early discharge. Other predictors for early discharge were: no induction of labour, no epidural painkiller, bleeding less than 500 ml during delivery, higher gestational age, early expected discharge and positive breastfeeding experience...

  14. Heart attack - discharge

    Science.gov (United States)

    ... and lifestyle Cholesterol - drug treatment Controlling your high blood pressure Deep vein thrombosis - discharge Dietary fats explained Fast food tips Heart attack - discharge Heart attack - what to ask your doctor Heart bypass ... pacemaker - discharge High blood pressure - what to ask your doctor How to read ...

  15. Novel small-molecule AMPK activator orally exerts beneficial effects on diabetic db/db mice

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yuan-Yuan; Yu, Li-Fang; Zhang, Li-Na; Qiu, Bei-Ying; Su, Ming-Bo; Wu, Fang; Chen, Da-Kai; Pang, Tao; Gu, Min; Zhang, Wei; Ma, Wei-Ping; Jiang, Hao-Wen; Li, Jing-Ya, E-mail: jyli@mail.shcnc.ac.cn; Nan, Fa-Jun, E-mail: fjnan@mail.shcnc.ac.cn; Li, Jia, E-mail: jli@mail.shcnc.ac.cn

    2013-12-01

    AMP-activated protein kinase (AMPK), which is a pivotal guardian of whole-body energy metabolism, has become an attractive therapeutic target for metabolic syndrome. Previously, using a homogeneous scintillation proximity assay, we identified the small-molecule AMPK activator C24 from an optimization based on the original allosteric activator PT1. In this paper, the AMPK activation mechanism of C24 and its potential beneficial effects on glucose and lipid metabolism on db/db mice were investigated. C24 allosterically stimulated inactive AMPK α subunit truncations and activated AMPK heterotrimers by antagonizing autoinhibition. In primary hepatocytes, C24 increased the phosphorylation of AMPK downstream target acetyl-CoA carboxylase dose-dependently without changing intracellular AMP/ATP ratio, indicating its allosteric activation in cells. Through activating AMPK, C24 decreased glucose output by down-regulating mRNA levels of phosphoenolpyruvate carboxykinase (PEPCK) and glucose-6-phosphatase (G6Pase) in primary hepatocytes. C24 also decreased the triglyceride and cholesterol contents in HepG2 cells. Due to its improved bioavailability, chronic oral treatment with multiple doses of C24 significantly reduced blood glucose and lipid levels in plasma, and improved the glucose tolerance of diabetic db/db mice. The hepatic transcriptional levels of PEPCK and G6Pase were reduced. These results demonstrate that this orally effective activator of AMPK represents a novel approach to the treatment of metabolic syndrome. - Highlights: • C24 activates AMPK through antagonizing autoinhibition within α subunit. • C24 activates AMPK in hepatocytes and decreases glucose output via AMPK. • C24 exerts beneficial effects on diabetic db/db mice. • C24 represents a novel therapeutic for treatment of metabolic syndrome.

  16. Novel small-molecule AMPK activator orally exerts beneficial effects on diabetic db/db mice

    International Nuclear Information System (INIS)

    Li, Yuan-Yuan; Yu, Li-Fang; Zhang, Li-Na; Qiu, Bei-Ying; Su, Ming-Bo; Wu, Fang; Chen, Da-Kai; Pang, Tao; Gu, Min; Zhang, Wei; Ma, Wei-Ping; Jiang, Hao-Wen; Li, Jing-Ya; Nan, Fa-Jun; Li, Jia

    2013-01-01

    AMP-activated protein kinase (AMPK), which is a pivotal guardian of whole-body energy metabolism, has become an attractive therapeutic target for metabolic syndrome. Previously, using a homogeneous scintillation proximity assay, we identified the small-molecule AMPK activator C24 from an optimization based on the original allosteric activator PT1. In this paper, the AMPK activation mechanism of C24 and its potential beneficial effects on glucose and lipid metabolism on db/db mice were investigated. C24 allosterically stimulated inactive AMPK α subunit truncations and activated AMPK heterotrimers by antagonizing autoinhibition. In primary hepatocytes, C24 increased the phosphorylation of AMPK downstream target acetyl-CoA carboxylase dose-dependently without changing intracellular AMP/ATP ratio, indicating its allosteric activation in cells. Through activating AMPK, C24 decreased glucose output by down-regulating mRNA levels of phosphoenolpyruvate carboxykinase (PEPCK) and glucose-6-phosphatase (G6Pase) in primary hepatocytes. C24 also decreased the triglyceride and cholesterol contents in HepG2 cells. Due to its improved bioavailability, chronic oral treatment with multiple doses of C24 significantly reduced blood glucose and lipid levels in plasma, and improved the glucose tolerance of diabetic db/db mice. The hepatic transcriptional levels of PEPCK and G6Pase were reduced. These results demonstrate that this orally effective activator of AMPK represents a novel approach to the treatment of metabolic syndrome. - Highlights: • C24 activates AMPK through antagonizing autoinhibition within α subunit. • C24 activates AMPK in hepatocytes and decreases glucose output via AMPK. • C24 exerts beneficial effects on diabetic db/db mice. • C24 represents a novel therapeutic for treatment of metabolic syndrome

  17. Access of vehicles to DB netz infrastructure; Zugang von Fahrzeugen zur DB-Netz-Infrastruktur

    Energy Technology Data Exchange (ETDEWEB)

    Resch, U. [DB Systemtechnik, Frankfurt am Main (Germany); Ruch, M. [DB Energie GmbH, Frankfurt am Main (Germany)

    2003-05-01

    For line access it is necessary to take into account and observe the requirements of the infrastructure. The requirements and certifications for the power supply system and pantograph-overhead contact line interaction are described in the DB guidelines 810.0241 and 810.0242. (orig.) [German] Fuer den Netzzugang muessen die Anforderungen der Infrastruktur beachtet und eingehalten werden. Die Anforderungen und die erforderlichen Nachweise fuer den Bereich Energieversorgung und Zusammenwirken von Stromabnehmer und Oberleitung sind in den Richtlinien 810.0241 und 810.0242 der DB enthalten. (orig.)

  18. Executive summary

    International Nuclear Information System (INIS)

    2002-01-01

    systems. The scope of the workshop comprised reactor physics, fuel performance and fuel material technology, thermal-hydraulics, core behaviour and fuel cycle of advanced reactors with different types of fuels or fuel lattices. Reactor types considered were water-cooled, high-temperature gas-cooled and fast spectrum reactors as well as hybrid reactors with fast and thermal neutron spectra. The emphasis was on innovative concepts and issues related to the reactor and fuel. The workshop concluded with a wide-ranging panel discussion which considered some difficult questions from which it is hoped that some recommendations for future priorities can be derived. A record of the discussion is included at the end of this summary. (author)

  19. Influence of ultrasonic irradiation on ozone generation in a dielectric barrier discharge

    DEFF Research Database (Denmark)

    Kusano, Yukihiro; Drews, J.; Leipold, Frank

    2012-01-01

    An atmospheric pressure dielectric barrier discharge (DBD) was generated in an N2/O2 gas mixture at room temperature with and without ultrasonic irradiation to investigate ozone production. Powerful ultrasonic irradiation with the sound pressure level of approximately 150 dB into the DBD can...

  20. Influence of ultrasonic irradiation on ozone generation in a dielectric barrier discharge

    International Nuclear Information System (INIS)

    Kusano, Y; Drews, J; Leipold, F; Fateev, A; Bardenshtein, A; Krebs, N

    2012-01-01

    An atmospheric pressure dielectric barrier discharge (DBD) was generated in an N 2 /O 2 gas mixture at room temperature with and without ultrasonic irradiation to investigate ozone production. Powerful ultrasonic irradiation with the sound pressure level of approximately 150 dB into the DBD can enhance ozone production especially when the DBD was driven at a frequency of 15 kHz.

  1. SilkDB: a knowledgebase for silkworm biology and genomics

    DEFF Research Database (Denmark)

    Wang, Jing; Xia, Qingyou; He, Ximiao

    2005-01-01

    The Silkworm Knowledgebase (SilkDB) is a web-based repository for the curation, integration and study of silkworm genetic and genomic data. With the recent accomplishment of a approximately 6X draft genome sequence of the domestic silkworm (Bombyx mori), SilkDB provides an integrated representati....... SilkDB is publicly accessible at http://silkworm.genomics.org.cn. Udgivelsesdato: 2005-Jan-1...

  2. An Introduction to the DB Relational Database Management System

    OpenAIRE

    Ward, J.R.

    1982-01-01

    This paper is an introductory guide to using the Db programs to maintain and query a relational database on the UNIX operating system. In the past decade. increasing interest has been shown in the development of relational database management systems. Db is an attempt to incorporate a flexible and powerful relational database system within the user environment presented by the UNIX operating system. The family of Db programs is useful for maintaining a database of information that i...

  3. Executive Summary

    International Nuclear Information System (INIS)

    2013-01-01

    countries (MC) and concerned both initial safety assessment of new facilities and reassessment of existing ones (periodic safety review). It also considered trends of future improvement of safety assessment techniques. The workshop was organised in an opening session, four technical sessions, one special session and a conclusion session. The technical sessions were focussed on: - General approach including human aspects (9 papers); - Front end facilities (5 papers); - Chemical hazards - release limits (6 papers); and - Back end facilities (6 papers). In addition, a special session (4 presentations) was held to discuss the lessons learnt for FCFs from the Fukushima accident in Japan. The workshop ended with an organized site visit to Cameco Corporation's Port Hope Conversion Facility in Port Hope, Ontario on the last day of the workshop. This paper presents the Summary of the technical and special sessions, the General Conclusions and Recommendation of the workshop and some future directions

  4. Executive summary

    International Nuclear Information System (INIS)

    2009-01-01

    assessment process, licensee actions, regulatory actions. Summaries from the three days of workshop discussions as well as information from the licensee and regulatory responses to two pre-workshop surveys are presented. Also included are highlights from the numerous invited presentations. The conclusions and findings from the extensive group and plenary discussions are summarised too. Supporting material, discussion group presentation slides, slides from the invited presenters, and information/responses to the licensee and regulatory surveys are included in the attached Appendices

  5. Summary Record

    International Nuclear Information System (INIS)

    2008-01-01

    (II-3) - Uncertainty analysis of the steady state benchmark. It should be recognized that the purpose of this benchmark is not only to compare currently available macroscopic approaches but above-all to encourage the development of novel next-generation approaches that focus on more microscopic processes. Thus, the benchmark problem includes both macroscopic and microscopic measurement data. In this context, the sub-channel grade void fraction data are regarded as the macroscopic data and the digitized computer graphic images are the microscopic data. The technical topics to be addressed at the workshop include: - Review of the benchmark activities after the 4. Workshop; - Presentation and discussion of summary of comparisons of final submitted results for Exercise 1 of Phase I (I-1); for Exercise 0 of Phase II (II-0); and for Exercise 1 of Phase II (II-1); - Presentation and discussion of comparison of final submitted results for Exercise 2 of Phase I (I-2); - Presentation and discussion of comparison of final submitted results for Exercise 3 of Phase I (I-3); - Presentation and discussion of comparison of final submitted results for Exercise 2 of Phase II (II-2); - Presentation and discussion of preliminary uncertainty results for Exercise 4 of Phase I (I-4); - Presentation and discussion of preliminary uncertainty results for Exercise 3 of Phase II (II-3); - Preparing a special issue in a journal with participants' BFBT papers; - Defining a work plan and schedule outlining actions to advance the two phases of the benchmark activities

  6. Gradual linguistic summaries

    NARCIS (Netherlands)

    Wilbik, A.M.; Kaymak, U.; Laurent, A.; Strauss, O.; Bouchon-Meunier, xx

    2014-01-01

    In this paper we propose a new type of protoform-based linguistic summary – the gradual summary. This new type of summaries aims in capturing the change over some time span. Such summaries can be useful in many domains, for instance in economics, e.g., "prices of X are getting smaller" in eldercare,

  7. Drilling history of core hole DB-15

    International Nuclear Information System (INIS)

    Diediker, L.D.; Ledgerwood, R.K.

    1980-09-01

    This core hole was drilled to obtain hydrologic and chemical data on the permeable zones of the Saddle Mountains and Wanapum Formations. These data were obtained by testing the zones that were penetrated during drilling. This testing-as-drilled method reduced the potential problems of interflow and water contamination. This report summarizes the drilling and coring operations; geologic logging, hydrologic testing, and geophysical logging activities; and cementing operations of DB-15 during drilling. The successful completion of DB-15 demonstrated that hydrologic testing can be conducted during core drilling operations. More reliable head measurements and uncontaminated representative water samples from isolated permeable zones, which have not been exposed to potential open borehole cross-flow and head equilibration problems, were benefits derived from the testing-as-drilled method. Disadvantages of the technique were a longer time to complete the borehole caused by time required for testing and increased drilling costs due to rig standby time during testing. Extension of the testing-as-drilled method to the drilling of future core holes is recommended. An evaluation should be made of the required hydrologic data and expected borehole stratigraphy before and during drilling to allow uninterrupted drilling in zones of low permeability that can be tested after drilling is complete

  8. Restructuring of the Gut Microbiome by Intermittent Fasting Prevents Retinopathy and Prolongs Survival in db/db Mice.

    Science.gov (United States)

    Beli, Eleni; Yan, Yuanqing; Moldovan, Leni; Vieira, Cristiano P; Gao, Ruli; Duan, Yaqian; Prasad, Ram; Bhatwadekar, Ashay; White, Fletcher A; Townsend, Steven; Chan, Luisa; Ryan, Caitlin N; Morton, Daniel; Moldovan, Emil G; Chu, Fang-I; Oudit, Gavin Y; Derendorf, Hartmut; Adorini, Luciano; Wang, Xiaoxin X; Evans-Molina, Carmella; Mirmira, Raghavendra G; Boulton, Michael E; Yoder, Mervin C; Li, Qiuhong; Levi, Moshe; Busik, Julia V; Grant, Maria B

    2018-04-30

    Intermittent fasting (IF) protects against the development of metabolic diseases and cancer, but whether it can prevent diabetic microvascular complications is not known. In db/db mice, we examined the impact of long-term IF on diabetic retinopathy (DR). Despite no change in glycated hemoglobin, db/db mice on the IF regimen displayed significantly longer survival and a reduction in DR endpoints, including acellular capillaries and leukocyte infiltration. We hypothesized that IF mediated changes in the gut microbiota would produce beneficial metabolites and prevent the development of DR. Microbiome analysis revealed increased levels of Firmicutes and decreased Bacteroidetes and Verrucomicrobia Compared to db/db mice on ad-libitum (AL) feeding, changes in the microbiome of the db/db mice on IF were associated with increases in gut mucin, goblet cell number and villi length and reductions in plasma peptidoglycan. Consistent with the known modulatory effects of Firmicutes on bile acid (BA) metabolism, measurement of BAs demonstrated a significant increase of tauroursodeoxycholate (TUDCA), a neuroprotective BA, in db/db on IF but not in db/db on AL feeding. TGR-5, the TUDCA receptor, was found in neural cells of the retina primary ganglion cells. Expression of TGR5 did not change with IF or diabetes. However, IF reduced retinal TNF-α mRNA, which is a key downstream target of TGR-5 activation. Pharmacological activation of TGR5 using INT-767 prevented DR in a second diabetic mouse model. These findings support the concept that IF prevents DR by restructuring the microbiota towards species producing TUDCA and subsequent retinal protection by TGR5 activation. © 2018 by the American Diabetes Association.

  9. Bile acid sequestration reduces plasma glucose levels in db/db mice by increasing its metabolic clearance rate.

    Directory of Open Access Journals (Sweden)

    Maxi Meissner

    Full Text Available AIMS/HYPOTHESIS: Bile acid sequestrants (BAS reduce plasma glucose levels in type II diabetics and in murine models of diabetes but the mechanism herein is unknown. We hypothesized that sequestrant-induced changes in hepatic glucose metabolism would underlie reduced plasma glucose levels. Therefore, in vivo glucose metabolism was assessed in db/db mice on and off BAS using tracer methodology. METHODS: Lean and diabetic db/db mice were treated with 2% (wt/wt in diet Colesevelam HCl (BAS for 2 weeks. Parameters of in vivo glucose metabolism were assessed by infusing [U-(13C]-glucose, [2-(13C]-glycerol, [1-(2H]-galactose and paracetamol for 6 hours, followed by mass isotopologue distribution analysis, and related to metabolic parameters as well as gene expression patterns. RESULTS: Compared to lean mice, db/db mice displayed an almost 3-fold lower metabolic clearance rate of glucose (p = 0.0001, a ∼300% increased glucokinase flux (p = 0.001 and a ∼200% increased total hepatic glucose production rate (p = 0.0002. BAS treatment increased glucose metabolic clearance rate by ∼37% but had no effects on glucokinase flux nor total hepatic or endogenous glucose production. Strikingly, BAS-treated db/db mice displayed reduced long-chain acylcarnitine content in skeletal muscle (p = 0.0317 but not in liver (p = 0.189. Unexpectedly, BAS treatment increased hepatic FGF21 mRNA expression 2-fold in lean mice (p = 0.030 and 3-fold in db/db mice (p = 0.002. CONCLUSIONS/INTERPRETATION: BAS induced plasma glucose lowering in db/db mice by increasing metabolic clearance rate of glucose in peripheral tissues, which coincided with decreased skeletal muscle long-chain acylcarnitine content.

  10. Omission of Dysphagia Therapies in Hospital Discharge Communications

    Science.gov (United States)

    Kind, Amy; Anderson, Paul; Hind, Jacqueline; Robbins, JoAnne; Smith, Maureen

    2009-01-01

    Background Despite the wide implementation of dysphagia therapies, it is unclear whether these therapies are successfully communicated beyond the inpatient setting. Objective To examine the rate of dysphagia recommendation omissions in hospital discharge summaries for high-risk sub-acute care (i.e., skilled nursing facility, rehabilitation, long-term care) populations. Design Retrospective cohort study Subjects All stroke and hip fracture patients billed for inpatient dysphagia evaluations by speech-language pathologists (SLPs) and discharged to sub-acute care in 2003-2005 from a single large academic medical center (N=187). Measurements Dysphagia recommendations from final SLP hospital notes and from hospital (physician) discharge summaries were abstracted, coded, and compared for each patient. Recommendation categories included: dietary (food and liquid), postural/compensatory techniques (e.g., chin-tuck), rehabilitation (e.g., exercise), meal pacing (e.g., small bites), medication delivery (e.g., crush pills), and provider/supervision (e.g., 1-to-1 assist). Results 45% of discharge summaries omitted all SLP dysphagia recommendations. 47%(88/186) of patients with SLP dietary recommendations, 82%(93/114) with postural, 100%(16/16) with rehabilitation, 90%(69/77) with meal pacing, 95%(21/22) with medication, and 79%(96/122) with provider/supervision recommendations had these recommendations completely omitted from their discharge summaries. Conclusions Discharge summaries omitted all categories of SLP recommendations at notably high rates. Improved post-hospital communication strategies are needed for discharges to sub-acute care. PMID:20098999

  11. Executive summary

    International Nuclear Information System (INIS)

    2010-01-01

    The special session on Fuel cycle strategies and transition scenarios comprised three invited papers and five oral presentations: INL (USA) was invited to present US activities on fuel cycle transition scenarios; JAEA (Japan) presented the current status of the Japanese nuclear fuel cycle; CEA and EDF (France) gave a presentation on the French fuel cycle strategy and transition scenarios; CEA and INL presented the latest outcomes from the NEA activity on fuel cycle transition scenarios and the European approach; JAEA reported on the results of global scenarios for fast reactor deployment; AECL (Canada) discussed actinide transmutation in Candu reactors, which may efficiently transmute TRU; Materials assessments, which could be used in advanced nuclear fuel cycles from a safeguard perspective, were presented by LANL (USA); The technical session about Impact on P and T on waste management and geological disposal comprised one invited paper and two oral presentations: JAEA presented on the concept of waste management and geological disposal incorporating P and T technology; CIEMAT (Spain) gave a summary of the RED-IMPACT study, which is the study of the impact of P and T on the HLW management programme of the EC; Chalmers University(Sweden) presented an estimation of maximum permissible step losses in P and T processing; The technical session about Progress in transmutation fuels and targets comprised one invited paper and seven oral presentations: The invited talk of the session was given by ITU (EC), on advanced fuel fabrication processes for transmutation; INL presented the development status of transuranic-bearing metal fuels in the USA; CEA summarised European projects on design, development and qualification of advanced fuels for an industrial ADS prototype; The Japanese study of the microstructural evolution and Am migration behaviour in Am-containing MOX fuels at the initial stage of irradiation was presented by JAEA discussed Japanese status on the

  12. Inhibiting the NLRP3 Inflammasome Activation with MCC950 Ameliorates Diabetic Encephalopathy in db/db Mice

    Directory of Open Access Journals (Sweden)

    Yadong Zhai

    2018-02-01

    Full Text Available Diabetes is associated with a high risk of developing cognitive dysfunction and neuropsychiatric disabilities, and these disease symptomsare termed diabetic encephalopathy (DEP. Inflammation is involved in the development of DEP. The cleavage and maturation of the proinflammatory cytokine interleukin (IL-1β is regulated by the NLRP3 inflammasome. Obese and type 2 diabetic db/db mice show anxiety- and depression-like behaviors and cognitive disorders associated with hippocampal inflammation. The purpose of this study was to explore the role of NLRP3 inflammasome in DEP. Results showed that expression levels of inflammasome components including NLRP3, apoptosis-associated speck-like protein (ASC, and caspase-1, as well as IL-1β in the hippocampus of diabetic db/db mice were higher than those of non-diabetic db/m mice. Treatment of db/db mice with NLRP3 inflammasome inhibitor MCC950 ameliorated anxiety- and depression-like behaviors as well as cognitive dysfunction, and reversed increased NLRP3, ASC, and IL-1βexpression levels and caspase-1 activity in hippocampus. Moreover, MCC950 treatment significantly improved insulin sensitivity in db/db mice. These results demonstrate that inhibition of NLRP3 inflammasome activation may prove to be a potential therapeutic approach for DEP treatment.

  13. Resistin production from adipose tissue is decreased in db/db obese mice, and is reversed by rosiglitazone.

    Directory of Open Access Journals (Sweden)

    Hongying Ye

    Full Text Available OBJECTIVE: This study was designed to (1 investigate the expression profiles of resistin in db/db mice and its dynamic association with metabolic parameters; and (2 evaluate the effects of Rosiglitazone on production of resistin. METHODS: Db/db mice and their lean litter mates were used for this study. Epididymal fat tissue was excised from mice of different age (from 5 to 12 weeks for ex vivo incubation. Resistin,along with adiponectin,in serum and conditioned culture medium of epididymal fat pads were measured with immunoassays. The gene expression of resistin was determined by real-time PCR. Rosiglitazone or the vehicle (PBS was administered into db/db mice by daily intra-gastric gavage. Differentiated 3T3-L1 adipocytes were used for in vitro evaluation. RESULTS: The secretion of resistin from the fat pads in db/db mice was significantly lower than that in lean mice (P<0.01. The mRNA expression of the resistin gene in fat tissue of db/db mice at the age of 5 weeks was decreased by 60.5% compared to lean controls (p<0.05. Serum levels of resistin were comparable between the obese and lean groups, perhaps due to the increased total fat mass in db/db mice. Correlation analysis showed that serum resistin levels were positively correlated to resistin secretion from fat pads(r = 0.844,P = 0.000, while negatively associated with the body weight (r = -0.515, P = 0.000 and fasting glucose level (r = -0.357, P = 0.002. Notably, treatment with rosiglitazone increased the serum resistin levels by 66.4%(P<0.05in db/db mice. In 3T3-L1 adipocytes, Rosiglitazone (10 uM markedly enhanced the secretion of resistin by 120% (P<0.01 and its gene expression by 78.1% (P<0.05. CONCLUSION: Both resistin gene expression and its secretion from the epididymal adipose tissue were decreased in db/db obese mice, while the insulin-sensitizing drug rosiglitazone increased resistin production. Our results do not support the role of resistin as an

  14. Radioactive discharges and monitoring of the environment 1988

    International Nuclear Information System (INIS)

    1989-01-01

    This annual report on Radioactive Discharges and Monitoring the Environment, 1988, summarises the programmes of Sellafield, Drigg, Chapelcross, Springfields and Capenhurst for monitoring the discharges of radioactive materials to the sea and the environment. Critical groups and environmental exposure pathways are identified and collective doses to these groups estimated. The disposal of radioactive wastes at each site is discussed. Certificates of authorisation are presented. A summary of recommended doses of specific radionuclides is given. (Author)

  15. PRISMA/DB: A Parallel Main-Memory Relational DBMS

    NARCIS (Netherlands)

    Apers, Peter M.G.; Flokstra, Jan; van den Berg, Carel A.; Grefen, P.W.P.J.; Wilschut, A.N.; Kersten, Martin L.; van den Berg, C.A.

    1992-01-01

    PRISMA/DB, a full-fledged parallel, main memory relational database management system (DBMS) is described. PRISMA/DB's high performance is obtained by the use of parallelism for query processing and main memory storage of the entire database. A flexible architecture for experimenting with

  16. Comparing MongoDB to SQL Server, Replicated

    NARCIS (Netherlands)

    K. Azizi

    2014-01-01

    htmlabstractParker et al [1] studied the performance difference between MongoDB and Microsoft SQL Server on basis of a number of insert, update and select scenarios. As the result of their study, they conclude that MongoDB has got a better performance when it comes to insert, update and simple

  17. Glow discharging device

    International Nuclear Information System (INIS)

    Maeno, Katsuki; Kawasaki, Kozo; Hiratsuka, Hajime; Kawashima, Shuichi.

    1989-01-01

    In a thermonuclear device, etc. impurities adsorbed to inner walls of a vacuum vessel by glow discharge are released to clean the vacuum vessel for preventing intrusion of the impurities into plasmas. The object of the present invention is to minimize the capacity of a power source equipment for the glow discharge device to the least extent. That is, a stabilization resistance is connected in series between each of a plurality of anodes which are inserted and arranged at the inside of a vacuum vessel as a cathode and a power source respectively. The resistance value R is selected so as to satisfy the relation: R < (Vi - Vm)/Ii, in which Vi: glow discharge starting voltage, Vm: glow discharge keeping voltage, Ii: glow discharge starting current. Accordingly, if a voltage is applied from a power source to a plurality of anodes, scattering of electric discharge between the anodes can be suppressed and the effect of voltage drop during discharge by the stabilization resistance can be eliminated. As a result, it is possible to provide an economically advantageous glow discharge device with the capacity for the power source facility being to the least extent. (K.M.)

  18. CO-AXIAL DISCHARGES

    Science.gov (United States)

    Luce, J.S.; Smith, L.P.

    1960-11-22

    A method and apparatus are given for producing coaxial arc discharges in an evacuated enclosure and within a strong, confining magnetic field. The arcs are maintained at a high potential difference. Electrons will diffuse to the more positive arc from the negative arc, and positive ions will diffuse from the more positive arc to the negative arc. Coaxial arc discharges have the advantage that ions which return to strike the positive arc discharge will lose no energy since they do not strike a solid wall or electrode. Those discharges are useful in confining an ionized plasma between the discharges, and have the advantage of preventing impurities from the walls of the enclosure from entering ihe plasma area because of the arc barrier set up bv the cylindrical outer arc.

  19. Modelling electric discharge chemistry

    International Nuclear Information System (INIS)

    McFarlane, J.; Wren, J.C.

    1991-07-01

    The chemistry occurring in a electric discharge was modelled to predict how it would be influenced by discharge conditions. The discharge was characterized by a calculated Boltzmann electron-energy distribution, from which rate constants for electron-molecule processes in air were determined. These rate constants were used in a chemical kinetics calculation that also included reactions between neutral molecules, ions, free radicals and electronically excited species. The model describes how the discharge chemistry was influenced by humidity, electric field, electron number density, and concentrations of key reagents identified in the study. The use of an electric discharge to destroy airborne contaminant molecules was appraised, the targeted contaminants being CF 2 Cl 2 , HCN, and SO 2 . The modelling results indicate that an electric discharge should be able to remove HCN and CF 2 Cl 2 effectively, especially if the discharge conditions have been optimized. Effective destruction is achieved with a moderate electric field (over 1 x 10 -15 V.cm 2 ), a substantial electron number density (over 1 x 10 12 cm -3 ), and the presence of H 2 0 in the process air. The residence time in the discharge was also shown to be important in contaminant destruction. An attempt was made to explain the results of the electric discharge abatement of SO 2 , a component of a simulated flue-gas mixture. Results from the model indicate that the discharge parameters that increase the concentration of hydroxyl radical also increase the rate of decomposition of SO 2 . An objective of the study was to explain the apparent enhancement of SO 2 destruction by the presence of a small amount of NO 2 . It was thought that a likely explanation would be the stabilization of HOSO 2 , an important intermediate in the oxidation of SO 2 by NO 2 . (49 figs., 14 tabs., 75 refs.)

  20. Dapagliflozin Aggravates Renal Injury via Promoting Gluconeogenesis in db/db Mice.

    Science.gov (United States)

    Jia, Yingli; He, Jinzhao; Wang, Liang; Su, Limin; Lei, Lei; Huang, Wei; Geng, Xiaoqiang; Zhang, Shun; Meng, Xiaolu; Zhou, Hong; Yang, Baoxue

    2018-01-01

    A sodium-glucose co-transporter-2 inhibitor dapagliflozin is widely used for lowering blood glucose and its usage is limited in type 2 diabetes mellitus patients with moderate renal impairment. As its effect on kidney function is discrepant and complicated, the aim of this study is to determine the effect of dapagliflozin on the progression of diabetic nephropathy and related mechanisms. Twelve-week-old male C57BL/6 wild-type and db/db mice were treated with vehicle or 1 mg/kg dapagliflozin for 12 weeks. Body weight, blood glucose, insulin tolerance, glucose tolerance, pyruvate tolerance and 24-hour urine were measured every 4 weeks. At 24 weeks of age, renal function was evaluated by blood urea nitrogen level, creatinine clearance, urine output, urinary albumin excretion, Periodic Acid-Schiff staining, Masson's trichrome staining and electron microscopy. Changes in insulin signaling and gluconeogenic key regulatory enzymes were detected using Western blot analysis. Dapagliflozin did not alleviate but instead aggravated diabetic nephropathy manifesting as increased levels of microalbuminuria, blood urea nitrogen, and glomerular and tubular damage in db/db mice. Despite adequate glycemic control by dapagliflozin, urinary glucose excretion increased after administration before 24 weeks of age and was likely associated with renal impairment. Increased urinary glucose excretion was mainly derived from the disturbance of glucose homeostasis with elevated hepatic and renal gluconeogenesis induced by dapagliflozin. Although it had no effect on insulin sensitivity and glucose tolerance, dapagliflozin further induced the expression of gluconeogenic key rate-limiting enzymes through increasing the expression levels of FoxO1 in the kidney and liver. These experimental results indicate that dapagliflozin aggravates diabetes mellitus-induced kidney injury, mostly through increasing gluconeogenesis. © 2018 The Author(s). Published by S. Karger AG, Basel.

  1. Curcumin restores mitochondrial functions and decreases lipid peroxidation in liver and kidneys of diabetic db/db mice

    Directory of Open Access Journals (Sweden)

    María G Soto-Urquieta

    2014-01-01

    Full Text Available BACKGROUND: Nitrosative and oxidative stress play a key role in obesity and diabetes-related mitochondrial dysfunction. The objective was to investigate the effect of curcumin treatment on state 3 and 4 oxygen consumption, nitric oxide (NO synthesis, ATPase activity and lipid oxidation in mitochondria isolated from liver and kidneys of diabetic db/db mice. RESULTS: Hyperglycaemia increased oxygen consumption and decreased NO synthesis in liver mitochondria isolated from diabetic mice relative to the control mice. In kidney mitochondria, hyperglycaemia increased state 3 oxygen consumption and thiobarbituric acid-reactive substances (TBARS levels in diabetic mice relative to control mice. Interestingly, treating db/db mice with curcumin improved or restored these parameters to normal levels; also curcumin increased liver mitochondrial ATPase activity in db/db mice relative to untreated db/db mice. CONCLUSIONS: These findings suggest that hyperglycaemia modifies oxygen consumption rate, NO synthesis and increases TBARS levels in mitochondria from the liver and kidneys of diabetic mice, whereas curcumin may have a protective role against these alterations.

  2. ToxRefDB - Release user-friendly web-based tool for mining ToxRefDB

    Science.gov (United States)

    The updated URL link is for a table of NCCT ToxCast public datasets. The next to last row of the table has the link for the US EPA ToxCast ToxRefDB Data Release October 2014. ToxRefDB provides detailed chemical toxicity data in a publically accessible searchable format. ToxRefD...

  3. Resistin production from adipose tissue is decreased in db/db obese mice, and is reversed by rosiglitazone.

    Science.gov (United States)

    Ye, Hongying; Zhang, Herbert J; Xu, Aimin; Hoo, Ruby L C

    2013-01-01

    This study was designed to (1) investigate the expression profiles of resistin in db/db mice and its dynamic association with metabolic parameters; and (2) evaluate the effects of Rosiglitazone on production of resistin. Db/db mice and their lean litter mates were used for this study. Epididymal fat tissue was excised from mice of different age (from 5 to 12 weeks) for ex vivo incubation. Resistin,along with adiponectin,in serum and conditioned culture medium of epididymal fat pads were measured with immunoassays. The gene expression of resistin was determined by real-time PCR. Rosiglitazone or the vehicle (PBS) was administered into db/db mice by daily intra-gastric gavage. Differentiated 3T3-L1 adipocytes were used for in vitro evaluation. The secretion of resistin from the fat pads in db/db mice was significantly lower than that in lean mice (Plean controls (plean groups, perhaps due to the increased total fat mass in db/db mice. Correlation analysis showed that serum resistin levels were positively correlated to resistin secretion from fat pads(r = 0.844,P = 0.000), while negatively associated with the body weight (r = -0.515, P = 0.000) and fasting glucose level (r = -0.357, P = 0.002). Notably, treatment with rosiglitazone increased the serum resistin levels by 66.4%(Pproduction. Our results do not support the role of resistin as an etiological link between obesity and diabetes.

  4. Discharge lamp technologies

    Science.gov (United States)

    Dakin, James

    1994-01-01

    This talk is an overview of discharge lamp technology commonly employed in general lighting, with emphasis on issues pertinent to lighting for plant growth. Since the audience is primarily from the plant growth community, and this begins the light source part of the program, we will start with a brief description of the discharge lamps. Challenges of economics and of thermal management make lamp efficiency a prime concern in controlled environment agriculture, so we will emphasize science considerations relating to discharge lamp efficiency. We will then look at the spectra and ratings of some representative lighting products, and conclude with a discussion of technological advances.

  5. Capacitor discharge engineering

    CERN Document Server

    Früngel, Frank B A

    1976-01-01

    High Speed Pulse Technology, Volume III: Capacitor Discharge Engineering covers the production and practical application of capacitor dischargers for the generation and utilization of high speed pulsed of energy in different forms. This nine-chapter volume discusses the principles of electric current, voltage, X-rays, gamma rays, heat, beams of electrons, neutrons and ions, magnetic fields, sound, and shock waves in gases and liquids. Considerable chapters consider the applications of capacitor discharges, such as impulse hardening of steel, ultrapulse welding of precision parts, X-ray flash t

  6. Predicting tile drainage discharge

    DEFF Research Database (Denmark)

    Iversen, Bo Vangsø; Kjærgaard, Charlotte; Petersen, Rasmus Jes

    used in the analysis. For the dynamic modelling, a simple linear reservoir model was used where different outlets in the model represented tile drain as well as groundwater discharge outputs. This modelling was based on daily measured tile drain discharge values. The statistical predictive model...... was based on a polynomial regression predicting yearly tile drain discharge values using site specific parameters such as soil type, catchment topography, etc. as predictors. Values of calibrated model parameters from the dynamic modelling were compared to the same site specific parameter as used...

  7. Using computerized provider order entry to enforce documentation of tests with pending results at hospital discharge.

    Science.gov (United States)

    Cadwallader, J; Asirwa, C; Li, X; Kesterson, J; Tierney, W M; Were, M C

    2012-01-01

    Small numbers of tests with pending results are documented in hospital discharge summaries leading to breakdown in communication and medical errors due to inadequate followup. Evaluate effect of using a computerized provider order entry (CPOE) system to enforce documentation of tests with pending results into hospital discharge summaries. We assessed the percent of all tests with pending results and those with actionable results that were documented before (n = 182 discharges) and after (n = 203 discharges) implementing the CPOE-enforcement tool. We also surveyed providers (n = 52) about the enforcement functionality. Documentation of all tests with pending results improved from 12% (87/701 tests) before to 22% (178/812 tests) (p = 0.02) after implementation. Documentation of tests with eventual actionable results increased from 0% (0/24) to 50% (14/28)(ppending results into discharge summaries significantly increased documentation rates, especially of actionable tests. However, gaps in documentation still exist.

  8. Electric discharge during electrosurgery.

    Science.gov (United States)

    Shashurin, Alexey; Scott, David; Zhuang, Taisen; Canady, Jerome; Beilis, Isak I; Keidar, Michael

    2015-04-16

    Electric discharge utilized for electrosurgery is studied by means of a recently developed method for the diagnostics of small-size atmospheric plasma objects based on Rayleigh scattering of microwaves on the plasma volume. Evolution of the plasma parameters in the near-electrode sheaths and in the positive column is measured and analyzed. It is found that the electrosurgical system produces a glow discharge of alternating current with strongly contracted positive column with current densities reaching 10(3) A/cm(2). The plasma electron density and electrical conductivities in the channel were found be 10(16) cm(-3) and (1-2) Ohm(-1) cm(-1), respectively. The discharge interrupts every instance when the discharge-driving AC voltage crosses zero and re-ignites again every next half-wave at the moment when the instant voltage exceeds the breakdown threshold.

  9. Vaginal delivery - discharge

    Science.gov (United States)

    Pregnancy - discharge after vaginal delivery ... You may have bleeding from your vagina for up to 6 weeks. Early on, you may pass some small clots when you first get up. Bleeding will slowly become ...

  10. Prostate radiation - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000399.htm Prostate radiation - discharge To use the sharing features on ... keeping or getting an erection may occur after prostate radiation therapy. You may not notice this problem ...

  11. Brain injury - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000163.htm Brain injury - discharge To use the sharing features on ... know was in the hospital for a serious brain injury. At home, it will take time for ...

  12. Brain aneurysm repair - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000123.htm Brain aneurysm repair - discharge To use the sharing features ... this page, please enable JavaScript. You had a brain aneurysm . An aneurysm is a weak area in ...

  13. Brain radiation - discharge

    Science.gov (United States)

    Radiation - brain - discharge; Cancer - brain radiation; Lymphoma - brain radiation; Leukemia - brain radiation ... Decadron) while you are getting radiation to the brain. It may make you hungrier, cause leg swelling ...

  14. Atrial fibrillation - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000237.htm Atrial fibrillation - discharge To use the sharing features on this ... have been in the hospital because you have atrial fibrillation . This condition occurs when your heart beats faster ...

  15. Pneumonia - adults - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000017.htm Pneumonia in adults - discharge To use the sharing features on this page, please enable JavaScript. You have pneumonia, which is an infection in your lungs. In ...

  16. Knee arthroscopy - discharge

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/patientinstructions/000199.htm Knee arthroscopy - discharge To use the sharing features on this ... surgery to treat problems in your knee (knee arthroscopy). You may have been checked for: Torn meniscus. ...

  17. Cosmetic breast surgery - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000273.htm Cosmetic breast surgery - discharge To use the sharing features on this page, please enable JavaScript. You had cosmetic breast surgery to change the size or shape ...

  18. Shoulder surgery - discharge

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000179.htm Shoulder surgery - discharge To use the sharing features on this page, please enable JavaScript. You had shoulder surgery to repair the tissues inside or around your ...

  19. Discharges for lighting

    International Nuclear Information System (INIS)

    Stoffels, W W; Nimalasuriya, T; Flikweert, A J; Mulders, H C J

    2007-01-01

    The most common man-made discharge is a lamp. Even though lamps are often considered a mature technology, the discharge physics is often poorly understood. Two recent initiatives discussed here show that plasma research can help to make significant improvements. First we discuss color separation in metal halide lamps, which is a problem that prevents these highly efficient lamps from being used in more applications. Secondly a novel lamp concept is presented that may replace the current mercury based fluorescent lamps

  20. Molecular signatures database (MSigDB) 3.0.

    Science.gov (United States)

    Liberzon, Arthur; Subramanian, Aravind; Pinchback, Reid; Thorvaldsdóttir, Helga; Tamayo, Pablo; Mesirov, Jill P

    2011-06-15

    Well-annotated gene sets representing the universe of the biological processes are critical for meaningful and insightful interpretation of large-scale genomic data. The Molecular Signatures Database (MSigDB) is one of the most widely used repositories of such sets. We report the availability of a new version of the database, MSigDB 3.0, with over 6700 gene sets, a complete revision of the collection of canonical pathways and experimental signatures from publications, enhanced annotations and upgrades to the web site. MSigDB is freely available for non-commercial use at http://www.broadinstitute.org/msigdb.

  1. Discharge lamp technologies

    Energy Technology Data Exchange (ETDEWEB)

    Dakin, J. [GE Lighting, Cleveland, OH (United States)

    1994-12-31

    This talk is an overview of discharge lamp technology commonly employed in general lighting, with emphasis on issues pertinent to lighting for plant growth. Since the audience is primarily from the plant growth community, and this begins the light source part of the program, we will start with a brief description of the discharge lamps. Challenges of economics and of thermal management make lamp efficiency a prime concern in controlled environment agriculture, so we will emphasize science considerations relating to discharge lamp efficiency. We will then look at the spectra and ratings of some representative lighting products, and conclude with a discussion of technological advance. A general overview of discharge lighting technology can be found in the book of Waymouth (1971). A recent review of low pressure lighting discharge science is found in Dakin (1991). The pioneering paper of Reiling (1964) provides a good introduction to metal halide discharges. Particularly relevant to lighting for plant growth, a recent and thorough treatment of high pressure Na lamps is found in the book by deGroot and vanVliet (1986). Broad practical aspects of lighting application are thoroughly covered in the IES Lighting Handbook edited by Kaufman (1984).

  2. Chaos in gas discharges

    International Nuclear Information System (INIS)

    Piel, A.

    1993-01-01

    Many gas discharges exhibit natural oscillations which undergo a transition from regular to chaotic behavior by changing an experimental parameter or by applying external modulation. Besides several isolated investigations, two classes of discharge phenomena have been studied in more detail: ionization waves in medium pressure discharges and potential relaxation oscillations in filament cathode discharges at very low pressure. The latter phenomenon will be discussed by comparing experimental results from different discharge arrangements with particle-in-cell simulations and with a model based on the van-der-Pol equation. The filament cathode discharge has two stable modes of operation: the low current anode-glow-mode and the high current temperature-limited-mode, which form the hysteresis curve in the I(U) characteristics. Close to the hysteresis point of the AGM periodic relaxation oscillations occur. The authors demonstrate that the AGM can be understood by ion production in the anode layer, stopping of ions by charge exchange, and trapping in the virtual cathode around the filament. The relaxation oscillations consist of a slow filling phase and a rapid phase that invokes formation of an unstable double-layer, current-spiking, and ion depletion from the cathodic plasma. The relaxation oscillations can be mode-locked by external modulation. Inside a mode-locked state, a period doubling cascade is observed at high modulation degree

  3. AFM-based detection of glycocalyx degradation and endothelial stiffening in the db/db mouse model of diabetes.

    Science.gov (United States)

    Targosz-Korecka, Marta; Jaglarz, Magdalena; Malek-Zietek, Katarzyna E; Gregorius, Aleksandra; Zakrzewska, Agnieszka; Sitek, Barbara; Rajfur, Zenon; Chlopicki, Stefan; Szymonski, Marek

    2017-11-21

    Degradation of the glycocalyx and stiffening of endothelium are important pathophysiological components of endothelial dysfunction. However, to our knowledge, these events have not been investigated in tandem in experimental diabetes. Here, the mechanical properties of the glycocalyx and endothelium in ex vivo mouse aorta were determined simultaneously in indentation experiments with an atomic force microscope (AFM) for diabetic db/db and control db/+ mice at ages of 11-19 weeks. To analyze highly heterogeneous aorta samples, we developed a tailored classification procedure of indentation data based on a bi-layer brush model supplemented with Hertz model for quantification of nanomechanics of endothelial regions with and without the glycocalyx surface. In db/db mice, marked endothelial stiffening and reduced glycocalyx coverage were present already in 11-week-old mice and persisted in older animals. In contrast, reduction of the effective glycocalyx length was progressive and was most pronounced in 19-week-old db/db mice. The reduction of the glycocalyx length correlated with an increasing level of glycated haemoglobin and decreased endothelial NO production. In conclusion, AFM nanoindentation analysis revealed that stiffening of endothelial cells and diminished glycocalyx coverage occurred in early diabetes and were followed by the reduction of the glycocalyx length that correlated with diabetes progression.

  4. Dicty_cDB: Contig-U04605-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 46 2.2 1 ( DB766622 ) Apis mellifera head cDNA, RIKEN full-length enric... 46 2.2 1 ( FG291142 ) 1108793330728 New World... Screwworm Egg 9261 ESTs C... 46 2.2 1 ( FG290464 ) 1108793321772 New World... Screwworm Egg 9261 ESTs C... 46 2.2 1 ( FG288754 ) 1108793276247 New World Screwworm Egg 9261 ESTs ...C... 46 2.2 1 ( FG285961 ) 1108770710727 New World Screwworm Egg 9261 ESTs C... 46 2.2 1 ( CT030663 ) Mouse ..._142_D08_3APR2008_058 BN18DYSC Brassic... 44 8.7 1 ( FG286796 ) 1108770726415 New World

  5. Dicty_cDB: Contig-U16487-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ( DW406563 ) EST000984 Trichophyton rubrum cDNA library Tricho... 72 1e-17 4 ( FL496835 ) Mg_Nor01_07E06 Nor01 Myti... stress library Fra... 101 6e-18 3 ( DB668091 ) Saccharomyces cerevisiae mRNA, clon...isia annua normalized leaf... 62 2e-15 4 ( DW680253 ) EST003734 Trichophyton rubrum cDNA library 0 Tric... 7...R946874 ) EST1138413 Aquilegia cDNA library Aquilegia formo... 66 5e-10 2 ( FC787763 ) CBGC17953.fwd CBGC Lotti...:VS... 293 9e-75 1 ( DT758323 ) EST1192172 Aquilegia cDNA library Aquilegia formo

  6. StarDB: a large-scale DBMS for strings

    KAUST Repository

    Sahli, Majed

    2015-08-01

    Strings and applications using them are proliferating in science and business. Currently, strings are stored in file systems and processed using ad-hoc procedural code. Existing techniques are not flexible and cannot efficiently handle complex queries or large datasets. In this paper, we demonstrate StarDB, a distributed database system for analytics on strings. StarDB hides data and system complexities and allows users to focus on analytics. It uses a comprehensive set of parallel string operations and provides a declarative query language to solve complex queries. StarDB automatically tunes itself and runs with over 90% efficiency on supercomputers, public clouds, clusters, and workstations. We test StarDB using real datasets that are 2 orders of magnitude larger than the datasets reported by previous works.

  7. Eukaryotic Pathogen Database Resources (EuPathDB)

    Data.gov (United States)

    U.S. Department of Health & Human Services — EuPathDB Bioinformatics Resource Center for Biodefense and Emerging/Re-emerging Infectious Diseases is a portal for accessing genomic-scale datasets associated with...

  8. aetiological agents of ear discharge: a two year re- view in a ...

    African Journals Online (AJOL)

    2014-06-01

    Jun 1, 2014 ... SUMMARY. Background: The discharging ear is a common presentation in medical practice affecting all age groups but primarily children. This study shows the current aetiological causes of ear discharge and their antibiograms, data which would guide empirical treat- ment of ear infections, and also form ...

  9. DB2 10.1 fundamentals certification study guide

    CERN Document Server

    Sanders, Roger E

    2014-01-01

    Beginning with an explanation of the certification process and working through fundamental exam objectives, this guide gives test-takers all they need to know to pass IBM's DB2 10.1 Fundamentals certification exam (Exam 610). All the subjects covered on the exam are included: planning, security, data concurrency, working with databases and database objects, working with data using SQL and XQuery, working with DB2 tables, views, and indexes-and more. The book concludes with an

  10. GigaDB: announcing the GigaScience database

    Directory of Open Access Journals (Sweden)

    Sneddon Tam P

    2012-07-01

    Full Text Available Abstract With the launch of GigaScience journal, here we provide insight into the accompanying database GigaDB, which allows the integration of manuscript publication with supporting data and tools. Reinforcing and upholding GigaScience’s goals to promote open-data and reproducibility of research, GigaDB also aims to provide a home, when a suitable public repository does not exist, for the supporting data or tools featured in the journal and beyond.

  11. License - Plabrain DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us Plabrain... Alike 2.1 Japan . If you use data from this database, please be sure attribute this database as follows: Plabrain...of this database (http://dbarchive.lifesciencedb.jp/english/en/plabrain-db/desc.html) in the article or pape...se Description Download License Update History of This Database Site Policy | Contact Us License - Plabrain DB | LSDB Archive ...

  12. NGSmethDB 2017: enhanced methylomes and differential methylation

    Science.gov (United States)

    Lebrón, Ricardo; Gómez-Martín, Cristina; Carpena, Pedro; Bernaola-Galván, Pedro; Barturen, Guillermo; Hackenberg, Michael; Oliver, José L.

    2017-01-01

    The 2017 update of NGSmethDB stores whole genome methylomes generated from short-read data sets obtained by bisulfite sequencing (WGBS) technology. To generate high-quality methylomes, stringent quality controls were integrated with third-part software, adding also a two-step mapping process to exploit the advantages of the new genome assembly models. The samples were all profiled under constant parameter settings, thus enabling comparative downstream analyses. Besides a significant increase in the number of samples, NGSmethDB now includes two additional data-types, which are a valuable resource for the discovery of methylation epigenetic biomarkers: (i) differentially methylated single-cytosines; and (ii) methylation segments (i.e. genome regions of homogeneous methylation). The NGSmethDB back-end is now based on MongoDB, a NoSQL hierarchical database using JSON-formatted documents and dynamic schemas, thus accelerating sample comparative analyses. Besides conventional database dumps, track hubs were implemented, which improved database access, visualization in genome browsers and comparative analyses to third-part annotations. In addition, the database can be also accessed through a RESTful API. Lastly, a Python client and a multiplatform virtual machine allow for program-driven access from user desktop. This way, private methylation data can be compared to NGSmethDB without the need to upload them to public servers. Database website: http://bioinfo2.ugr.es/NGSmethDB. PMID:27794041

  13. Inpatient Prospective Payment System (IPPS) Provider Summary for the Top 100 Diagnosis-Related Groups (DRG)

    Data.gov (United States)

    U.S. Department of Health & Human Services — A provider level summary of Inpatient Prospective Payment System (IPPS) discharges, average charges and average Medicare payments for the Top 100 Diagnosis-Related...

  14. Tangshen formula attenuates hepatic steatosis by inhibiting hepatic lipogenesis and augmenting fatty acid oxidation in db/db mice.

    Science.gov (United States)

    Kong, Qin; Zhang, Haojun; Zhao, Tingting; Zhang, Weiku; Yan, Meihua; Dong, Xi; Li, Ping

    2016-12-01

    Tangshen formula (TSF), a well-prescribed traditional Chinese formula, has been used in the treatment of diabetic nephropathy. However, whether TSF ameliorates dyslipidemia and liver injury associated with diabetes remains unclear. In this study, we examined the effects of TSF on lipid profiles and hepatic steatosis in db/db mice. For this purpose, 8‑week-old db/db mice were treated with TSF or saline for 12 weeks via gavage and db/m mice were used as controls. Body weight and blood glucose levels were monitored weekly and bi-weekly, respectively. Blood samples were obtained for the analysis of lipids and enzymes related to hepatic function, and liver tissues were analyzed by histology, immunohistochemistry and molecular examination. The results revealed that TSF markedly reduced body weight, liver index [liver/body weight (LW/BW)] and improved lipid profiles, hepatic function and steatosis in db/db mice. TSF induced the phosphoralation of AMP-activated protein kinase and inhibited the activity of sterol regulatory element-binding protein 1 together with the inhibition of the expression of genes involved in de novo lipogenesis (DNL) and gluconeogenesis, such as fatty acid synthase (FAS), acetyl-CoA carboxylase (ACC), stearoyl CoA desaturase 1 (SCD1), glucose-6-phosphatase (G6pc) and phosphoenolpyruvate carboxykinase 1 (Pck1). Additionally, the silent mating type information regulation 2 homolog 1 (Sirt1)/peroxisome proliferator-activated receptor α (PPARα)/malonyl-CoA decarboxylase (MLYCD) cascade was potently activated by TSF in the liver and skeletal muscle of db/db mice, which led to enhanced fatty acid oxidation. These findings demonstrated that TSF attenuated hepatic fat accumulation and steatosis in db/db mice by inhibiting lipogenesis and augmenting fatty acid oxidation.

  15. Qing-Hua Granule induces GLP-1 secretion via bitter taste receptor in db/db mice.

    Science.gov (United States)

    Li, Junyan; Xu, Jie; Hou, Ruifang; Jin, Xin; Wang, Jingyi; Yang, Na; Yang, Li; Liu, Li; Tao, Feng; Lu, Hao

    2017-05-01

    Qing-Hua Granule (QHG), the modified formulation of a classical Chinese prescription named Gegen Qinlian Decoction, was clinically employed to treat type 2 diabetes mellitus (T2DM) through regulation of glucagon-like peptide-1 (GLP-1). However, the potential mechanism is unknown. We investigate whether QHG induces GLP-1 secretion via activation of bitter taste receptor (TAS2R) pathway in the gastrointestinal tract of db/db mice. The db/db mice were intragastrically (i.g.) administered QHG (low/medium/high dose) once daily for 8 weeks. GLP-1 secretion was evaluated. The bitter receptor signaling pathway, which regulates GLP-1 secretion, including TAS2R5 (a subtype of TAS2R), α-gustducin (Gαgust), 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase beta-2 (PLCβ2), transient receptor potential cation channel subfamily M member 5 (TRPM5), was assessed by quantitative real-time polymerase chain reaction (qRT-PCR), Western blot and immunohistochemistry (IHC). The biochemical observations of ileum and pancreas tissue were detected histopathologically. Acquity Ultra Performance LCTM - Micromass ZQ 2000 (UPLC-MS) was used for the phytochemical analysis. QHG exhibited significant and dose-dependent effect on GLP-1 secretion in db/db mice, along with significant up-regulation of TAS2R5 mRNA level and activation of TAS2R pathway (p<0.05). In addition, QHG improved the histopathological structure of ileum and pancreatic tissue. Seventeen compounds were identified in QHG. In conclusion, QHG induces GLP-1 secretion in db/db mice, most likely through the bitter taste receptor pathway. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  16. Tangshen Formula Attenuates Diabetic Nephropathy by Promoting ABCA1-Mediated Renal Cholesterol Efflux in db/db Mice.

    Science.gov (United States)

    Liu, Peng; Peng, Liang; Zhang, Haojun; Tang, Patrick Ming-Kuen; Zhao, Tingting; Yan, Meihua; Zhao, Hailing; Huang, Xiaoru; Lan, Huiyao; Li, Ping

    2018-01-01

    The commonly prescribed Tangshen Formula (TSF) is a traditional Chinese formulation that has been shown to reduce plasma lipid metabolism and proteinuria and improve the estimated glomerular filtration rate (eGFR) in patients with diabetic kidney disease. This study investigated the underlying mechanism whereby TSF regulates renal lipid accumulation and ameliorates diabetic renal injuries in spontaneous diabetic db/db mice and in vitro in sodium palmitate (PA)-stimulated and Abca1-SiRNA-transfected mouse tubular epithelial cells (mTECs). The results revealed that TSF treatment significantly ameliorated the renal injuries by lowering urinary albumin excretion and improving renal tissue injuries in diabetic (db/db) mice. Interestingly, the treatment with TSF also resulted in decreased cholesterol levels in the renal tissues of db/db mice, which was associated with increased expression of the peroxisome proliferator-activated receptor γ coactivator 1-α (PGC-1α), the Liver X receptors (LXR), and ATP-binding cassette subfamily A member 1 (ABCA1), suggesting that TSF might attenuate diabetic kidney injury via a mechanism associated with improving cholesterol efflux in the diabetic kidney. This was investigated in vitro in mTECs, and the results showed that TSF reduced the PA-stimulated cholesterol accumulation in mTECs. Mechanistically, the addition of TSF was capable of reversing PA-induced downregulation of PGC-1α, LXR, and ABCA1 expression and cholesterol accumulation in mTECs, suggesting that TSF might act the protection via the PGC-1α-LXR-ABCA1 pathway to improve the cholesterol efflux in the renal tissues of db/db mice. This was further confirmed by silencing ABCA1 to block the promotive effect of TSF on cholesterol efflux in vitro . In conclusion, TSF might ameliorate diabetic kidney injuries by promoting ABCA1-mediated renal cholesterol efflux.

  17. Night-time restricted feeding normalises clock genes and Pai-1 gene expression in the db/db mouse liver.

    Science.gov (United States)

    Kudo, T; Akiyama, M; Kuriyama, K; Sudo, M; Moriya, T; Shibata, S

    2004-08-01

    An increase in PAI-1 activity is thought to be a key factor underlying myocardial infarction. Mouse Pai-1 (mPai-1) activity shows a daily rhythm in vivo, and its transcription seems to be controlled not only by clock genes but also by humoral factors such as insulin and triglycerides. Thus, we investigated daily clock genes and mPai-1 mRNA expression in the liver of db/db mice exhibiting high levels of glucose, insulin and triglycerides. Locomotor activity was measured using an infrared detection system. RT-PCR or in situ hybridisation methods were applied to measure gene expression. Humoral factors were measured using measurement kits. The db/ db mice showed attenuated locomotor activity rhythms. The rhythmic expression of mPer2 mRNA was severely diminished and the phase of mBmal1 oscillation was advanced in the db/db mouse liver, whereas mPai-1 mRNA was highly and constitutively expressed. Night-time restricted feeding led to a recovery not only from the diminished locomotor activity, but also from the diminished Per2 and advanced mBmal1 mRNA rhythms. Expression of mPai-1 mRNA in db/db mice was reduced to levels far below normal. Pioglitazone treatment slightly normalised glucose and insulin levels, with a slight reduction in mPai-1 gene expression. We demonstrated that Type 2 diabetes impairs the oscillation of the peripheral oscillator. Night-time restricted feeding rather than pioglitazone injection led to a recovery from the diminished locomotor activity, and altered oscillation of the peripheral clock and mPai-1 mRNA rhythm. Thus, we conclude that scheduled restricted food intake may be a useful form of treatment for diabetes.

  18. Multipactor discharge apparatus

    International Nuclear Information System (INIS)

    1976-01-01

    The invention deals with a multipactor discharge apparatus which can be used for tuning microwave organs such as magnetron oscillators and other cavity resonators. This apparatus is suitable for delivering an improved tuning effect in a resonation organ wherefrom the working frequency must be set. This apparatus is equipped with two multipactor discharge electrodes set in a configuration such to that a net current flows from one electrode to another. These electrodes are parallel and flat. The apparatus can be used in magnetron devices as well for continuous waves as for impulses

  19. Red herring vaginal discharge.

    Science.gov (United States)

    Lee, Jun Hee; Pringle, Kirsty; Rajimwale, Ashok

    2013-09-18

    Labial hair tourniquet syndrome is a rare condition that can be easily misdiagnosed and ultimately lead to irreversible damage. An 11-year-old premenarche girl presented with a 5-day history of pain and swelling in the labia with associated vaginal discharge. The general practitioner treated her with clotrimazole without improvement. On examination, there was an oedematous swelling of the right labia with a proximal hair tourniquet. Local anaesthetic was applied and the hair removed with forceps. There was instant relief of pain and the discharge stopped within 24 h. The patient was sent home with a course of antibiotics.

  20. Travelling-wave-sustained discharges

    International Nuclear Information System (INIS)

    Schlueter, Hans; Shivarova, Antonia

    2007-01-01

    This review is on discharges maintained by travelling waves: new plasma sources, discovered in 1974 and considered as a prototype of the gas discharges according to their definition as nonlinear systems which unify in a self-consistent manner plasmas and fields. In the presentation here of the fluid-plasma models of the diffusion-controlled regime of the travelling-wave-sustained discharges (TWSDs), the basic features of the discharge maintenance-the discharge self-consistency and the electron heating in the high-frequency field-are stressed. Operation of stationary and pulsed discharges, discharge maintenance without and in external magnetic fields as well as discharge production in different gases (argon, helium, helium-argon gas mixtures and hydrogen) are covered. Modulation instability of diffusion-controlled discharges and discharge filamentation at higher gas pressures are also included in the review. Experimental findings which motivate aspects of the reported modelling are pointed out

  1. FEMA Disaster Declarations Summary

    Data.gov (United States)

    Department of Homeland Security — The FEMA Disaster Declarations Summary is a summarized dataset describing all federally declared disasters, starting with the first disaster declaration in 1953,...

  2. Anti-diabetic effect of amorphastilbol through PPARα/γ dual activation in db/db mice

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Woojung; Ham, Jungyeob; Kwon, Hak Cheol [Natural Medicine Center, KIST Gangneung Institute, Gangneung 210-340 (Korea, Republic of); Kim, Yong Kee, E-mail: yksnbk@sookmyung.ac.kr [College of Pharmacy, Sookmyung Women’s University, Seoul 140-742 (Korea, Republic of); Kim, Su-Nam, E-mail: snkim@kist.re.kr [Natural Medicine Center, KIST Gangneung Institute, Gangneung 210-340 (Korea, Republic of)

    2013-03-01

    Highlights: ► Amorphastilbol stimulates the transcriptional activities of both PPARα and PPARγ. ► Amorphastilbol improves glucose and lipid impairment in db/db mice. ► There are no side effects, such as hepatomegaly, in amorphastilbol-treated mice. ► Amorphastilbol can be used as a potential therapeutic agent against T2DM. - Abstract: Peroxisome proliferator-activated receptors (PPARs) have been considered as desirable targets for metabolic syndrome treatments, even though their specific agonists have several side effects, including body weight gain, edema, and tissue failure. The effects of amorphastilbol (APH) on glucose- and lipid metabolism were investigated with in vitro 3T3-L1 adipocyte systems and in vivo db/db mice model. APH selectively stimulates the transcriptional activities of both PPARα and PPARγ, which are able to enhance fatty acid oxidation and glucose utilization. Furthermore, APH improves glucose and lipid impairment in db/db mice. More importantly, there are no significant side effects, such as weight gain or hepatomegaly, in APH-treated animals, implying that APH do not adversely affect liver or lipid metabolism. All our data suggest that APH can be used as potential therapeutic agents against type 2 diabetes and related metabolic disorders, including obesity, by enhancing glucose and lipid metabolism.

  3. Pitavastatin suppresses diethylnitrosamine-induced liver preneoplasms in male C57BL/KsJ-db/db obese mice

    International Nuclear Information System (INIS)

    Shimizu, Masahito; Tanaka, Takuji; Moriwaki, Hisataka; Yasuda, Yoichi; Sakai, Hiroyasu; Kubota, Masaya; Terakura, Daishi; Baba, Atsushi; Ohno, Tomohiko; Kochi, Takahiro; Tsurumi, Hisashi

    2011-01-01

    Obesity and related metabolic abnormalities, including inflammation and lipid accumulation in the liver, play a role in liver carcinogenesis. Adipocytokine imbalances, such as decreased serum adiponectin levels, are also involved in obesity-related liver tumorigenesis. In the present study, we examined the effects of pitavastatin - a drug used for the treatment of hyperlipidemia - on the development of diethylnitrosamine (DEN)-induced liver preneoplastic lesions in C57BL/KsJ-db/db (db/db) obese mice. Male db/db mice were administered tap water containing 40 ppm DEN for 2 weeks and were subsequently fed a diet containing 1 ppm or 10 ppm pitavastatin for 14 weeks. At sacrifice, feeding with 10 ppm pitavastatin significantly inhibited the development of hepatic premalignant lesions, foci of cellular alteration, as compared to that in the untreated group by inducing apoptosis, but inhibiting cell proliferation. Pitavastatin improved liver steatosis and activated the AMPK-α protein in the liver. It also decreased free fatty acid and aminotransferases levels, while increasing adiponectin levels in the serum. The serum levels of tumor necrosis factor (TNF)-α and the expression of TNF-α and interleukin-6 mRNAs in the liver were decreased by pitavastatin treatment, suggesting attenuation of the chronic inflammation induced by excess fat deposition. Pitavastatin is effective in inhibiting the early phase of obesity-related liver tumorigenesis and, therefore, may be useful in the chemoprevention of liver cancer in obese individuals

  4. DPP-4 inhibitor des-F-sitagliptin treatment increased insulin exocytosis from db/db mice {beta} cells

    Energy Technology Data Exchange (ETDEWEB)

    Nagamatsu, Shinya, E-mail: shinya@ks.kyorin-u.ac.jp [Department of Biochemistry, Kyorin University School of Medicine, Mitaka, Tokyo 181-8611 (Japan); Ohara-Imaizumi, Mica; Nakamichi, Yoko; Aoyagi, Kyota; Nishiwaki, Chiyono [Department of Biochemistry, Kyorin University School of Medicine, Mitaka, Tokyo 181-8611 (Japan)

    2011-09-09

    Highlights: {yields} Anti-diabetic new drug, DPP-4 inhibitor, can affect the insulin exocytosis. {yields} DPP-4 inhibitor treatment altered syntaxin 1 expression. {yields} Treatment of db/db mice with DPP-4 inhibitor increased insulin release. -- Abstract: Incretin promotes insulin secretion acutely. Recently, orally-administered DPP-4 inhibitors represent a new class of anti-hyperglycemic agents. Indeed, inhibitors of dipeptidyl peptidase-IV (DPP-4), sitagliptin, has just begun to be widely used as therapeutics for type 2 diabetes. However, the effects of sitagliptin-treatment on insulin exocytosis from single {beta}-cells are yet unknown. We therefore investigated how sitagliptin-treatment in db/db mice affects insulin exocytosis by treating db/db mice with des-F-sitagliptin for 2 weeks. Perfusion studies showed that 2 weeks-sitagliptin treatment potentiated insulin secretion. We then analyzed insulin granule motion and SNARE protein, syntaxin 1, by TIRF imaging system. TIRF imaging of insulin exocytosis showed the increased number of docked insulin granules and increased fusion events from them during first-phase release. In accord with insulin exocytosis data, des-F-sitagliptin-treatment increased the number of syntaxin 1 clusters on the plasma membrane. Thus, our data demonstrated that 2-weeks des-F-sitagliptin-treatment increased the fusion events of insulin granules, probably via increased number of docked insulin granules and that of syntaxin 1 clusters.

  5. Anti-diabetic effect of amorphastilbol through PPARα/γ dual activation in db/db mice

    International Nuclear Information System (INIS)

    Lee, Woojung; Ham, Jungyeob; Kwon, Hak Cheol; Kim, Yong Kee; Kim, Su-Nam

    2013-01-01

    Highlights: ► Amorphastilbol stimulates the transcriptional activities of both PPARα and PPARγ. ► Amorphastilbol improves glucose and lipid impairment in db/db mice. ► There are no side effects, such as hepatomegaly, in amorphastilbol-treated mice. ► Amorphastilbol can be used as a potential therapeutic agent against T2DM. - Abstract: Peroxisome proliferator-activated receptors (PPARs) have been considered as desirable targets for metabolic syndrome treatments, even though their specific agonists have several side effects, including body weight gain, edema, and tissue failure. The effects of amorphastilbol (APH) on glucose- and lipid metabolism were investigated with in vitro 3T3-L1 adipocyte systems and in vivo db/db mice model. APH selectively stimulates the transcriptional activities of both PPARα and PPARγ, which are able to enhance fatty acid oxidation and glucose utilization. Furthermore, APH improves glucose and lipid impairment in db/db mice. More importantly, there are no significant side effects, such as weight gain or hepatomegaly, in APH-treated animals, implying that APH do not adversely affect liver or lipid metabolism. All our data suggest that APH can be used as potential therapeutic agents against type 2 diabetes and related metabolic disorders, including obesity, by enhancing glucose and lipid metabolism

  6. Pluronic L-81 ameliorates diabetic symptoms in db/db mice through transcriptional regulation of microsomal triglyceride transfer protein

    Science.gov (United States)

    Au, Wo-Shing; Lu, Li-Wei; Tam, Sidney; Ko, Otis King Hung; Chow, Billy KC; He, Ming-Liang; Ng, Samuel S; Yeung, Chung-Man; Liu, Ching-Chiu; Kung, Hsiang-Fu; Lin, Marie C

    2009-01-01

    AIM: To test whether oral L-81 treatment could improve the condition of mice with diabetes and to investigate how L-81 regulates microsomal triglyceride transfer protein (MTP) activity in the liver. METHODS: Genetically diabetic (db/db) mice were fed on chow supplemented with or without L-81 for 4 wk. The body weight, plasma glucose level, plasma lipid profile, and adipocyte volume of the db/db mice were assessed after treatment. Toxicity of L-81 was also evaluated. To understand the molecular mechanism, HepG2 cells were treated with L-81 and the effects on apolipoprotein B (apoB) secretion and mRNA level of the MTP gene were assessed. RESULTS: Treatment of db/db mice with L-81 significantly reduced and nearly normalized their body weight, hyperphagia and polydipsia. L-81 also markedly decreased the fasting plasma glucose level, improved glucose tolerance, and attenuated the elevated levels of plasma cholesterol and triglyceride. At the effective dosage, little toxicity was observed. Treatment of HepG2 cells with L-81 not only inhibited apoB secretion, but also significantly decreased the mRNA level of the MTP gene. Similar to the action of insulin, L-81 exerted its effect on the MTP promoter. CONCLUSION: L-81 represents a promising candidate in the development of a selective insulin-mimetic molecule and an anti-diabetic agent. PMID:19554651

  7. Discharges from nuclear power stations

    International Nuclear Information System (INIS)

    1991-02-01

    HM Inspectorate of Pollution commissioned, with authorising responsibilities in England and Wales, a study into the discharges of radioactive effluents from Nuclear Power Stations. The study considered arisings from nuclear power stations in Europe and the USA and the technologies to treat and control the radioactive discharges. This report contains details of the technologies used at many nuclear power stations to treat and control radioactive discharges and gives, where information was available, details of discharges and authorised discharge limits. (author)

  8. Heart valve surgery - discharge

    Science.gov (United States)

    ... ACC guideline for the management of patients with valvular heart disease: executive summary: a report of the American College ... Editorial team. Related MedlinePlus Health Topics Heart Surgery Heart Valve Diseases Browse the Encyclopedia A.D.A.M., Inc. ...

  9. Overactivity of Liver-Related Neurons in the Paraventricular Nucleus of the Hypothalamus: Electrophysiological Findings in db/db Mice.

    Science.gov (United States)

    Gao, Hong; Molinas, Adrien J R; Miyata, Kayoko; Qiao, Xin; Zsombok, Andrea

    2017-11-15

    Preautonomic neurons in the paraventricular nucleus (PVN) of the hypothalamus play a large role in the regulation of hepatic functions via the autonomic nervous system. Activation of hepatic sympathetic nerves increases glucose and lipid metabolism and contributes to the elevated hepatic glucose production observed in the type 2 diabetic condition. This augmented sympathetic output could originate from altered activity of liver-related PVN neurons. Remarkably, despite the importance of the brain-liver pathway, the cellular properties of liver-related neurons are not known. In this study, we provide the first evidence of overall activity of liver-related PVN neurons. Liver-related PVN neurons were identified with a retrograde, trans-synaptic, viral tracer in male lean and db/db mice and whole-cell patch-clamp recordings were conducted. In db/db mice, the majority of liver-related PVN neurons fired spontaneously; whereas, in lean mice the majority of liver-related PVN neurons were silent, indicating that liver-related PVN neurons are more active in db/db mice. Persistent, tonic inhibition was identified in liver-related PVN neurons; although, the magnitude of tonic inhibitory control was not different between lean and db/db mice. In addition, our study revealed that the transient receptor potential vanilloid type 1-dependent increase of excitatory neurotransmission was reduced in liver-related PVN neurons of db/db mice. These findings demonstrate plasticity of liver-related PVN neurons and a shift toward excitation in a diabetic mouse model. Our study suggests altered autonomic circuits at the level of the PVN, which can contribute to autonomic dysfunction and dysregulation of neural control of hepatic functions including glucose metabolism. SIGNIFICANCE STATEMENT A growing body of evidence suggests the importance of the autonomic control in the regulation of hepatic metabolism, which plays a major role in the development and progression of type 2 diabetes mellitus

  10. Plant DB link - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...e Site Policy | Contact Us Plant DB link - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  11. Dicty_cDB: Contig-U05261-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DN828913 ) KUCD01_04_F02_T3 WSWR cDNA library Triticum aesti... 48 0.49 1 ( DB872994 ) Lipochromis sp. 'matu...berosum cDNA, ... 50 0.13 1 ( CK261371 ) EST707449 potato abiotic stress cDNA library Sola... 50 0.13 1 ( BQ...pergillus niger mRNA for hypothetical protein, ... 44 7.7 1 ( AL111181 ) Botrytis cinerea strain T4 cDNA library...) Batrachochytrium dendrobatidis strain JAM059 vari... 48 0.49 1 ( AL112706 ) Botrytis cinerea strain T4 cDNA library...3 ) GH_MBb0070I15f GH_MBb Gossypium hirsutum genomic ... 48 0.49 1 ( AL424547 ) T3 end of clone XAZ0AA001A10 of library

  12. Dicty_cDB: Contig-U16414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( CB282081 ) BT0047 Blomia tropicalis cDNA library Blomia trop... 52 9e-19 4 ( EX370580 ) GQ03219.B7_O07 GQ032 - Shoot ti...on of useful proteins deri... 72 1e-29 5 ( DR930447 ) EST1121986 Aquilegia cDNA library...63 ) EST1191412 Aquilegia cDNA library Aquilegia formo... 88 5e-26 2 ( DB657321 ) Saccharomyces cere... 64 1e-21 4 ( DT739515 ) EST1173364 Aquilegia cDNA library Aquilegia formo... 70 1e-21 3 ( CF609239 ) INFIO01_000017 Grape Inflore... ( DT733254 ) EST1167104 Aquilegia cDNA library Aquilegia formo... 68 8e-21 5 ( FF717444 ) XABT35772.fwd Gateway compati

  13. Dicty_cDB: Contig-U15612-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2.1 3 ( DJ134199 ) Method for identification of useful proteins deri... 36 2.2 2 ( AL401410 ) T3 end of clone AS0AA027F03 of library...ana tabacum EST, clone nt002084085. 38 0.015 3 ( EX054863 ) BR039507 floral buds cDNA library KBFS Brassic....63 2 ( EX073063 ) BR057707 root cDNA library KBRT Brassica rapa sub... 40 0.67 2...27_A23_F.... 36 3.8 3 ( CV650372 ) GS0040 Chinese cabbage seedling library Brassica ... 40 3.8 2 ( DB662283 ) Saccharomyces cere.... 52 0.083 1 ( CB084704 ) hq20f02.b1 Hedyotis centranthoides flower - Stage... 52 0.083 1 ( CA853976 ) EST357 almond cDNA library

  14. Summary information report

    International Nuclear Information System (INIS)

    1982-07-01

    The Summary Information Report (SIR) provides summary data concerning NRC and its licensees for general use by the Chairman, other Commissioners and Commission staff offices, the Executive Director for Operations, and the Office Directors. SIR is published quarterly by the Management Information Branch (49-27834) of the Office of Resource Management

  15. Anti-diabetic and hypolipidemic effects of Sargassum yezoense in db/db mice

    International Nuclear Information System (INIS)

    Kim, Su-Nam; Lee, Woojung; Bae, Gyu-Un; Kim, Yong Kee

    2012-01-01

    Highlights: ► Sargassum yezoense (SY) treatment improved glucose and lipid impairment in vivo. ► This pharmacological action is associated with PPARα/γ dual activation. ► It decreases the expression of G6Pase for gluconeogenesis in liver. ► It increases the expression of UCP3 for lipid metabolism in adipose tissue. ► There are no significant side effects such as body weight gain and hepatomegaly. -- Abstract: Peroxisome proliferator-activated receptors (PPARs) have been considered to be desirable targets for metabolic syndrome, even though their specific agonists have several side effects including body weight gain, edema and tissue failure. Previously, we have reported in vitro effects of Sargassum yezoense (SY) and its ingredients, sargaquinoic acid (SQA) and sargahydroquinoic acid (SHQA), on PPARα/γ dual transcriptional activation. In this study, we describe in vivo pharmacological property of SY on metabolic disorders. SY treatment significantly improved glucose and lipid impairment in db/db mice model. More importantly, there are no significant side effects such as body weight gain and hepatomegaly in SY-treated animals, indicating little side effects of SY in liver and lipid metabolism. In addition, SY led to a decrease in the expression of G6Pase for gluconeogenesis in liver responsible for lowering blood glucose level and an increase in the expression of UCP3 in adipose tissue for the reduction of total and LDL-cholesterol level. Altogether, our data suggest that SY would be a potential therapeutic agent against type 2 diabetes and related metabolic disorders by ameliorating the glucose and lipid metabolism.

  16. Anti-diabetic and hypolipidemic effects of Sargassum yezoense in db/db mice

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Su-Nam, E-mail: snkim@kist.re.kr [Natural Medicine Center, KIST Gangneung Institute, Gangneung 210-340 (Korea, Republic of); Lee, Woojung [Natural Medicine Center, KIST Gangneung Institute, Gangneung 210-340 (Korea, Republic of); Bae, Gyu-Un [College of Pharmacy, Sookmyung Women' s University, Seoul 140-742 (Korea, Republic of); Research Center for Cell Fate Control, Sookmyung Women' s University, Seoul 140-742 (Korea, Republic of); Kim, Yong Kee, E-mail: yksnbk@sookmyung.ac.kr [College of Pharmacy, Sookmyung Women' s University, Seoul 140-742 (Korea, Republic of)

    2012-08-10

    Highlights: Black-Right-Pointing-Pointer Sargassum yezoense (SY) treatment improved glucose and lipid impairment in vivo. Black-Right-Pointing-Pointer This pharmacological action is associated with PPAR{alpha}/{gamma} dual activation. Black-Right-Pointing-Pointer It decreases the expression of G6Pase for gluconeogenesis in liver. Black-Right-Pointing-Pointer It increases the expression of UCP3 for lipid metabolism in adipose tissue. Black-Right-Pointing-Pointer There are no significant side effects such as body weight gain and hepatomegaly. -- Abstract: Peroxisome proliferator-activated receptors (PPARs) have been considered to be desirable targets for metabolic syndrome, even though their specific agonists have several side effects including body weight gain, edema and tissue failure. Previously, we have reported in vitro effects of Sargassum yezoense (SY) and its ingredients, sargaquinoic acid (SQA) and sargahydroquinoic acid (SHQA), on PPAR{alpha}/{gamma} dual transcriptional activation. In this study, we describe in vivo pharmacological property of SY on metabolic disorders. SY treatment significantly improved glucose and lipid impairment in db/db mice model. More importantly, there are no significant side effects such as body weight gain and hepatomegaly in SY-treated animals, indicating little side effects of SY in liver and lipid metabolism. In addition, SY led to a decrease in the expression of G6Pase for gluconeogenesis in liver responsible for lowering blood glucose level and an increase in the expression of UCP3 in adipose tissue for the reduction of total and LDL-cholesterol level. Altogether, our data suggest that SY would be a potential therapeutic agent against type 2 diabetes and related metabolic disorders by ameliorating the glucose and lipid metabolism.

  17. Increasing Muscle Mass Improves Vascular Function in Obese (db/db) Mice

    Science.gov (United States)

    Qiu, Shuiqing; Mintz, James D.; Salet, Christina D.; Han, Weihong; Giannis, Athanassios; Chen, Feng; Yu, Yanfang; Su, Yunchao; Fulton, David J.; Stepp, David W.

    2014-01-01

    Background A sedentary lifestyle is an independent risk factor for cardiovascular disease and exercise has been shown to ameliorate this risk. Inactivity is associated with a loss of muscle mass, which is also reversed with isometric exercise training. The relationship between muscle mass and vascular function is poorly defined. The aims of the current study were to determine whether increasing muscle mass by genetic deletion of myostatin, a negative regulator of muscle growth, can influence vascular function in mesenteric arteries from obese db/db mice. Methods and Results Myostatin expression was elevated in skeletal muscle of obese mice and associated with reduced muscle mass (30% to 50%). Myostatin deletion increased muscle mass in lean (40% to 60%) and obese (80% to 115%) mice through increased muscle fiber size (PMyostatin deletion decreased adipose tissue in lean mice, but not obese mice. Markers of insulin resistance and glucose tolerance were improved in obese myostatin knockout mice. Obese mice demonstrated an impaired endothelial vasodilation, compared to lean mice. This impairment was improved by superoxide dismutase mimic Tempol. Deletion of myostatin improved endothelial vasodilation in mesenteric arteries in obese, but not in lean, mice. This improvement was blunted by nitric oxide (NO) synthase inhibitor l‐NG‐nitroarginine methyl ester (l‐NAME). Prostacyclin (PGI2)‐ and endothelium‐derived hyperpolarizing factor (EDHF)‐mediated vasodilation were preserved in obese mice and unaffected by myostatin deletion. Reactive oxygen species) was elevated in the mesenteric endothelium of obese mice and down‐regulated by deletion of myostatin in obese mice. Impaired vasodilation in obese mice was improved by NADPH oxidase inhibitor (GKT136901). Treatment with sepiapterin, which increases levels of tetrahydrobiopterin, improved vasodilation in obese mice, an improvement blocked by l‐NAME. Conclusions Increasing muscle mass by genetic deletion of

  18. Vessel Sewage Discharges: No-Discharge Zones (NDZs)

    Science.gov (United States)

    States may petition the EPA to establish areas, called no discharge zones (NDZs), where vessel sewage discharges are prohibited. This page describes how NDZs are designated, the types of designations, who enforces them, and how to comply.

  19. Monitoring of lightning discharge

    International Nuclear Information System (INIS)

    Grigor'ev, V.A.

    2001-01-01

    The paper presents a brief description of a lightning discharge recording system developed at the NPO 'Monitoring Techniques' under the direction of V.M. Moskolenko (Moscow). The system provides information about dangerous environmental occurrences such as tornados and hurricanes, making the forecast of extreme situations possible, especially in the areas of dangerous industries and objects. The created automatic system can be useful in solving the tasks relating to nuclear test monitoring. (author)

  20. Underwater Ship Husbandry Discharges

    Science.gov (United States)

    2011-11-01

    which entered into force in September of 2008, prohibits the use of harmful organotins such as tributyltin ( TBT ) in AFCs used on international...States. The use of TBT AFCs is explicitly prohibited under the VGP, and vessels must remove such coatings or paint over them to prevent toxic ...to hull husbandry include (1) the discharge of toxic chemicals used as biocides in AFCs and (2) biofouling as a vector for aquatic nuisance species

  1. Radioactive wastes and discharges

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    The guide sets out the radiation safety requirements and limits for the treatment of radioactive waste. They shall be observed when discharging radioactive substances into the atmosphere or sewer system, or when delivering solid, low-activity waste to a landfill site without a separate waste treatment plan. The guide does not apply to the radioactive waste resulting from the utilisation of nuclear energy or natural resources.

  2. Radioactive wastes and discharges

    International Nuclear Information System (INIS)

    2000-01-01

    The guide sets out the radiation safety requirements and limits for the treatment of radioactive waste. They shall be observed when discharging radioactive substances into the atmosphere or sewer system, or when delivering solid, low-activity waste to a landfill site without a separate waste treatment plan. The guide does not apply to the radioactive waste resulting from the utilisation of nuclear energy or natural resources

  3. Klaim-DB: A Modeling Language for Distributed Database Applications

    DEFF Research Database (Denmark)

    Wu, Xi; Li, Ximeng; Lluch Lafuente, Alberto

    2015-01-01

    and manipulation of structured data, with integrity and atomicity considerations. We present the formal semantics of KlaimDB and illustrate the use of the language in a scenario where the sales from different branches of a chain of department stores are aggregated from their local databases. It can be seen......We present the modelling language, Klaim-DB, for distributed database applications. Klaim-DB borrows the distributed nets of the coordination language Klaim but essentially re-incarnates the tuple spaces of Klaim as databases, and provides high-level language abstractions for the access...... that raising the abstraction level and encapsulating integrity checks (concerning the schema of tables, etc.) in the language primitives for database operations benefit the modelling task considerably....

  4. Flux Density through Guides with Microstructured Twisted Clad DB Medium

    Directory of Open Access Journals (Sweden)

    M. A. Baqir

    2014-01-01

    Full Text Available The paper deals with the study of flux density through a newly proposed twisted clad guide containing DB medium. The inner core and the outer clad sections are usual dielectrics, and the introduced twisted windings at the core-clad interface are treated under DB boundary conditions. The pitch angle of twist is supposed to greatly contribute towards the control over the dispersion characteristics of the guide. The eigenvalue equation for the guiding structure is deduced, and the analytical investigations are made to explore the propagation patterns of flux densities corresponding to the sustained low-order hybrid modes under the situation of varying pitch angles. The emphasis has been put on the effects due to the DB twisted pitch on the propagation of energy flux density through the guide.

  5. Sharing mutants and experimental information prepublication using FgMutantDb (https://scabusa.org/FgMutantDb).

    Science.gov (United States)

    Baldwin, Thomas T; Basenko, Evelina; Harb, Omar; Brown, Neil A; Urban, Martin; Hammond-Kosack, Kim E; Bregitzer, Phil P

    2018-06-01

    There is no comprehensive storage for generated mutants of Fusarium graminearum or data associated with these mutants. Instead, researchers relied on several independent and non-integrated databases. FgMutantDb was designed as a simple spreadsheet that is accessible globally on the web that will function as a centralized source of information on F. graminearum mutants. FgMutantDb aids in the maintenance and sharing of mutants within a research community. It will serve also as a platform for disseminating prepublication results as well as negative results that often go unreported. Additionally, the highly curated information on mutants in FgMutantDb will be shared with other databases (FungiDB, Ensembl, PhytoPath, and PHI-base) through updating reports. Here we describe the creation and potential usefulness of FgMutantDb to the F. graminearum research community, and provide a tutorial on its use. This type of database could be easily emulated for other fungal species. Published by Elsevier Inc.

  6. Self-quenching streamer discharge in a wire chamber

    International Nuclear Information System (INIS)

    Alekseev, G.D.; Kruglov, V.V.; Khazins, D.M.

    1982-01-01

    A summary is given of the investigation of a new mode of operation of a wire chamber involving a self-quenching streamer discharge. The history of the question is briefly discussed. The main characteristics of the self-quenching mode and the influence of the composition and pressure of the gas mixture and the geometrical parameters of the chamber on the characteristics are described. The mechanism of a self-quenching streamer discharge is analyzed. Detectors working in this mode are described, and the prospects for its future use are discussed

  7. Effect of liquid waste discharges from steam generating facilities

    Energy Technology Data Exchange (ETDEWEB)

    McGuire, H.E. Jr.

    1977-09-01

    This report contains a summary of the effects of liquid waste discharges from steam electric generating facilities on the environment. Also included is a simplified model for use in approximately determining the effects of these discharges. Four basic fuels are used in steam electric power plants: three fossil fuels--coal, natural gas, and oil; and uranium--presently the basic fuel of nuclear power. Coal and uranium are expected to be the major fuels in future years. The following power plant effluents are considered: heat, chlorine, copper, total dissolved solids, suspended solids, pH, oil and grease, iron, zinc, chrome, phosphorus, and trace radionuclides.

  8. Effect of liquid waste discharges from steam generating facilities

    International Nuclear Information System (INIS)

    McGuire, H.E. Jr.

    1977-09-01

    This report contains a summary of the effects of liquid waste discharges from steam electric generating facilities on the environment. Also included is a simplified model for use in approximately determining the effects of these discharges. Four basic fuels are used in steam electric power plants: three fossil fuels--coal, natural gas, and oil; and uranium--presently the basic fuel of nuclear power. Coal and uranium are expected to be the major fuels in future years. The following power plant effluents are considered: heat, chlorine, copper, total dissolved solids, suspended solids, pH, oil and grease, iron, zinc, chrome, phosphorus, and trace radionuclides

  9. NGSmethDB 2017: enhanced methylomes and differential methylation.

    Science.gov (United States)

    Lebrón, Ricardo; Gómez-Martín, Cristina; Carpena, Pedro; Bernaola-Galván, Pedro; Barturen, Guillermo; Hackenberg, Michael; Oliver, José L

    2017-01-04

    The 2017 update of NGSmethDB stores whole genome methylomes generated from short-read data sets obtained by bisulfite sequencing (WGBS) technology. To generate high-quality methylomes, stringent quality controls were integrated with third-part software, adding also a two-step mapping process to exploit the advantages of the new genome assembly models. The samples were all profiled under constant parameter settings, thus enabling comparative downstream analyses. Besides a significant increase in the number of samples, NGSmethDB now includes two additional data-types, which are a valuable resource for the discovery of methylation epigenetic biomarkers: (i) differentially methylated single-cytosines; and (ii) methylation segments (i.e. genome regions of homogeneous methylation). The NGSmethDB back-end is now based on MongoDB, a NoSQL hierarchical database using JSON-formatted documents and dynamic schemas, thus accelerating sample comparative analyses. Besides conventional database dumps, track hubs were implemented, which improved database access, visualization in genome browsers and comparative analyses to third-part annotations. In addition, the database can be also accessed through a RESTful API. Lastly, a Python client and a multiplatform virtual machine allow for program-driven access from user desktop. This way, private methylation data can be compared to NGSmethDB without the need to upload them to public servers. Database website: http://bioinfo2.ugr.es/NGSmethDB. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

  10. Flow cytometry analysis reveals different activation profiles of thrombin- or TRAP-stimulated platelets in db/db mice. The regulatory role of PAR-3.

    Science.gov (United States)

    Kassassir, Hassan; Siewiera, Karolina; Talar, Marcin; Przygodzki, Tomasz; Watala, Cezary

    2017-06-01

    Recent studies have shown that it may be the concentration of thrombin, which is discriminative in determining of the mechanism of platelet activation via protease activated receptors (PARs). Whether the observed phenomenon of differentiated responses of mouse platelets to various thrombin concentrations in non-diabetic db/+ and diabetic db/db mice depends upon the concerted action of various PARs, remains to be established. We found elevated reactivity of platelets, as well as the enhanced PAR-3 expression in response to both the used concentrations of AYPGKF in db/db mice, as compared to db/+ heterozygotes. At low concentration of thrombin platelets from diabetic mice demonstrated hyperreactivity, reflected by higher expression of PAR-3. For higher thrombin concentration, blood platelets from db/db mice appeared hyporeactive, compared to db/+ animals, while no significant differences in PAR-3 expression were observed between diabetic and non-diabetic mice. The novel and previously unreported finding resulting from our study is that the increased expression of PAR-3 in response to either TRAP for PAR-4 or low thrombin (when PAR-4 is not the efficient thrombin receptor) may be one of the key events contributing to higher reactivity of platelets in db/db mice. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Summary big data

    CERN Document Server

    2014-01-01

    This work offers a summary of Cukier the book: "Big Data: A Revolution That Will Transform How we Live, Work, and Think" by Viktor Mayer-Schonberg and Kenneth. Summary of the ideas in Viktor Mayer-Schonberg's and Kenneth Cukier's book: " Big Data " explains that big data is where we use huge quantities of data to make better predictions based on the fact we identify patters in the data rather than trying to understand the underlying causes in more detail. This summary highlights that big data will be a source of new economic value and innovation in the future. Moreover, it shows that it will

  12. Biofuels: Project summaries

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The US DOE, through the Biofuels Systems Division (BSD) is addressing the issues surrounding US vulnerability to petroleum supply. The BSD goal is to develop technologies that are competitive with fossil fuels, in both cost and environmental performance, by the end of the decade. This document contains summaries of ongoing research sponsored by the DOE BSD. A summary sheet is presented for each project funded or in existence during FY 1993. Each summary sheet contains and account of project funding, objectives, accomplishments and current status, and significant publications.

  13. 50 tips and tricks for MongoDB developers

    CERN Document Server

    Chodorow, Kristina

    2011-01-01

    Getting started with MongoDB is easy, but once you begin building applications with it, you'll face some complex issues. What are the tradeoffs between normalized and denormalized data? How do you handle replica set failure and failover? This collection of MongoDB tips, tricks, and hacks helps you resolve issues with everything from application design and implementation to data safety and monitoring. You get specific guidance in five topic areas directly from engineers at 10gen, the company that develops and supports this open source database: Application Design Tips: What to keep in mind wh

  14. DB2 9 for Linux, Unix, and Windows database administration certification study guide

    CERN Document Server

    Sanders, Roger E

    2007-01-01

    In DB2 9 for Linux, UNIX, and Windows Database Administration Certification Study Guide, Roger E. Sanders-one of the world's leading DB2 authors and an active participant in the development of IBM's DB2 certification exams-covers everything a reader needs to know to pass the DB2 9 UDB DBA Certification Test (731).This comprehensive study guide steps you through all of the topics that are covered on the test, including server management, data placement, database access, analyzing DB2 activity, DB2 utilities, high availability, security, and much more. Each chapter contains an extensive set of p

  15. ValidatorDB: database of up-to-date validation results for ligands and non-standard residues from the Protein Data Bank.

    Science.gov (United States)

    Sehnal, David; Svobodová Vařeková, Radka; Pravda, Lukáš; Ionescu, Crina-Maria; Geidl, Stanislav; Horský, Vladimír; Jaiswal, Deepti; Wimmerová, Michaela; Koča, Jaroslav

    2015-01-01

    Following the discovery of serious errors in the structure of biomacromolecules, structure validation has become a key topic of research, especially for ligands and non-standard residues. ValidatorDB (freely available at http://ncbr.muni.cz/ValidatorDB) offers a new step in this direction, in the form of a database of validation results for all ligands and non-standard residues from the Protein Data Bank (all molecules with seven or more heavy atoms). Model molecules from the wwPDB Chemical Component Dictionary are used as reference during validation. ValidatorDB covers the main aspects of validation of annotation, and additionally introduces several useful validation analyses. The most significant is the classification of chirality errors, allowing the user to distinguish between serious issues and minor inconsistencies. Other such analyses are able to report, for example, completely erroneous ligands, alternate conformations or complete identity with the model molecules. All results are systematically classified into categories, and statistical evaluations are performed. In addition to detailed validation reports for each molecule, ValidatorDB provides summaries of the validation results for the entire PDB, for sets of molecules sharing the same annotation (three-letter code) or the same PDB entry, and for user-defined selections of annotations or PDB entries. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  16. Pending studies at hospital discharge: a pre-post analysis of an electronic medical record tool to improve communication at hospital discharge.

    Science.gov (United States)

    Kantor, Molly A; Evans, Kambria H; Shieh, Lisa

    2015-03-01

    Achieving safe transitions of care at hospital discharge requires accurate and timely communication. Both the presence of and follow-up plan for diagnostic studies that are pending at hospital discharge are expected to be accurately conveyed during these transitions, but this remains a challenge. To determine the prevalence, characteristics, and communication of studies pending at hospital discharge before and after the implementation of an electronic medical record (EMR) tool that automatically generates a list of pending studies. Pre-post analysis. 260 consecutive patients discharged from inpatient general medicine services from July to August 2013. Development of an EMR-based tool that automatically generates a list of studies pending at discharge. The main outcomes were prevalence and characteristics of pending studies and communication of studies pending at hospital discharge. We also surveyed internal medicine house staff on their attitudes about communication of pending studies. Pre-intervention, 70% of patients had at least one pending study at discharge, but only 18% of these were communicated in the discharge summary. Most studies were microbiology cultures (68%), laboratory studies (16%), or microbiology serologies (10%). The majority of study results were ultimately normal (83%), but 9% were newly abnormal. Post-intervention, communication of studies pending increased to 43% (p pending studies, but in usual practice, the presence of these studies has rarely been communicated to outpatient providers in the discharge summary. Communication significantly increased with the implementation of an EMR-based tool that automatically generated a list of pending studies from the EMR and allowed users to import this list into the discharge summary. This is the first study to our knowledge to introduce an automated EMR-based tool to communicate pending studies.

  17. Worldwide Airfield Summary

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Worldwide Airfield Summary contains a selection of climatological data produced by the U.S. Air Force, Air Weather Service. The reports were compiled from dozens...

  18. Annual Meteorological Summaries

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Single-year summaries of observations at Weather Bureau and cooperative stations across the United States. Predominantly the single page Form 1066, which includes...

  19. Summary of Research 1997

    OpenAIRE

    Maier, William B.; Cleary, David D.

    1997-01-01

    This report contains summaries of research projects in the Department of Physics. A list of recent publications in also included which consists of conference presentations and publications, books, contributions to books, published jounal papers, technical reports, and thesis abstracts.

  20. Global Climate Summaries

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Global Hourly Summaries are simple indicators of observational normals which include climatic data summarizations and frequency distributions. These typically...

  1. Cancer Information Summaries

    Science.gov (United States)

    Peer-reviewed, evidence-based summaries on topics including adult and pediatric cancer treatment, supportive and palliative care, screening, prevention, genetics, and complementary and alternative medicine. References to published literature are included.

  2. Summaries of poster contributions

    International Nuclear Information System (INIS)

    1981-01-01

    The 10. meeting covered subjects on the application of electron microscopy in numerous fields such as biology and medicine, solid state physics, semiconductor research and production, crystallography, materials science, and chemistry of polymers. 174 summaries of poster contributions are included

  3. Oceanographic Monthly Summary

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Oceanographic Monthly Summary contains sea surface temperature (SST) analyses on both regional and ocean basin scales for the Atlantic, Pacific, and Indian Oceans....

  4. MSIS State Summary Datamarts

    Data.gov (United States)

    U.S. Department of Health & Human Services — This page provides background needed to take advantage of the capabilities of the MSIS State Summary Datamart. This mart allows the user to develop high-level...

  5. Plasma Discharge Process in a Pulsed Diaphragm Discharge System

    Science.gov (United States)

    Duan, Jianjin; Hu, Jue; Zhang, Chao; Wen, Yuanbin; Meng, Yuedong; Zhang, Chengxu

    2014-12-01

    As one of the most important steps in wastewater treatment, limited study on plasma discharge process is a key challenge in the development of plasma applications. In this study, we focus on the plasma discharge process of a pulsed diaphragm discharge system. According to the analysis, the pulsed diaphragm discharge proceeds in seven stages: (1) Joule heating and heat exchange stage; (2) nucleated site formation; (3) plasma generation (initiation of the breakdown stage); (4) avalanche growth and plasma expansion; (5) plasma contraction; (6) termination of the plasma discharge; and (7) heat exchange stage. From this analysis, a critical voltage criterion for breakdown is obtained. We anticipate this finding will provide guidance for a better application of plasma discharges, especially diaphragm plasma discharges.

  6. Diet supplementation with green tea extract epigallocatechin gallate prevents progression to glucose intolerance in db/db mice

    Directory of Open Access Journals (Sweden)

    Ortsäter Henrik

    2012-02-01

    Full Text Available Abstract Background Green tea was suggested as a therapeutic agent for the treatment of diabetes more than 70 years ago, but the mechanisms behind its antidiabetic effect remains elusive. In this work, we address this issue by feeding a green tea extract (TEAVIGO™ with a high content of epigallocatechin gallate (EGCG or the thiazolidinedione PPAR-γ agonist rosiglitazone, as positive control, to db/db mice, an animal model for diabetes. Methods Young (7 week-old db/db mice were randomized and assigned to receive diets supplemented with or without EGCG or rosiglitazone for 10 weeks. Fasting blood glucose, body weight and food intake was measured along the treatment. Glucose and insulin levels were determined during an oral glucose tolerance test after 10 weeks of treatment. Pancreata were sampled at the end of the study for blinded histomorphometric analysis. Islets were isolated and their mRNA expression analyzed by quantitative RT-PCR. Results The results show that, in db/db mice, EGCG improves glucose tolerance and increases glucose-stimulated insulin secretion. EGCG supplementation reduces the number of pathologically changed islets of Langerhans, increases the number and the size of islets, and heightens pancreatic endocrine area. These effects occurred in parallel with a reduction in islet endoplasmic reticulum stress markers, possibly linked to the antioxidative capacity of EGCG. Conclusions This study shows that the green tea extract EGCG markedly preserves islet structure and enhances glucose tolerance in genetically diabetic mice. Dietary supplementation with EGCG could potentially contribute to nutritional strategies for the prevention and treatment of type 2 diabetes.

  7. Summary of blog

    CERN Document Server

    Reader, Capitol

    2013-01-01

    This ebook consists of a summary of the ideas, viewpoints and facts presented by Hugh Hewitt in his book "Blog: Understanding the Information Reformation that's Changing Your World". This summary offers a concise overview of the entire book in less than 30 minutes reading time. However this work does not replace in any case Hugh Hewitt's book.Hewitt argues that blogs have an important potential and he believes that it would be a dreadful mistake to avoid their power.

  8. Site environmental report summary

    International Nuclear Information System (INIS)

    1992-01-01

    In this summary of the Fernald 1992 Site Environmental Report the authors will describe the impact of the Fernald site on man and the environment and provide results from the ongoing Environmental Monitoring Program. Also included is a summary of the data obtained from sampling conducted to determine if the site complies with DOE, US Environmental Protection Agency (USEPA), and Ohio EPA (OEPA) requirements. These requirements are set to protect both man and the environment

  9. Impaired Hippocampal Glutamate and Glutamine Metabolism in the db/db Mouse Model of Type 2 Diabetes Mellitus

    DEFF Research Database (Denmark)

    Andersen, Jens Velde; Nissen, Jakob Dahl; Christensen, Sofie Kjellerup

    2017-01-01

    Type 2 diabetes mellitus (T2DM) is a risk factor for the development of Alzheimer's disease, and changes in brain energy metabolism have been suggested as a causative mechanism. The aim of this study was to investigate the cerebral metabolism of the important amino acids glutamate and glutamine...... significantly reduced 13C labeling in glutamate, glutamine, GABA, citrate, and aspartate from metabolism of [U-13C]glutamate. Additionally, reduced 13C labeling were observed in GABA, citrate, and aspartate from [U-13C]glutamine metabolism in hippocampal slices of db/db mice when compared to controls. None...

  10. The antidiabetic effects of a dry powder of dietary vegetable and fruit mixtures in diabetic db/db mice

    Directory of Open Access Journals (Sweden)

    Chung-Man Yeung

    2008-09-01

    Full Text Available Chung-Man Yeung1, Yi Tan1, Sidney Tam2, Liwei Lu3, King-Hung Ko3, Pai-Hao Yang1,4, Hsiang-Fu Kung4, Marie C Lin11Department of Chemistry, Open Laboratory of Chemical Biology of the Institute of Molecular Technology, 2Clinical Biochemistry Unit, 3Department of Pathology, The University of Hong Kong, Hong Kong, China; 4Centre of Emerging Infectious Diseases, The Chinese University of Hong Kong, Shatin, N.T., Hong Kong, ChinaAbstract: We evaluated the antidiabetic effects of a mixed vegetable powder-formula I (MVP-FI, which is a dry powder mixture of over 65 kinds of vegetables and fruits, using the db/db type 2 diabetes mouse model. The db/db mice at 8–10 weeks of age were randomly divided into three groups: vehicle treatment, 1.575 g/kg MVP-FI treatment, and 3.15 g/kg MVP-FI treatment. During 12 days of treatment, we measured food intake and body weight changes, fasting blood glucose levels, and plasma lipid levels. Our results showed that the food intake and the body weight of MVP-FI-treated group were decreased gradually. Moreover, the fasting blood glucose level of the treated group was significantly dropped to a normal level comparable to that of the lean mice. Furthermore, we also found that the plasma triglyceride level in the treated group was dropped, whereas the high-density lipoprotein (HDL level was increased and total cholesterol/HDL-cholesterol ratio was decreased. Taken together, these results suggest that the diabetic conditions of the db/db mice have been improved after 12 days treatment with MVP-FI. The antihyperglycemic and antiobese activities of the MVP-FI, as demonstrated in the present study, may have important clinical implications for improving the management of type 2 diabetic patients.Keywords: traditional Chinese medicine (TCM, db/db mice, diabetes

  11. Compact Intracloud Discharges

    Energy Technology Data Exchange (ETDEWEB)

    Smith, David A. [Univ. of Colorado, Boulder, CO (United States)

    1998-11-01

    In November of 1993, mysterious signals recorded by a satellite-borne broadband VHF radio science experiment called Blackboard led to a completely unexpected discovery. Prior to launch of the ALEXIS satellite, it was thought that its secondary payload, Blackboard, would most often detect the radio emissions from lightning when its receiver was not overwhelmed by noise from narrowband communication carriers. Instead, the vast majority of events that triggered the instrument were isolated pairs of pulses that were one hundred times more energetic than normal thunderstorm electrical emissions. The events, which came to be known as TIPPs (for transionospheric pulse pairs), presented a true mystery to the geophysics community. At the time, it was not even known whether the events had natural or anthropogenic origins. After two and one half years of research into the unique signals, two ground-based receiver arrays in New Mexico first began to detect and record thunderstorm radio emissions that were consistent with the Blackboard observations. On two occasions, the ground-based systems and Blackboard even recorded emissions that were produced by the same exact events. From the ground based observations, it has been determined that TIPP events areproduced by brief, singular, isolated, intracloud electrical discharges that occur in intense regions of thunderstorms. These discharges have been dubbed CIDS, an acronym for compact intracloud discharges. During the summer of 1996, ground-based receiver arrays were used to record the electric field change signals and broadband HF emissions from hundreds of CIDS. Event timing that was accurate to within a few microseconds made possible the determination of source locations using methods of differential time of arrival. Ionospheric reflections of signals were recorded in addition to groundwave/line-of-sight signals and were used to determine accurate altitudes for the discharges. Twenty-four CIDS were recorded from three

  12. Continuous pile discharging machine

    International Nuclear Information System (INIS)

    Smith, P.P.

    1976-01-01

    A device for discharging cartridges from tubes under fluid pressure includes a cylindrical housing adapted to be seated in a leak-tight manner on the end of one of the tubes, a chute depending from the cylindrical housing near the end seated on the end of the tube, a rotatable piston having a wrench on the forward end thereof disposed in the cylindrical housing and adapted to manipulate a plug in the end of the tube, and a telescopic hydraulic ram adapted to move the piston toward the plug. In addition the wrench contains a magnet which prevents inadvertent uncoupling of the wrench and the plug. 7 claims, 10 drawing figures

  13. Capacitive discharge exciplex lamps

    Energy Technology Data Exchange (ETDEWEB)

    Sosnin, E A; Erofeev, M V; Tarasenko, V F [High Current Electronics Institute, 2/3, Akademichesky Ave., Tomsk 634055 (Russian Federation)

    2005-09-07

    Simple-geometry exciplex lamps of a novel type excited by a capacitive discharge (CD-excilamps) have been investigated. An efficient radiation has been obtained on KrBr*, KrCl*, XeBr*, XeCl* molecules and I* atom. The highest values of efficiency of various working molecules are approximately 10-18%. The lifetime of the operating gas mixture in KrCl*, XeCl*, I* and XeBr* exciplex lamps excited by a CD is above 1000 h. Owing to the above-mentioned characteristics, the exciplex lamps excited by a CD are supposed to be very promising for various applications.

  14. Capacitive discharge exciplex lamps

    International Nuclear Information System (INIS)

    Sosnin, E A; Erofeev, M V; Tarasenko, V F

    2005-01-01

    Simple-geometry exciplex lamps of a novel type excited by a capacitive discharge (CD-excilamps) have been investigated. An efficient radiation has been obtained on KrBr*, KrCl*, XeBr*, XeCl* molecules and I* atom. The highest values of efficiency of various working molecules are approximately 10-18%. The lifetime of the operating gas mixture in KrCl*, XeCl*, I* and XeBr* exciplex lamps excited by a CD is above 1000 h. Owing to the above-mentioned characteristics, the exciplex lamps excited by a CD are supposed to be very promising for various applications

  15. Continuous pile discharging machine

    Science.gov (United States)

    Smith, Phillips P.

    1976-05-11

    A device for discharging cartridges from tubes under fluid pressure includes a cylindrical housing adapted to be seated in a leak-tight manner on the end of one of the tubes, a chute depending from the cylindrical housing near the end seated on the end of the tube, a rotatable piston having a wrench on the forward end thereof disposed in the cylindrical housing and adapted to manipulate a plug in the end of the tube, and a telescopic hydraulic ram adapted to move the piston toward the plug. In addition the wrench contains a magnet which prevents inadvertent uncoupling of the wrench and the plug.

  16. DB4US: A Decision Support System for Laboratory Information Management.

    Science.gov (United States)

    Carmona-Cejudo, José M; Hortas, Maria Luisa; Baena-García, Manuel; Lana-Linati, Jorge; González, Carlos; Redondo, Maximino; Morales-Bueno, Rafael

    2012-11-14

    Until recently, laboratory automation has focused primarily on improving hardware. Future advances are concentrated on intelligent software since laboratories performing clinical diagnostic testing require improved information systems to address their data processing needs. In this paper, we propose DB4US, an application that automates information related to laboratory quality indicators information. Currently, there is a lack of ready-to-use management quality measures. This application addresses this deficiency through the extraction, consolidation, statistical analysis, and visualization of data related to the use of demographics, reagents, and turn-around times. The design and implementation issues, as well as the technologies used for the implementation of this system, are discussed in this paper. To develop a general methodology that integrates the computation of ready-to-use management quality measures and a dashboard to easily analyze the overall performance of a laboratory, as well as automatically detect anomalies or errors. The novelty of our approach lies in the application of integrated web-based dashboards as an information management system in hospital laboratories. We propose a new methodology for laboratory information management based on the extraction, consolidation, statistical analysis, and visualization of data related to demographics, reagents, and turn-around times, offering a dashboard-like user web interface to the laboratory manager. The methodology comprises a unified data warehouse that stores and consolidates multidimensional data from different data sources. The methodology is illustrated through the implementation and validation of DB4US, a novel web application based on this methodology that constructs an interface to obtain ready-to-use indicators, and offers the possibility to drill down from high-level metrics to more detailed summaries. The offered indicators are calculated beforehand so that they are ready to use when the user

  17. Web development with MongoDB and Node.js

    CERN Document Server

    Krol, Jason

    2014-01-01

    This book is designed for developers of any skill level that want to get up and running using Node.js and MongoDB to build full featured web applications. A basic understanding of JavaScript and HTML is the only requirement for this book.

  18. DB-PABP: a database of polyanion-binding proteins.

    Science.gov (United States)

    Fang, Jianwen; Dong, Yinghua; Salamat-Miller, Nazila; Middaugh, C Russell

    2008-01-01

    The interactions between polyanions (PAs) and polyanion-binding proteins (PABPs) have been found to play significant roles in many essential biological processes including intracellular organization, transport and protein folding. Furthermore, many neurodegenerative disease-related proteins are PABPs. Thus, a better understanding of PA/PABP interactions may not only enhance our understandings of biological systems but also provide new clues to these deadly diseases. The literature in this field is widely scattered, suggesting the need for a comprehensive and searchable database of PABPs. The DB-PABP is a comprehensive, manually curated and searchable database of experimentally characterized PABPs. It is freely available and can be accessed online at http://pabp.bcf.ku.edu/DB_PABP/. The DB-PABP was implemented as a MySQL relational database. An interactive web interface was created using Java Server Pages (JSP). The search page of the database is organized into a main search form and a section for utilities. The main search form enables custom searches via four menus: protein names, polyanion names, the source species of the proteins and the methods used to discover the interactions. Available utilities include a commonality matrix, a function of listing PABPs by the number of interacting polyanions and a string search for author surnames. The DB-PABP is maintained at the University of Kansas. We encourage users to provide feedback and submit new data and references.

  19. EST Table: DB673368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DB673368 E_FL_BmN-_27M22_F_0 10/09/28 86 %/190 aa ref|XP_002092788.1| GE14387 [Dros...ophila yakuba] gb|EDW92500.1| GE14387 [Drosophila yakuba] 10/09/01 86 %/190 aa FBpp0259397|DyakGE14387-PA 10

  20. ProOpDB: Prokaryotic Operon DataBase.

    Science.gov (United States)

    Taboada, Blanca; Ciria, Ricardo; Martinez-Guerrero, Cristian E; Merino, Enrique

    2012-01-01

    The Prokaryotic Operon DataBase (ProOpDB, http://operons.ibt.unam.mx/OperonPredictor) constitutes one of the most precise and complete repositories of operon predictions now available. Using our novel and highly accurate operon identification algorithm, we have predicted the operon structures of more than 1200 prokaryotic genomes. ProOpDB offers diverse alternatives by which a set of operon predictions can be retrieved including: (i) organism name, (ii) metabolic pathways, as defined by the KEGG database, (iii) gene orthology, as defined by the COG database, (iv) conserved protein domains, as defined by the Pfam database, (v) reference gene and (vi) reference operon, among others. In order to limit the operon output to non-redundant organisms, ProOpDB offers an efficient method to select the most representative organisms based on a precompiled phylogenetic distances matrix. In addition, the ProOpDB operon predictions are used directly as the input data of our Gene Context Tool to visualize their genomic context and retrieve the sequence of their corresponding 5' regulatory regions, as well as the nucleotide or amino acid sequences of their genes.

  1. Download - Plabrain DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us Plabrain...s Database Database Description Download License Update History of This Database Site Policy | Contact Us Download - Plabrain DB | LSDB Archive ...

  2. SolveDB: Integrating Optimization Problem Solvers Into SQL Databases

    DEFF Research Database (Denmark)

    Siksnys, Laurynas; Pedersen, Torben Bach

    2016-01-01

    for optimization problems, (2) an extensible infrastructure for integrating different solvers, and (3) query optimization techniques to achieve the best execution performance and/or result quality. Extensive experiments with the PostgreSQL-based implementation show that SolveDB is a versatile tool offering much...

  3. Effect of zinc nutriture on tissue zinc (Zn) in the diabetic C57BL/KsJ db/db mouse

    International Nuclear Information System (INIS)

    Donaldson, D.L.; Smith, C.C.; Walker, M.S.; Yunice, A.A.; Rennert, O.M.

    1986-01-01

    The genetically obese diabetic db/db mouse has been reported to have low serum (S) and femur (F) Zn concentrations. In order to examine whether this animal model is predisposed to dietary Zn deficiency, they measured tissue Zn concentrations (conc.) in db/db, heterozygous db/m, and homozygous m/m control mice fed either a zinc deficient diet (2 ppm Zn) ad libitum or a zinc adequate diet (20 ppm Zn) either ad libitum or in restricted amounts (equal to that consumed by mice on the 2 ppm Zn diet) for 12 wks. The results were analyzed by analysis of variance for a completely randomized 3X3 design. Similar clinical manifestations of Zn deficiency were seen in mice of all 3 genotypes after 8-10 weeks on 2 ppm Zn. S Zn(p=0.0001) and F Zn conc.(p=0.0001) and content(p=0.0001) of those 3 groups showed similar marked reductions. S Zn was not reduced in db/db mice fed 20 ppm Zn. F Zn conc. was mildly reduced in these mice but not to the extent observed in mice fed 2 ppm Zn. Liver (L) Zn conc. was not affected by either genotype or diet, but total L Zn(p=0.0001) was greater in db/db mice due to their larger L weight. Kidney (K) Zn conc.(p=0.0001) of db/db mice was slightly but significantly decreased, but their total K Zn content(p=0.0001) was increased due to their greater K weights. They conclude that, in spite of its having a decreased F Zn conc. and content, the db/db mouse does not appear to be particularly susceptible to dietary Zn deficiency

  4. Cryogenic high current discharges

    International Nuclear Information System (INIS)

    Meierovich, B.E.

    1994-01-01

    Z-pinches formed from frozen deuterium fibers by a rapidly rising current have enhanced stability and high neutron yield. The efforts to understand the enhanced stability and neutron yield on the basis of classical picture of Bennett equilibrium of the current channel has not given satisfactory results. The traditional approach does not take into account the essential difference between the frozen deuterium fiber Z-pinches and the usual Z-pinches such as exploding wires or classical gas-puffed Z-pinches. The very low temperature of the fiber atoms (10 K), together with the rapidly rising current, result in the coexistence of a high current channel with unionized fiber atoms for a substantial period of time. This phenomena lasts during the risetime. This approach takes into account the difference of the breakdown in a dielectric deuterium fiber and the breakdown in a metallic wire. This difference is essential to the understanding of specific features of cryogenic high current discharges. Z-pinches in frozen deuterium fibers should be considered as a qualitatively new phenomenon on the boundary of cryogenic and high current physics. It is a start of a new branch in plasma physics: the physics of cryogenic high current discharges

  5. ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL

  6. Radioactive liquid wastes discharged to ground in the 200 areas during the first three quarters of 1974

    International Nuclear Information System (INIS)

    Anderson, J.D.

    1974-01-01

    An overall summary of radioactive liquid wastes discharged to ground during the first three quarters of 1974 and since startup within the Production and Waste Management control zone is presented in tabular form. Estimates of the radioactivity discharged to individual ponds, cribs, and specific retention sites are given. (LK)

  7. Reversibility of β-Cell-Specific Transcript Factors Expression by Long-Term Caloric Restriction in db/db Mouse

    Directory of Open Access Journals (Sweden)

    Chunjun Sheng

    2016-01-01

    Full Text Available Type 2 diabetes (T2D is characterized by β-cell dedifferentiation, but underlying mechanisms remain unclear. The purpose of the current study was to explore the mechanisms of β-cell dedifferentiation with and without long-term control of calorie intake. We used a diabetes mouse model (db/db to analyze the changes in the expression levels of β-cell-specific transcription factors (TFs and functional factors with long-term caloric restriction (CR. Our results showed that chronic euglycemia was maintained in the db/db mice with long-term CR intervention, and β-cell dedifferentiation was significantly reduced. The expression of Glut2, Pdx1, and Nkx6.1 was reversed, while MafA expression was significantly increased with long-term CR. GLP-1 pathway was reactivated with long-term CR. Our work showed that the course of β-cell dedifferentiation can intervene by long-term control of calorie intake. Key β-cell-specific TFs and functional factors play important roles in maintaining β-cell differentiation. Targeting these factors could optimize T2D therapies.

  8. Calcium dobesilate prevents the oxidative stress and inflammation induced by diabetes in the retina of db/db mice.

    Science.gov (United States)

    Bogdanov, Patricia; Solà-Adell, Cristina; Hernández, Cristina; García-Ramírez, Marta; Sampedro, Joel; Simó-Servat, Olga; Valeri, Marta; Pasquali, Christian; Simó, Rafael

    2017-10-01

    Calcium dobesilate (CaD) is beneficial in early stages of diabetic retinopathy (DR), but its mechanisms of action remains to be elucidated. The aim was to investigate the effect of CaD on proinflammatory cytokines and oxidative stress. db/db mice were randomly assigned to daily oral treatment with CaD (200mg/kg/day) or vehicle for 15days. Biomarkers of oxidative stress (dihydroethidium, malondialdehyde), NF-κB, and proinflammatory cytokines (IL-1β, IL-6, IL-8, TNF-α, MCP-1) were examined in the retina by immunohistochemical analysis. Cultures of human retinal endothelial cells (HRECs) were used for complementary experiments. CaD significantly reduced the biomarkers of oxidative stress in the retina of db/db mice. In addition, CaD prevented the increase of NF-κB, IL-6, IL-8, TNF-α and MCP-1 induced by diabetes. CaD inhibited the activation of NF-kβ induced by IL-1β by preventing IKKB-α phosphorylation in HRECs and reduced the upregulation of IL-6 and IL-18 induced by TNF-α in a dose-dependent manner. Our results suggest that antioxidant and antiinflammatory effects are crucial in accounting for the effectiveness of CaD for treating DR. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. The effective temperature of the DBV's, and the sensitivity of DB model atmospheres to input physics

    International Nuclear Information System (INIS)

    Thejll, P.; Delaware Univ., Newark, DE; Vennes, S.; Shipman, H.L.

    1990-01-01

    A new grid of DB models is applied to the problem of the DBV temperatures and the DB gap. It is found that the DBV instability strip lies lower than thought before. This has consequences for the calibration of mixing-length theories and the reality of the DB gap. The DBV GD358 is discussed in detail. (orig.)

  10. AOP-DB Frontend: A user interface for the Adverse Outcome Pathways Database.

    Science.gov (United States)

    The EPA Adverse Outcome Pathway Database (AOP-DB) is a database resource that aggregates association relationships between AOPs, genes, chemicals, diseases, pathways, species orthology information, ontologies. The AOP-DB frontend is a simple yet powerful AOP-DB user interface in...

  11. RegaDB: Community-driven data management and analysis for infectious diseases

    NARCIS (Netherlands)

    Libin, P.; Beheydt, G.; Deforche, K.; Imbrechts, S.; Ferreira, F.; Van Laethem, K.; Theys, K.; Carvalho, A.P.; Cavaco-Silva, J.; Lapadula, G.; Torti, C.; Assel, M.; Wesner, S.; Snoeck, J.; Ruelle, J.; de Bel, A.; Lacor, P.; de Munter, P.; van Wijngaerden, E.; Zazzi, M.; Kaiser, R.; Ayouba, A.; Peeters, M.; de Oliveira, T.; Alcantara, L.C.J.; Grossman, Z.; Sloot, P.; Otelea, D.; Paraschiv, S.; Boucher, C.; Camacho, R.J.; Vandamme, A.-M.

    2013-01-01

    RegaDB is a free and open source data management and analysis environment for infectious diseases. RegaDB allows clinicians to store, manage and analyze patient data, including viral genetic sequences. Moreover, RegaDB provides researchers with a mechanism to collect data in a uniform format and

  12. Diffusion of condenser water discharge

    International Nuclear Information System (INIS)

    Iwakiri, Toshio

    1977-01-01

    Thermal and nuclear power stations in Japan are mostly located in coastal area, and the cooling water is discharged into sea as warm water. Recently, large interest is taken in this matter, and it is desirable to predict the diffusion of warm discharge accurately and to take effective measures for lowering the temperature. As for the methods of predicting the diffusion of warm discharge, simplified estimation, mathematical analysis and hydrographical model experiment are used corresponding to objects and conditions. As for the measures to lower temperature, the method of discharging warm water into deep sea bottom was confirmed to be very effective. In this paper, the phenomena of diffusion of warm discharge in sea, the methods of predicting the diffusion of warm discharge, and the deep sea discharge as the measure for lowering temperature are outlined. The factors concerning the diffusion of warm discharge in sea are the conditions of discharge, topography and sea state, and the diffusion is roughly divided into mixing diffusion in the vicinity of warm water outlet and eddy diffusion in distant region. It is difficult to change artificially the conditions of diffusion in distant region, and the measures of raising the rate of dilution in near region are effective, therefore the deep sea discharge is adopted. (Kako, I.)

  13. The impact of three discharge coding methods on the accuracy of diagnostic coding and hospital reimbursement for inpatient medical care.

    Science.gov (United States)

    Tsopra, Rosy; Peckham, Daniel; Beirne, Paul; Rodger, Kirsty; Callister, Matthew; White, Helen; Jais, Jean-Philippe; Ghosh, Dipansu; Whitaker, Paul; Clifton, Ian J; Wyatt, Jeremy C

    2018-07-01

    Coding of diagnoses is important for patient care, hospital management and research. However coding accuracy is often poor and may reflect methods of coding. This study investigates the impact of three alternative coding methods on the inaccuracy of diagnosis codes and hospital reimbursement. Comparisons of coding inaccuracy were made between a list of coded diagnoses obtained by a coder using (i)the discharge summary alone, (ii)case notes and discharge summary, and (iii)discharge summary with the addition of medical input. For each method, inaccuracy was determined for the primary, secondary diagnoses, Healthcare Resource Group (HRG) and estimated hospital reimbursement. These data were then compared with a gold standard derived by a consultant and coder. 107 consecutive patient discharges were analysed. Inaccuracy of diagnosis codes was highest when a coder used the discharge summary alone, and decreased significantly when the coder used the case notes (70% vs 58% respectively, p coded from the discharge summary with medical support (70% vs 60% respectively, p coding with case notes, and 35% for coding with medical support. The three coding methods resulted in an annual estimated loss of hospital remuneration of between £1.8 M and £16.5 M. The accuracy of diagnosis codes and percentage of correct HRGs improved when coders used either case notes or medical support in addition to the discharge summary. Further emphasis needs to be placed on improving the standard of information recorded in discharge summaries. Copyright © 2018 Elsevier B.V. All rights reserved.

  14. Heart bypass surgery - minimally invasive - discharge

    Science.gov (United States)

    ... invasive direct coronary artery bypass - discharge; MIDCAB - discharge; Robot assisted coronary artery bypass - discharge; RACAB - discharge; Keyhole ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...

  15. Vaginal Discharge: What's Normal, What's Not

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español Vaginal Discharge: What's Normal, What's Not KidsHealth / For Teens / ... Discharge: What's Normal, What's Not Print What Is Vaginal Discharge? Vaginal discharge is fluid that comes from ...

  16. Analysis of Multipactor Discharge

    International Nuclear Information System (INIS)

    Lau, Y. Y.

    2005-01-01

    Several comprehensive studies of radio frequency (rf) breakdown and rf heating are reported. They are of general interest to magnetic confinement fusion, rf linac, and high power microwave source development. The major results include: (1) a ground-breaking theory of multipactor discharge on dielectric, including a successful proof-of-principle experiment that verified the newly developed scaling laws, (2) an in depth investigation of the failure mechanisms of diamond windows and ceramic windows, and of the roles of graphitization, thin films of coating and contaminants, and (3) a most comprehensive theory, to date, on the heating of particulates by an electromagnetic pulse, and on the roles of rf magnetic field heating and of rf electric field heating, including the construction of new scaling laws that govern them. The above form a valuable knowledge base for the general problem of heating phenomenology

  17. Radioactive wastes and discharges

    International Nuclear Information System (INIS)

    1993-01-01

    According to the Section 24 of the Finnish Radiation Decree (1512/91), the Finnish Centre for Radiation and Nuclear Safety shall specify the concentration and activity limits and principles for the determination whether a waste can be defined as a radioactive waste or not. The radiation safety requirements and limits for the disposal of radioactive waste are given in the guide. They must be observed when discharging radioactive waste into the atmosphere or sewer system, or when delivering solid low-activity waste to a landfill site without a separate waste disposal plan. The guide does not apply to the radioactive waste resulting from the utilization of nuclear energy of natural resources. (4 refs., 1 tab.)

  18. Indexing for summary queries

    DEFF Research Database (Denmark)

    Yi, Ke; Wang, Lu; Wei, Zhewei

    2014-01-01

    ), of a particular attribute of these records. Aggregation queries are especially useful in business intelligence and data analysis applications where users are interested not in the actual records, but some statistics of them. They can also be executed much more efficiently than reporting queries, by embedding...... returned by reporting queries. In this article, we design indexing techniques that allow for extracting a statistical summary of all the records in the query. The summaries we support include frequent items, quantiles, and various sketches, all of which are of central importance in massive data analysis....... Our indexes require linear space and extract a summary with the optimal or near-optimal query cost. We illustrate the efficiency and usefulness of our designs through extensive experiments and a system demonstration....

  19. An aqueous extract of Portulaca oleracea ameliorates diabetic nephropathy through suppression of renal fibrosis and inflammation in diabetic db/db mice.

    Science.gov (United States)

    Lee, An Sook; Lee, Yun Jung; Lee, So Min; Yoon, Jung Joo; Kim, Jin Sook; Kang, Dae Gill; Lee, Ho Sub

    2012-01-01

    Diabetic nephropathy is one of the most common microvascular complications of diabetes and the leading cause of end-stage renal disease. In the present study, we investigated the renoprotective effect of the aqueous extract of Portulaca oleracea (AP) on diabetic nephropathy accelerated by renal fibrosis and inflammation in type 2 diabetic db/db mice. The mice were treated with AP (300 mg/kg/day, p.o.) for ten weeks to examine the long-term effects on diabetic nephropathy and renal dysfunction. We found that AP treatment markedly lowered blood glucose to 412 ± 11.4 mg/dl and plasma creatinine level to 2.3 ± 0.8 mg/dl compared to db/db mice (p < 0.05, p < 0.01, respectively). This study also showed that treatment with AP significantly decreased water intake and urine volume in diabetic db/db mice (p < 0.05). In immunohistological study, the renal expression of transforming growth factor-β1 (TGF-β1), advanced glycation end products (AGE), and intercellular adhesion molecule (ICAM)-1 markedly increased in the renal cortex of untreated db/db mice (p < 0.01). In contrast, AP treatment significantly reduced these expressions to 50 ± 2.1%, 48 ± 2.8%, 61 ± 1.1%, respectively (p < 0.01). Furthermore, NF-κB p65 activation in renal tissues markedly increased in untreated db/db mice, which was significantly suppressed by AP treatment. Taken together, these findings suggest that AP attenuates diabetic nephropathy through inhibition of renal fibrosis and inflammation in db/db mice.

  20. GC/TOFMS analysis of metabolites in serum and urine reveals metabolic perturbation of TCA cycle in db/db mice involved in diabetic nephropathy.

    Science.gov (United States)

    Li, Mengjie; Wang, Xufang; Aa, Jiye; Qin, Weisong; Zha, Weibin; Ge, Yongchun; Liu, Linsheng; Zheng, Tian; Cao, Bei; Shi, Jian; Zhao, Chunyan; Wang, Xinwen; Yu, Xiaoyi; Wang, Guangji; Liu, Zhihong

    2013-06-01

    Early diagnosis of diabetic nephropathy (DN) is difficult although it is of crucial importance to prevent its development. To probe potential markers and the underlying mechanism of DN, an animal model of DN, the db/db mice, was used and serum and urine metabolites were profiled using gas chromatography/time-of-flight mass spectrometry. Metabolic patterns were evaluated based on serum and urine data. Principal component analysis of the data revealed an obvious metabonomic difference between db/db mice and controls, and db/db mice showed distinctly different metabolic patterns during the progression from diabetes to early, medium, and later DN. The identified metabolites discriminating between db/db mice and controls suggested that db/db mice have perturbations in the tricarboxylic acid cycle (TCA, citrate, malate, succinate, and aconitate), lipid metabolism, glycolysis, and amino acid turnover. The db/db mice were characterized by acidic urine, high TCA intermediates in serum at week 6 and a sharp decline thereafter, and gradual elevation of free fatty acids in the serum. The sharp drop of serum TCA intermediates from week 6 to 8 indicated the downregulated glycolysis and insulin resistance. However, urinary TCA intermediates did not decrease in parallel with those in the serum from week 6 to 10, and an increased portion of TCA intermediates in the serum was excreted into the urine at 8, 10, and 12 wk than at 6 wk, indicating kidney dysfunction occurred. The relative abundances of TCA intermediates in urine relative to those in serum were suggested as an index of renal damage.

  1. MIV Project: Executive Summary

    DEFF Research Database (Denmark)

    Ravazzotti, Mariolina T.; Jørgensen, John Leif; Neefs, Marc

    1997-01-01

    Under the ESA contract #11453/95/NL/JG(SC), aiming at assessing the feasibility of Rendez-vous and docking of unmanned spacecrafts, a reference mission scenario was defined. This report gives an executive summary of the achievements and results from the project.......Under the ESA contract #11453/95/NL/JG(SC), aiming at assessing the feasibility of Rendez-vous and docking of unmanned spacecrafts, a reference mission scenario was defined. This report gives an executive summary of the achievements and results from the project....

  2. Dicarboxylic acids from electric discharge

    Science.gov (United States)

    Zeitman, B.; Chang, S.; Lawless, J. G.

    1974-01-01

    An investigation was conducted concerning the possible synthesis of a suite of dicarboxylic acids similar to that found in the Murchison meteorite. The investigation included the conduction of a chemical evolution experiment which simulated electric discharge through the primitive atmosphere of the earth. The suite of dicarboxylic acids obtained in the electric discharge experiment is similar to that of the Murchison meteorite, except for the fact that 2-chlorosuccinic acid is present in the spark discharge.

  3. Mechanical Vibration Mitigates the Decrease of Bone Quantity and Bone Quality of Leptin Receptor-Deficient Db/Db Mice by Promoting Bone Formation and Inhibiting Bone Resorption.

    Science.gov (United States)

    Jing, Da; Luo, Erping; Cai, Jing; Tong, Shichao; Zhai, Mingming; Shen, Guanghao; Wang, Xin; Luo, Zhuojing

    2016-09-01

    Leptin, a major hormonal product of adipocytes, is involved in regulating appetite and energy metabolism. Substantial studies have revealed the anabolic actions of leptin on skeletons and bone cells both in vivo and in vitro. Growing evidence has substantiated that leptin receptor-deficient db/db mice exhibit decreased bone mass and impaired bone microstructure despite several conflicting results previously reported. We herein systematically investigated bone microarchitecture, mechanical strength, bone turnover and its potential molecular mechanisms in db/db mice. More importantly, we also explored an effective approach for increasing bone mass in leptin receptor-deficient animals in an easy and noninvasive manner. Our results show that deterioration of trabecular and cortical bone microarchitecture and decreases of skeletal mechanical strength-including maximum load, yield load, stiffness, energy, tissue-level modulus and hardness-in db/db mice were significantly ameliorated by 12-week, whole-body vibration (WBV) with 0.5 g, 45 Hz via micro-computed tomography (μCT), three-point bending, and nanoindentation examinations. Serum biochemical analysis shows that WBV significantly decreased serum tartrate-resistant acid phosphatase 5b (TRACP5b) and CTx-1 levels and also mitigated the reduction of serum osteocalcin (OCN) in db/db mice. Bone histomorphometric analysis confirmed that decreased bone formation-lower mineral apposition rate, bone formation rate, and osteoblast numbers in cancellous bone-in db/db mice were suppressed by WBV. Real-time PCR assays show that WBV mitigated the reductions of tibial alkaline phosphatase (ALP), OCN, Runt-related transcription factor 2 (RUNX2), type I collagen (COL1), BMP2, Wnt3a, Lrp6, and β-catenin mRNA expression, and prevented the increases of tibial sclerostin (SOST), RANK, RANKL, RANL/osteoprotegerin (OPG) gene levels in db/db mice. Our results show that WBV promoted bone quantity and quality in db/db mice with obvious

  4. A Systematic Review of Interventions to Follow-Up Test Results Pending at Discharge.

    Science.gov (United States)

    Darragh, Patrick J; Bodley, T; Orchanian-Cheff, A; Shojania, K G; Kwan, J L; Cram, P

    2018-05-01

    Patients are frequently discharged from the hospital before all test results have been finalized. Thirty to 40% of tests pending at discharge (TPADs) return potentially actionable results that could necessitate change in the patients' management, often unbeknownst to their physicians. Delayed follow-up of TPADs can lead to patient harm. We sought to synthesize the existing literature on interventions intended to improve the management of TPADs, including interventions designed to enhance documentation of TPADs, increase physician awareness when TPAD results finalize post-discharge, decrease adverse events related to missed TPADs, and increase physician satisfaction with TPAD management. We searched Medline, EMBASE, CINAHL, Cochrane Database of Systematic Reviews, Cochrane Database of Controlled Clinical Trials and Medline (January 1, 2000-November 10, 2016) for randomized controlled trials and prospective, controlled observational studies that evaluated interventions to improve follow-up of TPADs for adult patients discharged from acute care hospitals or emergency department settings. From each study we extracted characteristics of the intervention being evaluated and its impact on TPAD management. Nine studies met the criteria for inclusion. Six studies evaluated electronic discharge summary templates with a designated field for documenting TPADs, and three of six of these studies reported a significant improvement in documentation of TPADs in discharge summaries in pre- and post-intervention analysis. One study reported that auditing discharge summaries and providing feedback to physicians were associated with improved TPAD documentation in discharge summaries. Two studies found that email alerts when TPADs were finalized improved physicians' awareness of the results and documentation of their follow-up actions. Of the four studies that assessed patient morbidity, two showed a positive effect; however, none specifically measured the impact of their interventions

  5. DB2 11 the ultimate database for cloud, analytics, and mobile

    CERN Document Server

    Campbell, John; Jones, Gareth; Parekh, Surekha; Yothers, Jay

    2014-01-01

    Building on the prior book ""DB2 11: The Database for Big Data and Analytics,"" published in 2013, this book is written particularly for new and existing DB2 for z/OS customers and users who want to learn as much as they can about the new software version before migrating their organizations to DB2 11 for z/OS. The book begins with a technical overview of DB2 11 features and explains how the new functions in DB2 11 can help enterprise customers address the challenges they face with the explosion of data and information. There has been rapid growth in the variety, volume, and velocity of dat

  6. Regression models of discharge and mean velocity associated with near-median streamflow conditions in Texas: utility of the U.S. Geological Survey discharge measurement database

    Science.gov (United States)

    Asquith, William H.

    2014-01-01

    A database containing more than 16,300 discharge values and ancillary hydraulic attributes was assembled from summaries of discharge measurement records for 391 USGS streamflow-gauging stations (streamgauges) in Texas. Each discharge is between the 40th- and 60th-percentile daily mean streamflow as determined by period-of-record, streamgauge-specific, flow-duration curves. Each discharge therefore is assumed to represent a discharge measurement made for near-median streamflow conditions, and such conditions are conceptualized as representative of midrange to baseflow conditions in much of the state. The hydraulic attributes of each discharge measurement included concomitant cross-section flow area, water-surface top width, and reported mean velocity. Two regression equations are presented: (1) an expression for discharge and (2) an expression for mean velocity, both as functions of selected hydraulic attributes and watershed characteristics. Specifically, the discharge equation uses cross-sectional area, water-surface top width, contributing drainage area of the watershed, and mean annual precipitation of the location; the equation has an adjusted R-squared of approximately 0.95 and residual standard error of approximately 0.23 base-10 logarithm (cubic meters per second). The mean velocity equation uses discharge, water-surface top width, contributing drainage area, and mean annual precipitation; the equation has an adjusted R-squared of approximately 0.50 and residual standard error of approximately 0.087 third root (meters per second). Residual plots from both equations indicate that reliable estimates of discharge and mean velocity at ungauged stream sites are possible. Further, the relation between contributing drainage area and main-channel slope (a measure of whole-watershed slope) is depicted to aid analyst judgment of equation applicability for ungauged sites. Example applications and computations are provided and discussed within a real-world, discharge

  7. Getting Started with GEO, CouchDB, and Nodejs

    CERN Document Server

    Thompson, Mick

    2011-01-01

    Today's mobile devices have GPS and standard APIs to give you access to coordinates-but what can you do with that data? With this concise book, application developers learn how to work with location data quickly and easily, using Node.js, CouchDB, and other open source tools and libraries. Node.js makes it simple to run event code on the Web, and the CouchDB document-oriented database lets you store location data and perform complex queries on it quickly. You'll learn how to get started with these tools, and then use them together to build an example project called MapChat, using HTML and Ja

  8. Crisis Management: Research Summaries

    Science.gov (United States)

    Brock, Stephen E., Ed.; Dorman, Sally; Anderson, Luke; McNair, Daniel

    2013-01-01

    This article presents summaries of three studies relevant to school crisis response. The first report, "A Framework for International Crisis Intervention" (Sally Dorman), is a review of how existing crisis intervention models (including the NASP PREPaRE model) have been adapted for international use. The second article, "Responding…

  9. Summary of Trends

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Summary of Trends. Optical Ethernet: Direct Ethernet connectivity to businesses through optical fiber. Automation of network infrastructure: Cross-connects for interconnections; Intelligence through software for OA&M. New “data-centric” protection mechanisms ...

  10. Summary of discussion

    International Nuclear Information System (INIS)

    2006-01-01

    This document provides summaries of the discussions occurred during the second international workshop on the indemnification of nuclear damage. It concerns the second accident scenario: a fire on board of a ship transporting enriched uranium hexafluoride along the Danube River. (A.L.B.)

  11. Geothermal energy. Program summary

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    Brief descriptions of geothermal projects funded through the Department of Energy during FY 1978 are presented. Each summary gives the project title, contractor name, contract number, funding level, dates, location, and name of the principal investigator, together with project highlights, which provide informaion such as objectives, strategies, and a brief project description. (MHR)

  12. Symposium summary and prognosis

    International Nuclear Information System (INIS)

    Bjorken, J.D.

    1975-11-01

    The summary of the symposium on high energy physics experiments includes phenomena at low energies, the foundations of physics (considered to be mainly gravitation and quantum electrodynamics), standards of reference used for interpretation of experimental data, the new physics, particle proliferation, theoretical development, and a prognosis for the future

  13. Summary of Session III

    International Nuclear Information System (INIS)

    Furman, M.A.

    2002-01-01

    This is a summary of the talks presented in Session III ''Simulations of Electron-Cloud Build Up'' of the Mini-Workshop on Electron-Cloud Simulations for Proton and Positron Beams ECLOUD-02, held at CERN, 15-18 April 2002

  14. Summaries and future projections

    International Nuclear Information System (INIS)

    Egelstaff, P.A.

    1989-01-01

    In this paper the author gives a brief summary of this meeting. He discusses the status at the current neutron sources and future sources. The current problems with targets, moderators, performance of storage rings and shields are briefly mentioned. Finally, he speculates on the prospects of neutron sources for the future and gives his version of the ultimate source

  15. Executive Summaries: CIL '90.

    Science.gov (United States)

    Elsweiler, John A., Jr.; And Others

    1990-01-01

    Presents summaries of 12 papers presented at the 1990 Computers in Libraries Conference. Topics discussed include online searching; microcomputer-based serials management; microcomputer-based workstations; online public access catalogs (OPACs); multitype library networking; CD-ROM searches; locally mounted online databases; collection evaluation;…

  16. Healthcare. Executive Summary

    Science.gov (United States)

    Carnevale, Anthony P.; Smith, Nicole; Gulish, Artem; Beach, Bennett H.

    2012-01-01

    This executive summary highlights several findings about healthcare. These are: (1) Healthcare is 18 percent of the U.S. economy, twice as high as in other countries; (2) There are two labor markets in healthcare: high-skill, high-wage professional and technical jobs and low-skill, low-wage support jobs; (3) Demand for postsecondary education in…

  17. Summary Stage 2018 - SEER

    Science.gov (United States)

    Access this manual of codes and coding instructions for the summary stage field for cases diagnosed January 1, 2018 and forward. 2018 version applies to every site and/or histology combination, including lymphomas and leukemias. Historically, also called General Staging, California Staging, and SEER Staging.

  18. An evaluation of paediatric medicines reconciliation at hospital discharge into the community

    OpenAIRE

    Huynh, Chi; Wong, Ian Chi Kei; Tomlin, Stephen; Halford, Ellisha; Jani, Yogini; Ghaleb, Maisoon

    2016-01-01

    OBJECTIVE: A UK national survey of primary care physicians has indicated that the medication information on hospital discharge summary was incomplete or inaccurate most of the time. Internationally, studies have shown that hospital pharmacist's interventions reduce these discrepancies in the adult population. There have been no published studies on the incidence and severity of the discrepancies of the medication prescribed for children specifically at discharge to date. The objectives of thi...

  19. Joint study on activation of international nuclear information use through implementation INIS DB server with IAEA

    International Nuclear Information System (INIS)

    Lee, H. C.; Yi, J. H.; Kim, T. W.; Chun, Y. C.; Yoo, A. N.

    2003-03-01

    In order to install the INIS DB host site in Korea, the Korea INIS national center has cooperated with KAERI and organizations concerned, contacted the INIS secretariat participated in the consultative meeting of INIS liaison officers, and strengthened the relationship with Asian and Oceanian countries. And KAERI staff and a maintenance engineer participated training seminar on INIS DB installation and maintenance. The Korea national center obtained the INIS DB server code and data by international cooperation activity. Based these code and data, hardware and software for INIS DB server are purchased. INIS DB server system was installed the software and INIS database(2,347,302) was constructed. In 2003 INIS host DB site started to provide web service in Korea. Also It enables the users in the member countries in Asia as well as domestic users to get quick information. It will also bring the active use of the domestic INIS DB and the increase of the productivity of domestic research activities

  20. Results on (UNPublished Wet Runs on Pulsating DB White Dwarfs

    Directory of Open Access Journals (Sweden)

    Handler G.

    2003-03-01

    Full Text Available I have collected all the WET archival data on the pulsating DB white dwarf stars (DBVs and re-reduced them. In addition, the WET has recently observed three DBVs. Preliminary results on PG 1115+158, PG 1351+489, KUV 05134+2605, PG 1654+160 and PG 1456+103 are presented, and the future use of the data is outlined.

  1. HTT-DB: horizontally transferred transposable elements database.

    Science.gov (United States)

    Dotto, Bruno Reis; Carvalho, Evelise Leis; Silva, Alexandre Freitas; Duarte Silva, Luiz Fernando; Pinto, Paulo Marcos; Ortiz, Mauro Freitas; Wallau, Gabriel Luz

    2015-09-01

    Horizontal transfer of transposable (HTT) elements among eukaryotes was discovered in the mid-1980s. As then, >300 new cases have been described. New findings about HTT are revealing the evolutionary impact of this phenomenon on host genomes. In order to provide an up to date, interactive and expandable database for such events, we developed the HTT-DB database. HTT-DB allows easy access to most of HTT cases reported along with rich information about each case. Moreover, it allows the user to generate tables and graphs based on searches using Transposable elements and/or host species classification and export them in several formats. This database is freely available on the web at http://lpa.saogabriel.unipampa.edu.br:8080/httdatabase. HTT-DB was developed based on Java and MySQL with all major browsers supported. Tools and software packages used are free for personal or non-profit projects. bdotto82@gmail.com or gabriel.wallau@gmail.com. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  2. SiteDB: Marshalling people and resources available to CMS

    Energy Technology Data Exchange (ETDEWEB)

    Metson, S [H.H. Wills Physics Laboratory, Bristol (United Kingdom); Bonacorsi, D [University of Bologna and INFN Bologna (Italy); Ferreira, M Dias [SPRACE (Brazil); Egeland, R [University of Minnesota, Twin Cities (United States)

    2010-04-01

    In a collaboration the size of CMS (approx. 3000 users, and almost 100 computing centres of varying size) communication and accurate information about the sites it has access to is vital in co-ordinating the multitude of computing tasks required for smooth running. SiteDB is a tool developed by CMS to track sites available to the collaboration, the allocation to CMS of resources available at those sites and the associations between CMS members and the sites (as either a manager/operator of the site or a member of a group associated to the site). It is used to track the roles a person has for an associated site or group. SiteDB eases the coordination load for the operations teams by providing a consistent interface to manage communication with the people working at a site, by identifying who is responsible for a given task or service at a site and by offering a uniform interface to information on CMS contacts and sites. SiteDB provides api's and reports for other CMS tools to use to access the information it contains, for instance enabling CRAB to use 'user friendly' names when black/white listing CE's, providing role based authentication and authorisation for other web based services and populating various troubleshooting squads in external ticketing systems in use daily by CMS Computing operations.

  3. SiteDB: Marshalling people and resources available to CMS

    International Nuclear Information System (INIS)

    Metson, S; Bonacorsi, D; Ferreira, M Dias; Egeland, R

    2010-01-01

    In a collaboration the size of CMS (approx. 3000 users, and almost 100 computing centres of varying size) communication and accurate information about the sites it has access to is vital in co-ordinating the multitude of computing tasks required for smooth running. SiteDB is a tool developed by CMS to track sites available to the collaboration, the allocation to CMS of resources available at those sites and the associations between CMS members and the sites (as either a manager/operator of the site or a member of a group associated to the site). It is used to track the roles a person has for an associated site or group. SiteDB eases the coordination load for the operations teams by providing a consistent interface to manage communication with the people working at a site, by identifying who is responsible for a given task or service at a site and by offering a uniform interface to information on CMS contacts and sites. SiteDB provides api's and reports for other CMS tools to use to access the information it contains, for instance enabling CRAB to use 'user friendly' names when black/white listing CE's, providing role based authentication and authorisation for other web based services and populating various troubleshooting squads in external ticketing systems in use daily by CMS Computing operations.

  4. Discharge cleaning for a tokamak

    International Nuclear Information System (INIS)

    Ishii, Shigeyuki

    1983-01-01

    Various methods of discharge cleaning for tokamaks are described. The material of the first walls of tokamaks is usually stainless steel, inconel, titanium and so on. Hydrogen is exclusively used as the discharge gas. Glow discharge cleaning (GDC), Taylor discharge cleaning (TDC), and electron cyclotron resonance discharge cleaning (ECR-DC) are discussed in this paper. The cleaning by GDC is made by moving a movable anode to the center of a tokamak vassel. Taylor found the good cleaning effect of induced discharge by high pressure and low power discharge. This is called TDC. When the frequency of high frequency discharge in a magnetic field is equal to that of the electron cyclotron resonance, the break down potential is lowered if the pressure is sufficiently low. The ECR-CD is made by using this effect. In TDC and ECR-DC, the electron temperature, which has a close relation to the production rate of H 0 , can be controlled by the pressure. In GDC, the operating pressure was improved by the radio frequency glow (RG) method. However, there is still the danger of arcing. In case of GDC and ECR-DC, the position of plasma can be controlled, but not in case of TDC. The TDC is accepted by most of takamak devices in the world. (Kato, T.)

  5. Preliminary data summary for the hospitals point-source category

    International Nuclear Information System (INIS)

    Strassler, E.; Hund, F.H.

    1989-09-01

    The summaries were prepared in order to allow EPA to respond to the mandate of Section 304(m) of the Clean Water Act. Summaries for categories already subject to rulemaking were developed for comparison purposes, and contain only the minimum amount of data needed to provide some perspective on the relative magnitude of the pollution problems created across the categories. The document summarizes the most current information available regarding the discharge of wastewater and solid wastes containing priority and hazardous non-priority pollutants by hospitals. The document provides a technical basis for determining whether additional national regulations should be developed pursuant to the Clean Water Act (CWA), and makes available preliminary information regarding the discharge of priority and hazardous non-priority pollutants by the hospital industry

  6. The practice of terminal discharge.

    Science.gov (United States)

    Radha Krishna, Lalit Kumar; Murugam, Vengadasalam; Quah, Daniel Song Chiek

    2017-01-01

    'Terminal discharges' are carried out in Singapore for patients who wish to die at home. However, if due diligence is not exercised, parallels may be drawn with euthanasia. We present a theoretical discussion beginning with the definition of terminal discharges and the reasons why they are carried out in Singapore. By considering the intention behind terminal discharges and utilising a multidisciplinary team to deliberate on the clinical, social and ethical intricacies with a patient- and context-specific approach, euthanasia is avoided. It is hoped that this will provide a platform for professionals in palliative medicine to negotiate challenging issues when arranging a terminal discharge, so as to avoid the pitfall of committing euthanasia in a country such as Singapore where euthanasia is illegal. It is hoped that a set of guidelines for terminal discharges may someday be realised to assist professionals in Singapore and around the world.

  7. The ASDEX Upgrade discharge schedule

    International Nuclear Information System (INIS)

    Neu, G.; Engelhardt, K.; Raupp, G.; Treutterer, W.; Zasche, D.; Zehetbauer, T.

    2007-01-01

    ASDEX Upgrade's recently commissioned discharge control system (DCS) marks the transition from a traditional programmed system to a highly flexible 'data driven' one. The allocation of application processes (APs) to controllers, the interconnection of APs through uniquely named signals, and AP control parameter values are all defined as data, and can easily be adapted to the requirements of a particular discharge. The data is laid down in a set of XML documents which APs request via HTTP from a configuration server before a discharge. The use of XML allows for easy parsing, and structural validation through (XSD) schemas. The central input to the configuration process is the discharge schedule (DS), which embodies the dynamic behaviour of a planned discharge as reference trajectories grouped in segments, concatenated through transition conditions. Editing, generation and validation tools, and version control through CVS allow for efficient management of DSs

  8. Oligonol, a low-molecular-weight polyphenol derived from lychee fruit, attenuates diabetes-induced renal damage through the advanced glycation end product-related pathway in db/db mice.

    Science.gov (United States)

    Park, Chan Hum; Yokozawa, Takako; Noh, Jeong Sook

    2014-08-01

    This study was conducted to examine whether oligonol, a low-molecular-weight polyphenol derived from lychee fruit, has an ameliorative effect on diabetes-induced alterations, such as advanced glycation end product (AGE) formation or apoptosis in the kidneys of db/db mice with type 2 diabetes. Oligonol [10 or 20 mg/(kg body weight · d), orally] was administered every day for 8 wk to prediabetic db/db mice, and its effect was compared with vehicle-treated db/db and normal control mice (m/m). The administration of oligonol decreased the elevated renal glucose concentrations and reactive oxygen species in db/db mice (P factor-α (P related variables, representing renoprotective effects against the development of diabetic complications in db/db mice with type 2 diabetes. © 2014 American Society for Nutrition.

  9. Magnolia officinalis Extract Contains Potent Inhibitors against PTP1B and Attenuates Hyperglycemia in db/db Mice

    Directory of Open Access Journals (Sweden)

    Jing Sun

    2015-01-01

    Full Text Available Protein tyrosine phosphatase 1B (PTP1B is an established therapeutic target for type 2 diabetes mellitus (T2DM and obesity. The aim of this study was to investigate the inhibitory activity of Magnolia officinalis extract (ME on PTP1B and its anti-T2DM effects. Inhibition assays and inhibition kinetics of ME were performed in vitro. 3T3-L1 adipocytes and C2C12 myotubes were stimulated with ME to explore its bioavailability in cell level. The in vivo studies were performed on db/db mice to probe its anti-T2DM effects. In the present study, ME inhibited PTP1B in a reversible competitive manner and displayed good selectivity against PTPs in vitro. Furthermore, ME enhanced tyrosine phosphorylation levels of cellular proteins, especially the insulin-induced tyrosine phosphorylations of insulin receptor β-subunit (IRβ and ERK1/2 in a dose-dependent manner in stimulated 3T3-L1 adipocytes and C2C12 myotubes. Meanwhile, ME enhanced insulin-stimulated GLUT4 translocation. More importantly, there was a significant decrease in fasting plasma glucose level of db/db diabetic mice treated orally with 0.5 g/kg ME for 4 weeks. These findings indicated that improvement of insulin sensitivity and hypoglycemic effects of ME may be attributed to the inhibition of PTP1B. Thereby, we pioneered the inhibitory potential of ME targeted on PTP1B as anti-T2DM drug discovery.

  10. Data Container Study for Handling array-based data using Hive, Spark, MongoDB, SciDB and Rasdaman

    Science.gov (United States)

    Xu, M.; Hu, F.; Yang, J.; Yu, M.; Yang, C. P.

    2017-12-01

    Geoscience communities have come up with various big data storage solutions, such as Rasdaman and Hive, to address the grand challenges for massive Earth observation data management and processing. To examine the readiness of current solutions in supporting big Earth observation, we propose to investigate and compare four popular data container solutions, including Rasdaman, Hive, Spark, SciDB and MongoDB. Using different types of spatial and non-spatial queries, datasets stored in common scientific data formats (e.g., NetCDF and HDF), and two applications (i.e. dust storm simulation data mining and MERRA data analytics), we systematically compare and evaluate the feature and performance of these four data containers in terms of data discover and access. The computing resources (e.g. CPU, memory, hard drive, network) consumed while performing various queries and operations are monitored and recorded for the performance evaluation. The initial results show that 1) the popular data container clusters are able to handle large volume of data, but their performances vary in different situations. Meanwhile, there is a trade-off between data preprocessing, disk saving, query-time saving, and resource consuming. 2) ClimateSpark, MongoDB and SciDB perform the best among all the containers in all the queries tests, and Hive performs the worst. 3) These studied data containers can be applied on other array-based datasets, such as high resolution remote sensing data and model simulation data. 4) Rasdaman clustering configuration is more complex than the others. A comprehensive report will detail the experimental results, and compare their pros and cons regarding system performance, ease of use, accessibility, scalability, compatibility, and flexibility.

  11. Reduced sulfation of chondroitin sulfate but not heparan sulfate in kidneys of diabetic db/db mice.

    Science.gov (United States)

    Reine, Trine M; Grøndahl, Frøy; Jenssen, Trond G; Hadler-Olsen, Elin; Prydz, Kristian; Kolset, Svein O

    2013-08-01

    Heparan sulfate proteoglycans are hypothesized to contribute to the filtration barrier in kidney glomeruli and the glycocalyx of endothelial cells. To investigate potential changes in proteoglycans in diabetic kidney, we isolated glycosaminoglycans from kidney cortex from healthy db/+ and diabetic db/db mice. Disaccharide analysis of chondroitin sulfate revealed a significant decrease in the 4-O-sulfated disaccharides (D0a4) from 65% to 40%, whereas 6-O-sulfated disaccharides (D0a6) were reduced from 11% to 6%, with a corresponding increase in unsulfated disaccharides. In contrast, no structural differences were observed in heparan sulfate. Furthermore, no difference was found in the molar amount of glycosaminoglycans, or in the ratio of hyaluronan/heparan sulfate/chondroitin sulfate. Immunohistochemical staining for the heparan sulfate proteoglycan perlecan was similar in both types of material but reduced staining of 4-O-sulfated chondroitin and dermatan was observed in kidney sections from diabetic mice. In support of this, using qRT-PCR, a 53.5% decrease in the expression level of Chst-11 (chondroitin 4-O sulfotransferase) was demonstrated in diabetic kidney. These results suggest that changes in the sulfation of chondroitin need to be addressed in future studies on proteoglycans and kidney function in diabetes.

  12. Observations and Inferred Physical Characteristics of Compact Intracloud Discharges

    International Nuclear Information System (INIS)

    Argo, P.E.; Eack, K.B.; Holden, D.N.; Massey, R.S.; Shao, X.; Smith, D.A.; Wiens, K.C.

    1999-01-01

    Compact intracloud discharges (CIDS) represent a distinct class of electrical discharges that occur within intense regions of thunderstorms. They are singular discharges that produce brief (typically 3 ampersand micro;s in duration) broadband RF emissions that are 20 to 30 dB more powerful than radiation from all other recorded lightning processes in the HF and VHF radio spectrum. Far field electric field change recordings of CIDS consist of a single, large-amplitude bipolar pulse that begins to rise during the RF-producing phase of the CID and typically lasts for 20 ampersand micro;s. During the summer of 1998 we operated a 4-station array of electric field change meters in New Mexico to support FORTE satellite observations of transient RF and optical sources and to learn more about the phenomenology and physical characteristics of CIDS. Over 800 CIDS were detected and located during the campaign. The events were identified on the basis of their unique field change waveforms. CID source heights determined using the relative delays of ionospherically reflected source emissions were typically between 4 and 11 km above ground level. Events of both positive and negative polarity were observed with events' of initially- negative polarity (indicative of discharges occurring between underlying positive and overlying negative charge) occurring at slightly higher altitudes. Within CID field change waveforms the CID pulse was often followed within a few ms by one or more smaller-amplitude pulses. We associate these subsequent pulses with the initial activity of a ''normal'' intracloud flash, the inference being that some fraction of the time, a CID initiates an intracloud lightning flash

  13. Mirror Confinement Systems: project summaries

    International Nuclear Information System (INIS)

    1980-07-01

    This report contains descriptions of the projects supported by the Mirror Confinement Systems (MCS) Division of the Office of Fusion Energy. The individual project summaries were prepared by the principal investigators, in collaboration with MCS staff office, and include objectives and milestones for each project. In addition to project summaries, statements of Division objectives and budget summaries are also provided

  14. Summary on experiments

    International Nuclear Information System (INIS)

    Livingston, A.E.

    1981-01-01

    Experimental studies of the atomic structures of both simple and complex atoms and ions provide crucial tests of atomic structure theory and of calculational techniques for a wide range of atomic systems. This summary is restricted to a brief discussion of some recent and current experiments in few-electron and many-electron atoms and ions which represent exciting challenges to sophisticated atomic structure calculations, discussed elsewhere. In particular the emphasis is on high-Z systems

  15. Blois V: Experimental summary

    International Nuclear Information System (INIS)

    Albrow, M.G.

    1993-09-01

    The author gives a summary talk of the best experimental data given at the Vth Blois Workshop on Elastic and Diffractive Scattering. He addresses the following eight areas in his talk: total and elastic cross sections; single diffractive excitation; electron-proton scattering; di-jets and rapidity gaps; areas of future study; spins and asymmetries; high-transverse momentum and masses at the Tevatron; and disoriented chiral condensates and cosmic radiation

  16. Summary and outlook

    Energy Technology Data Exchange (ETDEWEB)

    Jong, M. de, E-mail: mjg@nikhef.nl [Nikhef - National Institute for Subatomic Physics, Science Park 105, 1098 XG Amsterdam (Netherlands); LION - Leiden Institute of Physics, Leiden University, PO Box 9504, 2300 RA Leiden (Netherlands)

    2013-10-11

    In 2003, a series of Very Large Volume Neutrino Telescope Workshops (VLVnT) was initiated in Amsterdam, the Netherlands. The 5th workshop in this series took place in Erlangen, Germany, between 12–14 October 2011 and focused on the aspects of high-energy neutrino astronomy. In this summary report, an overview of the activities world-wide is presented as well as the perspectives of the field.

  17. Blois 5: Experimental summary

    Science.gov (United States)

    Albrow, M. G.

    1993-09-01

    The author gives a summary talk of the best experimental data given at the 5th Blois Workshop on Elastic and Diffractive Scattering. He addresses the following eight areas in his talk: total and elastic cross sections; single diffractive excitation; electron-proton scattering; di-jets and rapidity gaps; areas of future study; spins and asymmetries; high-transverse momentum and masses at the Tevatron; and disoriented chiral condensates and cosmic radiation.

  18. Mineral commodity summaries 2015

    Science.gov (United States)

    ,

    2015-01-01

    Each chapter of the 2015 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2014 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses.

  19. Blois V: Experimental summary

    Energy Technology Data Exchange (ETDEWEB)

    Albrow, M.G.

    1993-09-01

    The author gives a summary talk of the best experimental data given at the Vth Blois Workshop on Elastic and Diffractive Scattering. He addresses the following eight areas in his talk: total and elastic cross sections; single diffractive excitation; electron-proton scattering; di-jets and rapidity gaps; areas of future study; spins and asymmetries; high-transverse momentum and masses at the Tevatron; and disoriented chiral condensates and cosmic radiation.

  20. Annual report on radioactive discharges and monitoring of the environment 1991. V. 1

    International Nuclear Information System (INIS)

    1992-01-01

    This Annual Report supplements and updates British Nuclear Fuel plc's Health and Safety and the Environment Annual Report by providing more detailed information on radioactive discharges, monitoring of the environment and critical groups doses. BNFL has published Annual Reports on Radioactive Discharges and Monitoring of the Environment since 1977. This year the report is again sub-divided into two complementary volumes. Volume I includes, for each of the Company's sites, annual data on radioactive discharges into the environment and the associated environmental monitoring programmes. Critical groups doses for each site are presented in summary tables at the beginning of each chapter. (author)

  1. ULSGEN (Uplink Summary Generator)

    Science.gov (United States)

    Wang, Y.-F.; Schrock, M.; Reeve, T.; Nguyen, K.; Smith, B.

    2014-01-01

    Uplink is an important part of spacecraft operations. Ensuring the accuracy of uplink content is essential to mission success. Before commands are radiated to the spacecraft, the command and sequence must be reviewed and verified by various teams. In most cases, this process requires collecting the command data, reviewing the data during a command conference meeting, and providing physical signatures by designated members of various teams to signify approval of the data. If commands or sequences are disapproved for some reason, the whole process must be restarted. Recording data and decision history is important for traceability reasons. Given that many steps and people are involved in this process, an easily accessible software tool for managing the process is vital to reducing human error which could result in uplinking incorrect data to the spacecraft. An uplink summary generator called ULSGEN was developed to assist this uplink content approval process. ULSGEN generates a web-based summary of uplink file content and provides an online review process. Spacecraft operations personnel view this summary as a final check before actual radiation of the uplink data. .

  2. Recurrent vaginal discharge in children.

    Science.gov (United States)

    McGreal, Sharon; Wood, Paul

    2013-08-01

    Childhood vaginal discharge remains a frequent reason for referral from primary to secondary care. The Pediatric and Adolescent Gynecology (PAG) service at Kettering General Hospital was established in 1993 and provides a specialized service that meets the needs of children with gynaecological conditions. To investigate recurrent vaginal discharge noting symptomatology, defining pathogens, common and rarer causes, exploring management regimes, and any changes in practice over time. Retrospective review spanning 15 years identifying prepubertal children attending the outpatient PAG clinic with recurrent vaginal discharge. We reviewed the medical notes individually. 110 patients were identified; 85% were referred from primary care. The age distribution was bimodal at four and eight years. Thirty-five percent of our patients were discharged after the initial consultation. The commonest cause of discharge was vulvovaginitis (82%). Other important causes included suspected sexual abuse (5%), foreign body (3%), labial adhesions (3%), vaginal agenesis (2%). 35% of patients were admitted for vaginoscopy. Vaginal discharge is the most common gynecological symptom in prepubertal girls and can cause repeated clinical episodes. Vulvovaginitis is the most common cause and often responds to simple hygiene measures. Awareness of the less common causes of vaginal discharge is essential. Copyright © 2013 North American Society for Pediatric and Adolescent Gynecology. Published by Elsevier Inc. All rights reserved.

  3. Analysis of neuron–astrocyte metabolic cooperation in the brain of db/db mice with cognitive decline using 13C NMR spectroscopy

    Science.gov (United States)

    Zheng, Hong; Zheng, Yongquan; Wang, Dan; Cai, Aimin; Lin, Qiuting; Zhao, Liangcai; Chen, Minjiang; Deng, Mingjie; Ye, Xinjian

    2016-01-01

    Type 2 diabetes has been linked to cognitive impairment, but its potential metabolic mechanism is still unclear. The present study aimed to explore neuron–astrocyte metabolic cooperation in the brain of diabetic (db/db, BKS.Cg-m+/+ Leprdb/J) mice with cognitive decline using 13C NMR technique in combination with intravenous [2-13C]-acetate and [3-13C]-lactate infusions. We found that the 13C-enrichment from [2-13C]-acetate into tricarboxylic acid cycle intermediate, succinate, was significantly decreased in db/db mice with cognitive decline compared with wild-type (WT, C57BLKS/J) mice, while an opposite result was obtained after [3-13C]-lactate infusion. Relative to WT mice, db/db mice with cognitive decline had significantly lower 13C labeling percentages in neurotransmitters including glutamine, glutamate, and γ-aminobutyric acid after [2-13C]-acetate infusion. However, [3-13C]-lactate resulted in increased 13C-enrichments in neurotransmitters in db/db mice with cognitive decline. This may indicate that the disturbance of neurotransmitter metabolism occurred during the development of cognitive decline. In addition, a reduction in 13C-labeling of lactate and an increase in gluconeogenesis were found from both labeled infusions in db/db mice with cognitive decline. Therefore, our results suggest that the development of cognitive decline in type 2 diabetes may be implicated to an unbalanced metabolism in neuron–astrocyte cooperation and an enhancement of gluconeogenesis. PMID:26762505

  4. Analysis of neuron-astrocyte metabolic cooperation in the brain of db/db mice with cognitive decline using 13C NMR spectroscopy.

    Science.gov (United States)

    Zheng, Hong; Zheng, Yongquan; Wang, Dan; Cai, Aimin; Lin, Qiuting; Zhao, Liangcai; Chen, Minjiang; Deng, Mingjie; Ye, Xinjian; Gao, Hongchang

    2017-01-01

    Type 2 diabetes has been linked to cognitive impairment, but its potential metabolic mechanism is still unclear. The present study aimed to explore neuron-astrocyte metabolic cooperation in the brain of diabetic (db/db, BKS.Cg-m +/+ Leprdb/J) mice with cognitive decline using 13 C NMR technique in combination with intravenous [2- 13 C]-acetate and [3- 13 C]-lactate infusions. We found that the 13 C-enrichment from [2- 13 C]-acetate into tricarboxylic acid cycle intermediate, succinate, was significantly decreased in db/db mice with cognitive decline compared with wild-type (WT, C57BLKS/J) mice, while an opposite result was obtained after [3- 13 C]-lactate infusion. Relative to WT mice, db/db mice with cognitive decline had significantly lower 13 C labeling percentages in neurotransmitters including glutamine, glutamate, and γ-aminobutyric acid after [2- 13 C]-acetate infusion. However, [3- 13 C]-lactate resulted in increased 13 C-enrichments in neurotransmitters in db/db mice with cognitive decline. This may indicate that the disturbance of neurotransmitter metabolism occurred during the development of cognitive decline. In addition, a reduction in 13 C-labeling of lactate and an increase in gluconeogenesis were found from both labeled infusions in db/db mice with cognitive decline. Therefore, our results suggest that the development of cognitive decline in type 2 diabetes may be implicated to an unbalanced metabolism in neuron-astrocyte cooperation and an enhancement of gluconeogenesis. © The Author(s) 2016.

  5. Legal aspects of thermal discharges

    International Nuclear Information System (INIS)

    Martin, A.J.

    1974-01-01

    An overview of those legal areas which directly affect technical and planning decisions is presented in the form of 2 legal approaches which constrain the indiscriminate release of thermal discharges to receiving waters. One takes the form of private remedies which have traditionally been available to aggrieved parties who are in some way damaged by the harmful discharge. The 2nd approach utilizes the various statutory constraints leading to direct governmental action. It appears that statutory law is playing the prominent role in restricting the temperature to which receiving waters may be raised as a result of such discharges by using effluent limitations and water quality standards. (Water Resour. Abstr.)

  6. An introduction to gas discharges

    CERN Document Server

    Howatson, A M

    2013-01-01

    An Introduction to Gas Discharges: Second Edition aims to provide a compact introduction to the subject of gas discharges, which continues to make both scientific and industrial progress. In this second edition, the author has made minor corrections, rewritten and expanded some sections, used SI units and modernized notions, in hopes of making the book more up to date. Included in the book is a short history of the subject, an introduction that enumerates the types of gas discharges, the fundamental processes, and then moves on to the more specific areas such as the breakdown, the self-sustai

  7. CQI project improves discharge process.

    Science.gov (United States)

    1998-08-01

    At Gibson Rehab Center in Williamsport, PA, a continuous quality improvement project to bolster the institution's discharge planning process has resulted in increased satisfaction and an award for quality. The 15-month project was spearheaded by a multidisciplinary team charged with identifying areas that had a significant impact on customer service and suggesting better ways of delivering that service. Among the changes the group suggested were establishing a weekly discharge planning group for new neuro patients, assigning a discharge coordinator for each treatment team, and creating an interdisciplinary communication sheet for the home health therapy staff.

  8. cuticleDB: a relational database of Arthropod cuticular proteins

    Directory of Open Access Journals (Sweden)

    Willis Judith H

    2004-09-01

    Full Text Available Abstract Background The insect exoskeleton or cuticle is a bi-partite composite of proteins and chitin that provides protective, skeletal and structural functions. Little information is available about the molecular structure of this important complex that exhibits a helicoidal architecture. Scores of sequences of cuticular proteins have been obtained from direct protein sequencing, from cDNAs, and from genomic analyses. Most of these cuticular protein sequences contain motifs found only in arthropod proteins. Description cuticleDB is a relational database containing all structural proteins of Arthropod cuticle identified to date. Many come from direct sequencing of proteins isolated from cuticle and from sequences from cDNAs that share common features with these authentic cuticular proteins. It also includes proteins from the Drosophila melanogaster and the Anopheles gambiae genomes, that have been predicted to be cuticular proteins, based on a Pfam motif (PF00379 responsible for chitin binding in Arthropod cuticle. The total number of the database entries is 445: 370 derive from insects, 60 from Crustacea and 15 from Chelicerata. The database can be accessed from our web server at http://bioinformatics.biol.uoa.gr/cuticleDB. Conclusions CuticleDB was primarily designed to contain correct and full annotation of cuticular protein data. The database will be of help to future genome annotators. Users will be able to test hypotheses for the existence of known and also of yet unknown motifs in cuticular proteins. An analysis of motifs may contribute to understanding how proteins contribute to the physical properties of cuticle as well as to the precise nature of their interaction with chitin.

  9. ProCarDB: a database of bacterial carotenoids.

    Science.gov (United States)

    Nupur, L N U; Vats, Asheema; Dhanda, Sandeep Kumar; Raghava, Gajendra P S; Pinnaka, Anil Kumar; Kumar, Ashwani

    2016-05-26

    Carotenoids have important functions in bacteria, ranging from harvesting light energy to neutralizing oxidants and acting as virulence factors. However, information pertaining to the carotenoids is scattered throughout the literature. Furthermore, information about the genes/proteins involved in the biosynthesis of carotenoids has tremendously increased in the post-genomic era. A web server providing the information about microbial carotenoids in a structured manner is required and will be a valuable resource for the scientific community working with microbial carotenoids. Here, we have created a manually curated, open access, comprehensive compilation of bacterial carotenoids named as ProCarDB- Prokaryotic Carotenoid Database. ProCarDB includes 304 unique carotenoids arising from 50 biosynthetic pathways distributed among 611 prokaryotes. ProCarDB provides important information on carotenoids, such as 2D and 3D structures, molecular weight, molecular formula, SMILES, InChI, InChIKey, IUPAC name, KEGG Id, PubChem Id, and ChEBI Id. The database also provides NMR data, UV-vis absorption data, IR data, MS data and HPLC data that play key roles in the identification of carotenoids. An important feature of this database is the extension of biosynthetic pathways from the literature and through the presence of the genes/enzymes in different organisms. The information contained in the database was mined from published literature and databases such as KEGG, PubChem, ChEBI, LipidBank, LPSN, and Uniprot. The database integrates user-friendly browsing and searching with carotenoid analysis tools to help the user. We believe that this database will serve as a major information centre for researchers working on bacterial carotenoids.

  10. Vaginal itching and discharge - child

    Science.gov (United States)

    Pruritus vulvae; Itching - vaginal area; Vulvar itching; Yeast infection - child ... Common causes of vaginal itching and discharge in young girls include: Chemicals such as perfumes and dyes in detergents, fabric softeners, creams, ointments, ...

  11. Microwave discharges in capillary tubes

    International Nuclear Information System (INIS)

    Dervisevic, Emil

    1984-01-01

    This research thesis aims at being a contribution to the study of microwave discharge by a surface wave, and more precisely focusses on the discharge in capillary tubes filled with argon. The author first present theoretical models which describe, on the one hand, the propagation of the surface wave along the plasma column, and, on the other hand, longitudinal and radial profiles of the main discharge characteristics. The second part addresses the study of the influence of parameters (gas pressure and tube radius) on discharge operation and characteristics. Laws of similitude as well as empirical relationships between argon I and argon II emission line intensities, electron density, and electric field in the plasma have been established [fr

  12. Ion source of discharge type

    Energy Technology Data Exchange (ETDEWEB)

    Enchevich, I.B. [TRIUMF, Cyclotron Div., Vancouver, British Columbia (Canada); Korenev, S.A. [JINR, Hihg Energy Physics Lab., Dubna, Moscow (Russian Federation)

    1992-07-01

    A new scheme of ion source based on a dielectric surface sliding discharge is described. The conditions to form this type of discharge are analyzed and experimental results are shown. The main parameters of this ion source are: accelerating voltage U = 1/20kV; continuous extracted ion beam; current density j = 0.01/0.5 A/cm{sup 2}; ions of Cl, F, C, H; residual gas pressure P = 10{sup -6} Torr. A magnetic system is used to separate the different types of ions. The dielectric material in the discharge circuit (anode plasma emitter) defines the type of ions. The emission characteristics of plasma emitter and the discharge parameters are presented. The ion current yield satisfies the Child-Langmuir law. (author)

  13. Ion source of discharge type

    International Nuclear Information System (INIS)

    Enchevich, I.B.; Korenev, S.A.

    1992-07-01

    A new scheme of ion source based on a dielectric surface sliding discharge is described. The conditions to form this type of discharge are analyzed and experimental results are shown. The main parameters of this ion source are: accelerating voltage U = 1/20kV; continuous extracted ion beam; current density j = 0.01/0.5 A/cm 2 ; ions of Cl, F, C, H; residual gas pressure P = 10 -6 Torr. A magnetic system is used to separate the different types of ions. The dielectric material in the discharge circuit (anode plasma emitter) defines the type of ions. The emission characteristics of plasma emitter and the discharge parameters are presented. The ion current yield satisfies the Child-Langmuir law. (author)

  14. 75 FR 35712 - National Pollutant Discharge Elimination System (NPDES): Use of Sufficiently Sensitive Test...

    Science.gov (United States)

    2010-06-23

    ... necessary to meet water quality standards. With respect to the protection of water quality, NPDES permits... protection of human health; for discharges to the Great Lakes Basin, the applicable water quality criteria...: Proposed rule. SUMMARY: The Environmental Protection Agency (EPA) is proposing minor amendments to its...

  15. Evolution of Some Particle Detectors Based On the Discharge in Gases

    Science.gov (United States)

    Charpak, G.

    1969-11-19

    Summary of the properties of some of the detectors that are commonly used in counter experiments to localize charged particles, and which are based on discharge in gases under the influence of electric fields and some basic facts of gaseous amplification in homogeneous and inhomogeneous fields.

  16. Radioactive discharges from Sellafield (UK)

    International Nuclear Information System (INIS)

    Pentreath, R.J.

    1985-01-01

    This study of low-level liquid radioactive discharges from the British Nuclear Fuels Ltd Sellafield site into the eastern basin of the Irish Sea, prepared on the basis of existing publications and documents, reviews chemical forms and rate of discharges, physical oceanography, sediment distribution and fisheries of the Irish Sea, behaviour of radionuclides in seawater, association with sedimentary materials, accumulation of radionuclides by biological materials, environmental monitoring, surveillance and assessment of radiation exposure of the public and impact on the environment

  17. Chronic obstructive pulmonary disease - adults - discharge

    Science.gov (United States)

    ... coughing up dark mucus Your fingertips or the skin around your fingernails are blue Alternative Names COPD - adults - discharge; Chronic obstructive airways disease - adults - discharge; Chronic obstructive lung disease - adults - discharge; ...

  18. Ballooning stability of JET discharges

    International Nuclear Information System (INIS)

    Huysmans, G.T.A.; Goedbloed, J.P.; Galvao, R.M.O.; Lazzaro, E.; Smeulders, P.

    1989-01-01

    Conditions under which ballooning modes are expected to be excited have recently been obtained in two different types of discharges in JET. In the first type, extremely large pressure gradients have been produced in the plasma core through pellet injections in the current rise phase followed by strong additional heating. In the second type, the total pressure of the discharge is approaching the Troyon limit. The stability of these discharges with respect to the ideal MHD ballooning modes has been studied with the stability code HBT. The equilibria are reconstructed with the IDENTC code using the external magnetic measurements and the experimental pressure profile. The results show that the evaluated high beta discharge is unstable in the central region of the plasma. This instability is related to the low shear and not to a large pressure gradient, as expected at the Troyon limit. In the pellet discharges the regions with the large pressure gradients are unstable to ballooning modes at the time of the beta decay, which ends the period of enhanced performance. The maximum pressure gradient in these discharges is limited by the boundary of the first region of stability. The observed phenomena at the beta decay are similar to those observed at the beta limit in DIII-D and TFTR. (author)

  19. Filamentary and diffuse barrier discharges

    International Nuclear Information System (INIS)

    Kogelschatz, U.

    2001-01-01

    Barrier discharges, sometimes also referred to as dielectric-barrier discharges or silent discharges, are characterized by the presence of at least one insulating layer in contact with the discharge between two planar or cylindrical electrodes connected to an ac power supply. The main advantage of this type of electrical discharge is, that non-equilibrium plasma conditions in atmospheric-pressure gases can be established in an economic and reliable way. This has led to a number of important applications including industrial ozone generation, surface modification of polymers, plasma chemical vapor deposition, excitation of CO 2 lasers, excimer lamps and, most recently, large-area flat plasma display panels. Depending on the application, the width of the discharge gap can range from less than 0.1 mm to about 100 mm and the applied frequency from below line frequency to several gigahertz. Typical materials used for the insulating layer (dielectric barrier) are glass, quartz, ceramics but also thin enamel or polymer layers

  20. Design, Implementation and Applications of 3d Web-Services in DB4GEO

    Science.gov (United States)

    Breunig, M.; Kuper, P. V.; Dittrich, A.; Wild, P.; Butwilowski, E.; Al-Doori, M.

    2013-09-01

    The object-oriented database architecture DB4GeO was originally designed to support sub-surface applications in the geo-sciences. This is reflected in DB4GeO's geometric data model as well as in its import and export functions. Initially, these functions were designed for communication with 3D geological modeling and visualization tools such as GOCAD or MeshLab. However, it soon became clear that DB4GeO was suitable for a much wider range of applications. Therefore it is natural to move away from a standalone solution and to open the access to DB4GeO data by standardized OGC web-services. Though REST and OGC services seem incompatible at first sight, the implementation in DB4GeO shows that OGC-based implementation of web-services may use parts of the DB4GeO-REST implementation. Starting with initial solutions in the history of DB4GeO, this paper will introduce the design, adaptation (i.e. model transformation), and first steps in the implementation of OGC Web Feature (WFS) and Web Processing Services (WPS), as new interfaces to DB4GeO data and operations. Among its capabilities, DB4GeO can provide data in different data formats like GML, GOCAD, or DB3D XML through a WFS, as well as its ability to run operations like a 3D-to-2D service, or mesh-simplification (Progressive Meshes) through a WPS. We then demonstrate, an Android-based mobile 3D augmented reality viewer for DB4GeO that uses the Web Feature Service to visualize 3D geo-database query results. Finally, we explore future research work considering DB4GeO in the framework of the research group "Computer-Aided Collaborative Subway Track Planning in Multi-Scale 3D City and Building Models".

  1. LEAP 1992: Conference summary

    International Nuclear Information System (INIS)

    Dover, C.B.

    1992-12-01

    We present a summary of the many new results in antiproton (bar p) physics presented at the LEAP '92 conference, in the areas of meson spectroscopy, bar NN scattering, annihilation and spin observables, strangeness and charm production, bar N annihilation in nuclei, atomic physics with very low energy bar p's, the exploration of fundamental symmetries and interactions with bar p (CP, T, CPT, gravitation), and the prospects for new bar p facilities at ultralow energies or energies above the LEAR regime (≥ 2 GeV/c)

  2. FY 1996 activity summary

    International Nuclear Information System (INIS)

    1997-01-01

    The US Department of Energy Office of Nuclear and Facility Safety provides nuclear safety policy, independent technical evaluation, and technical support. A summary of these activities is provided in this report. These include: (1) changing the mission of the former production facilities to storage and waste management; (2) stabilizing nuclear materials not recycled due to production cessation or interruptions; (3) reformulating the authorization basis for existing facilities to convert to a standards based approach for operations consistent with modern expectations; and (4) implementing a modern regulatory framework for nuclear facilities. Enforcement of the Price-Anderson Amendments Act is also reported

  3. Program summary report

    International Nuclear Information System (INIS)

    1978-01-01

    The report provides summary information on all phases of nuclear regulation, and is intended as an information and decision-making tool for mid and upper level management of the Nuclear Regulatory Commission. The report is divided functionally into ten sections: (1) nuclear power plants in the United States; (2) operating nuclear power plants; (3) reactors under construction; (4) operating license applications under NRC review; (5) construction permit applications and special projects under NRC review; (6) ACRS and ASLBP; (7) nuclear materials; (8) standards and regulations; (9) research projects; and (10) foreign reactors

  4. INTRODUCTION Summary of Papers Summary of Papers

    Science.gov (United States)

    Gauthier, Serge; Abarzhi, Snezhana I.; Sreenivasan, Katepalli R.

    2010-12-01

    . The authors argue that reconnection is not an independent topic but is part of a variety of phenomena associated with the much broader subject of 3D current systems in plasmas. Malyshkin presents a two-fluid magneto-hydrodynamic (MHD) model of quasi-stationary, two-dimensional, magnetic reconnection in an incompressible plasma composed of electrons and ions. The author finds two distinct regimes of slow and fast reconnection, which may serve to explain the initial slow build up and subsequent rapid release of magnetic energy frequently observed in cosmic and laboratory plasmas. Malyshkin and Kulsrud present two theoretical approaches for the calculation of the rate of quasi-stationary, two-dimensional magnetic reconnection with nonuniform anomalous resistivity within the framework of incompressible MHD. These MHD equations are solved for the entire reconnection layer and across the reconnection layer. The approaches give the same approximate answer for the reconnection rate and agree with some recent simulations. Krommes reviews the state-of-the-art in the field of nonlinear gyrokinetics, which is a description of low-frequency dynamics in magnetized plasmas, providing the fundamental basis for numerical simulations of micro-turbulence in magnetic-confinement fusion and astrophysical applications. The author sketches the derivation of the novel dynamical system comprising the nonlinear gyrokinetic equation and the coupled electrostatic gyrokinetic Poisson equation with the use of modern perturbative approaches. This tutorial is accessible to a broad audience and allows the reader to fully appreciate the gyro-kinetic equation as a powerful theoretical tool for studies of turbulence in magnetized plasmas. Canonical plasmas. Several contributions are devoted to experiments and observations on canonical plasmas, including hydrodynamics of discharges and ionosphere. Bagautdinova et al study the influence of the RT instability and turbulent plasma-electrolyte mixing on

  5. Update History of This Database - dbQSNP | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us dbQSNP Update History of This Database Date Update contents 2017/02/16 dbQSNP English archiv...e Description Download License Update History of This Database Site Policy | Contact Us Update History of This Database - dbQSNP | LSDB Archive ... ...e site is opened. 2002/10/23 dbQSNP (http://qsnp.gen.kyushu-u.ac.jp/) is opened. About This Database Databas

  6. dbCAN2: a meta server for automated carbohydrate-active enzyme annotation

    DEFF Research Database (Denmark)

    Zhang, Han; Yohe, Tanner; Huang, Le

    2018-01-01

    of plant and plant-associated microbial genomes and metagenomes being sequenced, there is an urgent need of automatic tools for genomic data mining of CAZymes. We developed the dbCAN web server in 2012 to provide a public service for automated CAZyme annotation for newly sequenced genomes. Here, dbCAN2...... (http://cys.bios.niu.edu/dbCAN2) is presented as an updated meta server, which integrates three state-of-the-art tools for CAZome (all CAZymes of a genome) annotation: (i) HMMER search against the dbCAN HMM (hidden Markov model) database; (ii) DIAMOND search against the CAZy pre-annotated CAZyme...

  7. FungiDB: An Integrated Bioinformatic Resource for Fungi and Oomycetes

    Directory of Open Access Journals (Sweden)

    Evelina Y. Basenko

    2018-03-01

    Full Text Available FungiDB (fungidb.org is a free online resource for data mining and functional genomics analysis for fungal and oomycete species. FungiDB is part of the Eukaryotic Pathogen Genomics Database Resource (EuPathDB, eupathdb.org platform that integrates genomic, transcriptomic, proteomic, and phenotypic datasets, and other types of data for pathogenic and nonpathogenic, free-living and parasitic organisms. FungiDB is one of the largest EuPathDB databases containing nearly 100 genomes obtained from GenBank, Aspergillus Genome Database (AspGD, The Broad Institute, Joint Genome Institute (JGI, Ensembl, and other sources. FungiDB offers a user-friendly web interface with embedded bioinformatics tools that support custom in silico experiments that leverage FungiDB-integrated data. In addition, a Galaxy-based workspace enables users to generate custom pipelines for large-scale data analysis (e.g., RNA-Seq, variant calling, etc.. This review provides an introduction to the FungiDB resources and focuses on available features, tools, and queries and how they can be used to mine data across a diverse range of integrated FungiDB datasets and records.

  8. Classification of electrical discharges in DC Accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Srutarshi, E-mail: sruban.stephens@gmail.com [Accelerator and Pulse Power Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Deb, A.K. [Department of Electrical Engineering, Indian Institute of Technology Kharagpur, Kharagpur 721302 (India); Rajan, Rehim N. [Accelerator and Pulse Power Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Kishore, N.K. [Department of Electrical Engineering, Indian Institute of Technology Kharagpur, Kharagpur 721302 (India)

    2016-08-11

    Controlled electrical discharge aids in conditioning of the system while uncontrolled discharges damage its electronic components. DC Accelerator being a high voltage system is no exception. It is useful to classify electrical discharges according to the severity. Experimental prototypes of the accelerator discharges are developed. Photomultiplier Tubes (PMTs) are used to detect the signals from these discharges. Time and Frequency domain characteristics of the detected discharges are used to extract features. Machine Learning approaches like Fuzzy Logic, Neural Network and Least Squares Support Vector Machine (LSSVM) are employed to classify the discharges. This aids in detecting the severity of the discharges.

  9. GiSAO.db: a database for ageing research

    Directory of Open Access Journals (Sweden)

    Grillari Johannes

    2011-05-01

    Full Text Available Abstract Background Age-related gene expression patterns of Homo sapiens as well as of model organisms such as Mus musculus, Saccharomyces cerevisiae, Caenorhabditis elegans and Drosophila melanogaster are a basis for understanding the genetic mechanisms of ageing. For an effective analysis and interpretation of expression profiles it is necessary to store and manage huge amounts of data in an organized way, so that these data can be accessed and processed easily. Description GiSAO.db (Genes involved in senescence, apoptosis and oxidative stress database is a web-based database system for storing and retrieving ageing-related experimental data. Expression data of genes and miRNAs, annotation data like gene identifiers and GO terms, orthologs data and data of follow-up experiments are stored in the database. A user-friendly web application provides access to the stored data. KEGG pathways were incorporated and links to external databases augment the information in GiSAO.db. Search functions facilitate retrieval of data which can also be exported for further processing. Conclusions We have developed a centralized database that is very well suited for the management of data for ageing research. The database can be accessed at https://gisao.genome.tugraz.at and all the stored data can be viewed with a guest account.

  10. FlavorDB: a database of flavor molecules.

    Science.gov (United States)

    Garg, Neelansh; Sethupathy, Apuroop; Tuwani, Rudraksh; Nk, Rakhi; Dokania, Shubham; Iyer, Arvind; Gupta, Ayushi; Agrawal, Shubhra; Singh, Navjot; Shukla, Shubham; Kathuria, Kriti; Badhwar, Rahul; Kanji, Rakesh; Jain, Anupam; Kaur, Avneet; Nagpal, Rashmi; Bagler, Ganesh

    2018-01-04

    Flavor is an expression of olfactory and gustatory sensations experienced through a multitude of chemical processes triggered by molecules. Beyond their key role in defining taste and smell, flavor molecules also regulate metabolic processes with consequences to health. Such molecules present in natural sources have been an integral part of human history with limited success in attempts to create synthetic alternatives. Given their utility in various spheres of life such as food and fragrances, it is valuable to have a repository of flavor molecules, their natural sources, physicochemical properties, and sensory responses. FlavorDB (http://cosylab.iiitd.edu.in/flavordb) comprises of 25,595 flavor molecules representing an array of tastes and odors. Among these 2254 molecules are associated with 936 natural ingredients belonging to 34 categories. The dynamic, user-friendly interface of the resource facilitates exploration of flavor molecules for divergent applications: finding molecules matching a desired flavor or structure; exploring molecules of an ingredient; discovering novel food pairings; finding the molecular essence of food ingredients; associating chemical features with a flavor and more. Data-driven studies based on FlavorDB can pave the way for an improved understanding of flavor mechanisms. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

  11. MultitaskProtDB: a database of multitasking proteins.

    Science.gov (United States)

    Hernández, Sergio; Ferragut, Gabriela; Amela, Isaac; Perez-Pons, JosepAntoni; Piñol, Jaume; Mozo-Villarias, Angel; Cedano, Juan; Querol, Enrique

    2014-01-01

    We have compiled MultitaskProtDB, available online at http://wallace.uab.es/multitask, to provide a repository where the many multitasking proteins found in the literature can be stored. Multitasking or moonlighting is the capability of some proteins to execute two or more biological functions. Usually, multitasking proteins are experimentally revealed by serendipity. This ability of proteins to perform multitasking functions helps us to understand one of the ways used by cells to perform many complex functions with a limited number of genes. Even so, the study of this phenomenon is complex because, among other things, there is no database of moonlighting proteins. The existence of such a tool facilitates the collection and dissemination of these important data. This work reports the database, MultitaskProtDB, which is designed as a friendly user web page containing >288 multitasking proteins with their NCBI and UniProt accession numbers, canonical and additional biological functions, monomeric/oligomeric states, PDB codes when available and bibliographic references. This database also serves to gain insight into some characteristics of multitasking proteins such as frequencies of the different pairs of functions, phylogenetic conservation and so forth.

  12. Summary of main points

    International Nuclear Information System (INIS)

    2006-01-01

    In conjunction with its 6. annual meeting, the WPDD in close co-operation with the FSC held a Topical session on 'Stakeholder Involvement in Decommissioning' on November 14, 2005. The session was attended by 36 participants totally representing 14 NEA member countries and 2 international organisations. Two keynote addresses were given at the Topical Session. The first one treated of what is needed for robust decisions and how to bring all stakeholders into the debate. In the second keynote address a summary was made on what have been said on stakeholder involvement in decommissioning during earlier meetings of the WPDD. The main part of the session was then devoted to views from different stakeholders regarding their role and their involvement. This part contained viewpoints from local communities (Kaevlinge in Sweden and Port Hope in Canada), authorities (Scottish Executive and CSNC) and operators (EDF from France and EWN from Germany). Case studies from the decommissioning of Dounrey in the UK and from Trojan and Main Yankee in the USA were presented in the end part of the Topical session followed by a summary and lessons learnt report by the Rapporteur. A detailed programme of the Topical session can be seen in Appendix 1

  13. Flow discharge prediction in compound channels using linear genetic programming

    Science.gov (United States)

    Azamathulla, H. Md.; Zahiri, A.

    2012-08-01

    SummaryFlow discharge determination in rivers is one of the key elements in mathematical modelling in the design of river engineering projects. Because of the inundation of floodplains and sudden changes in river geometry, flow resistance equations are not applicable for compound channels. Therefore, many approaches have been developed for modification of flow discharge computations. Most of these methods have satisfactory results only in laboratory flumes. Due to the ability to model complex phenomena, the artificial intelligence methods have recently been employed for wide applications in various fields of water engineering. Linear genetic programming (LGP), a branch of artificial intelligence methods, is able to optimise the model structure and its components and to derive an explicit equation based on the variables of the phenomena. In this paper, a precise dimensionless equation has been derived for prediction of flood discharge using LGP. The proposed model was developed using published data compiled for stage-discharge data sets for 394 laboratories, and field of 30 compound channels. The results indicate that the LGP model has a better performance than the existing models.

  14. Estimating sediment discharge: Appendix D

    Science.gov (United States)

    Gray, John R.; Simões, Francisco J. M.

    2008-01-01

    Sediment-discharge measurements usually are available on a discrete or periodic basis. However, estimates of sediment transport often are needed for unmeasured periods, such as when daily or annual sediment-discharge values are sought, or when estimates of transport rates for unmeasured or hypothetical flows are required. Selected methods for estimating suspended-sediment, bed-load, bed- material-load, and total-load discharges have been presented in some detail elsewhere in this volume. The purposes of this contribution are to present some limitations and potential pitfalls associated with obtaining and using the requisite data and equations to estimate sediment discharges and to provide guidance for selecting appropriate estimating equations. Records of sediment discharge are derived from data collected with sufficient frequency to obtain reliable estimates for the computational interval and period. Most sediment- discharge records are computed at daily or annual intervals based on periodically collected data, although some partial records represent discrete or seasonal intervals such as those for flood periods. The method used to calculate sediment- discharge records is dependent on the types and frequency of available data. Records for suspended-sediment discharge computed by methods described by Porterfield (1972) are most prevalent, in part because measurement protocols and computational techniques are well established and because suspended sediment composes the bulk of sediment dis- charges for many rivers. Discharge records for bed load, total load, or in some cases bed-material load plus wash load are less common. Reliable estimation of sediment discharges presupposes that the data on which the estimates are based are comparable and reliable. Unfortunately, data describing a selected characteristic of sediment were not necessarily derived—collected, processed, analyzed, or interpreted—in a consistent manner. For example, bed-load data collected with

  15. Glow discharge in singlet oxygen

    International Nuclear Information System (INIS)

    Vagin, N.P.; Ionin, A.A.; Klimachev, Yu.M.; Sinitsyn, D.V.; Yuryshev, N.N.; Kochetov, I.V.; Napartovich, A.P.

    2003-01-01

    Currently, there is no experimental data on the plasma balance in gas mixtures with a high content of singlet delta oxygen O 2 ( 1 Δ g ). These data can be obtained by studying the parameters of an electric discharge in singlet oxygen produced by a chemical generator. The O 2 ( 1 Δ g ) molecules significantly change the kinetics of electrons and negative ions in plasma. Hence, the discharge conditions at low and high O 2 ( 1 Δ g ) concentrations are very different. Here, the parameters of the positive column of a glow discharge in a gas flow from a chemical singlet-oxygen generator are studied. It is experimentally shown that, at an O 2 ( 1 Δ g ) concentration of 50% and at pressures of 1.5 and 2 torr, the electric field required to sustain the discharge is considerably lower than in the case when all of the oxygen molecules are in the ground state. A theoretical model of the glow discharge is proposed whose predictions are in good agreement with the experimental data

  16. Assessing the impact of the introduction of an electronic hospital discharge system on the completeness and timeliness of discharge communication: a before and after study.

    Science.gov (United States)

    Mehta, Rajnikant L; Baxendale, Bryn; Roth, Katie; Caswell, Victoria; Le Jeune, Ivan; Hawkins, Jack; Zedan, Haya; Avery, Anthony J

    2017-09-05

    Hospital discharge summaries are a key communication tool ensuring continuity of care between primary and secondary care. Incomplete or untimely communication of information increases risk of hospital readmission and associated complications. The aim of this study was to evaluate whether the introduction of a new electronic discharge system (NewEDS) was associated with improvements in the completeness and timeliness of discharge information, in Nottingham University Hospitals NHS Trust, England. A before and after longitudinal study design was used. Data were collected using the gold standard auditing tool from the Royal College of Physicians (RCP). This tool contains a checklist of 57 items grouped into seven categories, 28 of which are classified as mandatory by RCP. Percentage completeness (out of the 28 mandatory items) was considered to be the primary outcome measure. Data from 773 patients discharged directly from the acute medical unit over eight-week long time periods (four before and four after the change to the NewEDS) from August 2010 to May 2012 were extracted and evaluated. Results were summarised by effect size on completeness before and after changeover to NewEDS respectively. The primary outcome variable was represented with percentage of completeness score and a non-parametric technique was used to compare pre-NewEDS and post-NewEDS scores. The changeover to the NewEDS resulted in an increased completeness of discharge summaries from 60.7% to 75.0% (p communication.

  17. Dioscorea Extract (DA-9801) Modulates Markers of Peripheral Neuropathy in Type 2 Diabetic db/db Mice.

    Science.gov (United States)

    Moon, Eunjung; Lee, Sung Ok; Kang, Tong Ho; Kim, Hye Ju; Choi, Sang Zin; Son, Mi-Won; Kim, Sun Yeou

    2014-09-01

    The purpose of this study was to investigate the therapeutic effects of DA-9801, an optimized extract of Dioscorea species, on diabetic peripheral neuropathy in a type 2 diabetic animal model. In this study, db/db mice were treated with DA-9801 (30 and 100 mg/kg, daily, p.o.) for 12 weeks. DA-9801 reduced the blood glucose levels and increased the withdrawal latencies in hot plate tests. Moreover, it prevented nerve damage based on increased nerve conduction velocity and ultrastructural changes. Decrease of nerve growth factor (NGF) may have a detrimental effect on diabetic neuropathy. We previously reported NGF regulatory properties of the Dioscorea genus. In this study, DA-9801 induced NGF production in rat primary astrocytes. In addition, it increased NGF levels in the sciatic nerve and the plasma of type 2 diabetic animals. DA-9801 also increased neurite outgrowth and mRNA expression of Tieg1/Klf10, an NGF target gene, in PC12 cells. These results demonstrated the attenuation of diabetic peripheral neuropathy by oral treatment with DA-9801 via NGF regulation. DA-9801 is currently being evaluated in a phase II clinical study.

  18. Modulation of hyperglycemia and TNFα-mediated inflammation by helichrysum and grapefruit extracts in diabetic db/db mice.

    Science.gov (United States)

    de la Garza, Ana Laura; Etxeberria, Usune; Palacios-Ortega, Sara; Haslberger, Alexander G; Aumueller, Eva; Milagro, Fermín I; Martínez, J Alfredo

    2014-09-01

    Type-2 diabetes is associated with a chronic low-grade systemic inflammation accompanied by an increased production of adipokines/cytokines by obese adipose tissue. The search for new antidiabetic drugs with different mechanisms of action, such as insulin sensitizers, insulin secretagogues and α-glucosidase inhibitors, has directed the focus on the potential use of flavonoids in the management of type-2 diabetes. Thirty six diabetic male C57BL/6J db/db mice were fed a standard diet and randomly assigned into four experimental groups: non-treated control, (n = 8); acarbose (5 mg per kg bw, n = 8); helichrysum (1 g per kg bw, n = 10) and grapefruit (0.5 g per kg bw, n = 10) for 6 weeks. The mRNA expression in pancreas, liver and epididymal adipose tissue was determined by RT-PCR. DNA methylation was quantified in epididymal fat using pyrosequencing. Mice supplemented with helichrysum and grapefruit extracts showed a significant decrease in fasting glucose levels (p helichrysum and grapefruit extracts improved hyperglycemia through the regulation of glucose metabolism in the liver and reduction of the expression of proinflammatory genes in the liver and visceral fat. The hypermethylation of TNFα in adipose tissue may contribute to reduce the inflammation associated with diabetes and obesity.

  19. IL-22R Ligands IL-20, IL-22, and IL-24 Promote Wound Healing in Diabetic db/db Mice.

    Science.gov (United States)

    Kolumam, Ganesh; Wu, Xiumin; Lee, Wyne P; Hackney, Jason A; Zavala-Solorio, Jose; Gandham, Vineela; Danilenko, Dimitry M; Arora, Puneet; Wang, Xiaoting; Ouyang, Wenjun

    2017-01-01

    Diabetic foot ulcers (DFU) are one of the major complications in type II diabetes patients and can result in amputation and morbidity. Although multiple approaches are used clinically to help wound closure, many patients still lack adequate treatment. Here we show that IL-20 subfamily cytokines are upregulated during normal wound healing. While there is a redundant role for each individual cytokine in this subfamily in wound healing, mice deficient in IL-22R, the common receptor chain for IL-20, IL-22, and IL-24, display a significant delay in wound healing. Furthermore, IL-20, IL-22 and IL-24 are all able to promote wound healing in type II diabetic db/db mice. Mechanistically, when compared to other growth factors such as VEGF and PDGF that accelerate wound healing in this model, IL-22 uniquely induced genes involved in reepithelialization, tissue remodeling and innate host defense mechanisms from wounded skin. Interestingly, IL-22 treatment showed superior efficacy compared to PDGF or VEGF in an infectious diabetic wound model. Taken together, our data suggest that IL-20 subfamily cytokines, particularly IL-20, IL-22, and IL-24, might provide therapeutic benefit for patients with DFU.

  20. Hazmat Yearly Incident Summary Reports

    Data.gov (United States)

    Department of Transportation — Series of Incident data and summary statistics reports produced which provide statistical information on incidents by type, year, geographical location, and others....

  1. Disparate phospho-Smad2 levels in advanced type 2 diabetes patients with diabetic nephropathy and early experimental db/db mouse model

    DEFF Research Database (Denmark)

    Thomsen, Lise Høj; Fog-Tonnesen, Morten; Nielsen Fink, Lisbeth

    2017-01-01

    Uncontrolled activation of transforming growth factor beta (TGF-β) family members is hypothesized to participate in type 2 diabetes (T2D) dependent diabetic nephropathy (DN). We evaluated and compared downstream activation of the Smad2-signaling pathway in kidney samples from T2D patients...... to kidneys from the T2D model of leptin receptor deficient db/db mouse. Furthermore, expression of TGF-β family members was evaluated to elucidate molecular mechanisms in the mouse model. Kidney samples from patients with advanced stages of DN showed elevated pSmad2 staining whereas db/db mouse kidneys...... surprisingly showed a decrease in pSmad2 in the tubular compartment. Structurally, kidney tissue showed dilated tubules and expanded glomeruli, but no clear fibrotic pattern was found in the diabetic mice. Selective TGF-β family members were up-regulated at the mRNA level. Antagonists of bone morphogenetic...

  2. Neutrino physics: Summary talk

    International Nuclear Information System (INIS)

    Marciano, W.J.

    1989-04-01

    This paper is organized as follows: First, I describe the state of neutrino phenomenology. Emphasis is placed on sin 2 θ W , its present status and future prospects. In addition, some signatures of ''new physics'' are described. Then, kaon physics at Fermilab is briefly discussed. I concentrate on the interesting rare decay K L → π 0 e + e - which may be a clean probe direct CP violation. Neutrino mass, mixing, and electromagnetic moments are surveyed. There, I describe the present state and future direction of accelerator based experiments. Finally, I conclude with an outlook on the future. Throughout this summary, I have drawn from and incorporated ideas discussed by other speakers at this workshop. However, I have tried to combine their ideas with my own perspective on neutrino physics and where it is headed. 49 refs., 3 figs., 4 tabs

  3. Summary of group discussions

    International Nuclear Information System (INIS)

    2009-01-01

    A key aspect of the workshop was the interaction and exchange of ideas and information among the 40 participants. To facilitate this activity the workshop participants were divided into five discussions groups. These groups reviewed selected subjects and reported back to the main body with summaries of their considerations. Over the 3 days the 5 discussion groups were requested to focus on the following subjects: the characteristics and capabilities of 'good' organisations; how to ensure sufficient resources; how to ensure competence within the organisation; how to demonstrate organisational suitability; the regulatory oversight processes - including their strengths and weaknesses. A list of the related questions that were provided to the discussion groups can be found in Appendix 3. Also included in Appendix 3 are copies of the slides the groups prepared that summarised their considerations

  4. Vacuum considerations: summary

    International Nuclear Information System (INIS)

    Blechschmidt, D.; Halama, H.J.

    1978-01-01

    A summary is given of the efforts of a vacuum systems study group of the workshop on a Heavy Ion Demonstration Experiment (HIDE) for heavy ion fusion. An inadequate knowledge of cross-sections prevents a more concrete vacuum system design. Experiments leading to trustworthy numbers for charge exchange, stripping and capture cross-sections are badly needed and should start as soon as possible. In linacs, beam loss will be almost directly proportional to the pressure inside the tanks. The tanks should, therefore, be built in such a way that they can be baked-out in situ to improve their vacuum, especially if the cross-sections turn out to be higher than anticipated. Using standard UHV techniques and existing pumps, an even lower pressure can be achieved. The vacuum system design for circular machines will be very difficult, and in some cases, beyond the present state-of-the-art

  5. Summary and conclusions

    International Nuclear Information System (INIS)

    2000-01-01

    The international workshop on 'Nuclear Power Plant Life Management in a Changing Business World' was held in Washington, DC, on 26-27 June 2000. This workshop was attended by more than 50 experts from 12 countries and three international organisations. The workshop included a series of presentations to a plenary session of all participants. A spectrum of experiences in plant life extension activities as well as experiences in operating a nuclear power plant (NPP) in a 'free-market' electricity environment were presented: The workshop also included three working groups in which major issues facing PLIM activities for NPPs were identified and discussed. The three working groups covered technology, regulation and business. The following sections of this report consist of summaries of the discussions that took place in each of the three working groups. (author)

  6. Electron runaway in rf discharges

    International Nuclear Information System (INIS)

    Chen, F.F.

    1992-10-01

    The critical electric field is computed as a function of pressure and starting energy for electrons to run away to high energies in moderate pressure discharges. The runaway conditions depend critically on the shape of the elastic cross section vs. energy curve. Computations are made for H, H 2 , and He gases, and it is shown that runaway occurs much more readily in atomic hydrogen than in the other gases. The values of the runaway fields are larger than would normally occur in dc discharges, where large voltages would lead to arc formation. However, in rf discharges such electric fields can be sustained over times long compared to electron transit times but short compared to ion transit times. (author)

  7. Discharge quenching circuit for counters

    International Nuclear Information System (INIS)

    Karasik, A.S.

    1982-01-01

    A circuit for quenching discharges in gas-discharge detectors with working voltage of 3-5 kV based on transistors operating in the avalanche mode is described. The quenching circuit consists of a coordinating emitter follower, amplifier-shaper for avalanche key cascade control which changes potential on the counter electrodes and a shaper of discharge quenching duration. The emitter follower is assembled according to a widely used flowsheet with two transistors. The circuit permits to obtain a rectangular quenching pulse with front of 100 ns and an amplitude of up to 3.2 kV at duration of 500 μm-8 ms. Application of the quenching circuit described permits to obtain countering characteristics with the slope less than or equal to 0.02%/V and plateau extent greater than or equal to 300 V [ru

  8. Summary: Hadron dynamics sessions

    International Nuclear Information System (INIS)

    Carroll, A.S.; Londergan, J.T.

    1993-01-01

    Four sessions on Hadron Dynamics were organized at this Workshop. The first topic, QCD Exclusive Reactions and Color Transparency, featured talks by Ralston, Heppelman and Strikman; the second, QCD and Inclusive Reactions had talks by Garvey, Speth and Kisslinger. The third dynamics session, Medium Modification of Elementary Interactions had contributions from Kopeliovich, Alves and Gyulassy; the fourth session Pre-QCD Dynamics and Scattering, had talks by Harris, Myhrer and Brown. An additional joint Spectroscopy/Dynamics session featured talks by Zumbro, Johnson and McClelland. These contributions are reviewed briefly in this summary. Two additional joint sessions between Dynamics and η physics are reviewed by the organizers of the Eta sessions. In such a brief review there is no way the authors can adequately summarize the details of the physics presented here. As a result, they concentrate only on brief impressionistic sketches of the physics topics discussed and their interrelations. They include no bibliography in this summary, but simply refer to the talks given in more detail in the Workshop proceedings. They focus on topics which were common to several presentations in these sessions. First, nuclear and particle descriptions of phenomena are now clearly converging, in both a qualitative and quantitative sense; they show several examples of this convergence. Second, an important issue in hadron dynamics is the extent to which elementary interactions are modified in nuclei at high energies and/or densities, and they illustrate some of these medium effects. Finally, they focus on those dynamical issues where hadron facilities can make an important, or even a unique, contribution to the knowledge of particle and nuclear physics

  9. Chemotherapy of second stage human African trypanosomiasis: comparison between the parenteral diamidine DB829 and its oral prodrug DB868 in vervet monkeys.

    Directory of Open Access Journals (Sweden)

    John K Thuita

    2015-02-01

    Full Text Available Human African trypanosomiasis (HAT, sleeping sickness ranks among the most neglected tropical diseases based on limited availability of drugs that are safe and efficacious, particularly against the second stage (central nervous system [CNS] of infection. In response to this largely unmet need for new treatments, the Consortium for Parasitic Drug Development developed novel parenteral diamidines and corresponding oral prodrugs that have shown cure of a murine model of second stage HAT. As a rationale for selection of one of these compounds for further development, the pharmacokinetics and efficacy of intramuscular (IM active diamidine 2,5-bis(5-amidino-2-pyridylfuran (DB829; CPD-0802 and oral prodrug2,5-bis[5-(N-methoxyamidino-2-pyridyl]furan (DB868 were compared in the vervet monkey model of second stage HAT. Treatment was initiated 28 days post-infection of monkeys with T. b. rhodesiense KETRI 2537. Results showed that IM DB829 at 5 mg/kg/day for 5 consecutive days, 5 mg/kg/day every other day for 5 doses, or 2.5 mg/kg/day for 5 consecutive days cured all monkeys (5/5. Oral DB868 was less successful, with no cures (0/2 at 3 mg/kg/day for 10 days and cure rates of 1/4 at 10 mg/kg/day for 10 days and 20 mg/kg/day for 10 days; in total, only 2/10 monkeys were cured with DB868 dose regimens. The geometric mean plasma Cmax of IM DB829 at 5 mg/kg following the last of 5 doses was 25-fold greater than that after 10 daily oral doses of DB868 at 20 mg/kg. These data suggest that the active diamidine DB829, administered IM, should be considered for further development as a potential new treatment for second stage HAT.

  10. Summary of Syllac results

    International Nuclear Information System (INIS)

    Siemon, R.E.

    1978-04-01

    A series of theta-pinch high-beta stellarator experiments has been recently completed. They demonstrated the existence of a toroidal equilibrium at high beta (about 70%) and reveal the expected instability of gross plasma motion. Feedback stabilization, by means of optical sensors for plasma position coupled to current amplifiers for magnetic field control, works effectively to keep the plasma column near the center of the discharge vessel. Confinement of plasma in the recent feedback experiments is limited by classical end losses associated with the finite-length toroidal sectors. This document gives a simplified history of Scyllac much as it was presented in an invited paper at the 1977 Plasma Physics Division meeting of the American Physical Society held in Atlanta, Georgia

  11. Panel summary report

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    Previous Advisory Group Meetings have led to IAEA Technical Reports No.15=5 (1974) on thermal discharge, 118 (1970) and 169 (1975) on sampling, storage and analysis methods for marine radioactivity studies, 167 (1975) on design of marine biological studies permitting comparative evaluation, and 172 (1976) on the effects of ionizing radiation on aquative organisms and eco-systems. The aim of the present report was a bringing into perspective not only problems designing radioecological experiments but to describe reliable experimental methodology suitable for a successful evaluation of radioactivity cycling, and of the effects of such radioactive additions to aquatic environments, as a result of nuclear activities. Specific examples are described. Individual studies presented to the Panel have been treated in detail, and constitute 19 separate INIS entries

  12. State Waste Discharge Permit application, 183-N Backwash Discharge Pond

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    As part of the Hanford Federal Facility Agreement and Consent Order negotiations (Ecology et al. 1994), the US Department of Energy, Richland Operations Office, the US Environmental Protection Agency, and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground on the Hanford Site which affect groundwater or have the potential to affect groundwater would be subject to permitting under the structure of Chapter 173--216 (or 173--218 where applicable) of the Washington Administrative Code, the State Waste Discharge Permit Program. As a result of this decision, the Washington State Department of Ecology and the US Department of Energy, Richland Operations Office entered into Consent Order No. DE91NM-177, (Ecology and DOE-RL 1991). The Consent Order No. DE91NM-177 requires a series of permitting activities for liquid effluent discharges. Liquid effluents on the Hanford Site have been classified as Phase I, Phase II, and Miscellaneous Streams. The Consent Order No. DE91NM-177 establishes milestones for State Waste Discharge Permit application submittals for all Phase I and Phase II streams, as well as the following 11 Miscellaneous Streams as identified in Table 4 of the Consent Order No. DE91NM-177.

  13. Radio and television interference caused by corona discharges from high-voltage transmission lines

    International Nuclear Information System (INIS)

    Sarmadi, M.

    1996-01-01

    Increase in power utility loads in industrialized countries, as well as developing countries, demands a higher level of transmission line voltage. Radio interference (RI) problems have been determined to be a limiting factor in selecting the size of transmission line conductors. Transmission line noise is primarily caused by corona discharges in the immediate vicinity of the conductor. It has been observed that discharges occur during both half-cycles of the applied voltage, but positive corona is usually predominant at AM radio frequencies range with practical high-voltage and extra high-voltage transmission lines. The corona radio noise effect is highly dependent upon the presence of particles on the surface of the conductor and the increase of the electrical gradient beyond the breakdown value of the air. Therefore, corona radio noise varies significantly with the weather and atmospheric conditions and generally increases by 10 to 30 dB in foul weather

  14. Current-Induced Membrane Discharge

    DEFF Research Database (Denmark)

    Andersen, Mathias Bækbo; van Soestbergen, M.; Mani, A.

    2012-01-01

    . Salt depletion leads to a large electric field resulting in a local pH shift within the membrane with the effect that the membrane discharges and loses its ion selectivity. Since salt co-ions, H+ ions, and OH- ions contribute to OLC, CIMD interferes with electrodialysis (salt counterion removal...... neglects chemical effects and remains to be quantitatively tested. Here, we show that charge regulation and water self-ionization can lead to OLC by "current-induced membrane discharge'' (CIMD), even in the absence of fluid flow, in ion-exchange membranes much thicker than the local Debye screening length...

  15. Plasma Discharge in Toroidal System

    International Nuclear Information System (INIS)

    Usada, Widdi; Suryadi; Purwadi, Agus; Kasiyo

    1996-01-01

    A toroidal discharge apparatus has been made as an initial research in magnetic confinement system. This system consists of a capacitor, a RF source, an igniter system, a primary coil, a torus, and completed by Rogowski probe as a current detector. In this system, the discharge occurs when the minimum voltage is operated at 5 kV. The experiment result shows that the coupling factor is 0.35, it is proved that there is an equality between estimated and measurement results of the primary inductance i.e 8.5 μH

  16. Taming Instabilities in Plasma Discharges

    International Nuclear Information System (INIS)

    Klinger, T.; Krahnstover, N. O.; Mausbach, T.; Piel, A.

    2000-01-01

    Recent experimental work on taming instabilities in plasma discharges is discussed. Instead of suppressing instabilities, it is desired to achieve control over their dynamics, done by perturbing appropriately the current flow in the external circuit of the discharge. Different discrete and continuous feedback as well as open-loop control schemes are applied. Chaotic oscillations in plasma diodes are controlled using the OGY discrete feedback scheme. This is demonstrated both in experiment and computer simulation. Weakly developed ionization wave turbulence is tamed by continuous feedback control. Open-loop control of stochastic fluctuations - stochastic resonance - is demonstrated in a thermionic plasma diode. (author)

  17. Generation of Natural-Language Textual Summaries from Longitudinal Clinical Records.

    Science.gov (United States)

    Goldstein, Ayelet; Shahar, Yuval

    2015-01-01

    Physicians are required to interpret, abstract and present in free-text large amounts of clinical data in their daily tasks. This is especially true for chronic-disease domains, but holds also in other clinical domains. We have recently developed a prototype system, CliniText, which, given a time-oriented clinical database, and appropriate formal abstraction and summarization knowledge, combines the computational mechanisms of knowledge-based temporal data abstraction, textual summarization, abduction, and natural-language generation techniques, to generate an intelligent textual summary of longitudinal clinical data. We demonstrate our methodology, and the feasibility of providing a free-text summary of longitudinal electronic patient records, by generating summaries in two very different domains - Diabetes Management and Cardiothoracic surgery. In particular, we explain the process of generating a discharge summary of a patient who had undergone a Coronary Artery Bypass Graft operation, and a brief summary of the treatment of a diabetes patient for five years.

  18. Ortholog - MicrobeDB.jp | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us MicrobeDB.jp Ortholog Data detail Data name Ortholog DOI 10.18908/lsdba.nbdc01181-010.V002 V...814 triples - About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Ortholog - MicrobeDB.jp | LSDB Archive ...

  19. Taxon (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available of This Database Site Policy | Contact Us Taxon (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Taxon (Viridiplantae) Data detail Data name Taxon (Viridiplantae) DOI 10...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  20. Download - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available e Description Download License Update History of This Database Site Policy | Contact Us Download - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Download First of all, please read the license of this database. Data na...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  1. Protein (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ut This Database Database Description Download License Update History of This Database Site Policy | Contact Us Protein (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Protein (Cyanobacteria) Data detail Data name Protein (Cyanobacteria) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  2. Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available of This Database Site Policy | Contact Us Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Taxon (Cyanobacteria) Data detail Data name Taxon (Cyanobacteria) DOI 10...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  3. Protein (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ase Description Download License Update History of This Database Site Policy | Contact Us Protein (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Protein (Viridiplantae) Data detail Data name Protein (Viridiplantae) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  4. Transformasi Skema Basis Data Relasional Menjadi Model Data Berorientasi Dokumen pada MongoDB

    Directory of Open Access Journals (Sweden)

    I Gede Winaya

    2016-01-01

    Full Text Available MongoDB is a database that uses document-oriented data storage models. In fact, to  migrate from a relational database to NoSQL databases such as MongoDB is not an easy matter especially if the data are extremely complex. Based on the documentation that has been done by several global companies related to the use of MongoDB, it can be concluded that the process of migration from RDBMS to MongoDB require quite a long time. One process that takes quite a lot is transformation of relational database schema into a document-oriented data model on MongoDB.             This research discusses the development transformation system of relational database schema to the document oriented data model in MongoDB. The process of transformation is done by utilizing the structure and relationships between tables in the scheme as the main parameters of the modeling algorithm. In the process of the modeling documents, it necessary to adjustments the specifications of MongoDB document that formed document model can be implemented in MongoDB.             Document models are formed from transformation process can be a single document, embedded document, referenced document or combination of these. Document models are formed depending on the type, rules, and the value of the relationships cardinality between tables in the relational database schema.

  5. RoboDB: an application of Semantic Web Technologies to robotics

    NARCIS (Netherlands)

    Juarez, Alex; Hu, J.; Feijs, L.M.G.

    2011-01-01

    RoboDB is a knowledge acquisition system that gathers information about robots. RoboDB uses Semantic Web technologies and tools to help the user in creating semantic descriptions of robot embodiments and their capabilities, as well as in building an ontology of robotics projects, research

  6. AOP-DB Frontend: A user interface for the Adverse Outcome Pathways Database

    Science.gov (United States)

    The EPA Adverse Outcome Pathway Database (AOP-DB) is a database resource that aggregates association relationships between AOPs, genes, chemicals, diseases, pathways, species orthology information, ontologies. The AOP-DB frontend is a simple yet powerful user interface in the for...

  7. myPhyloDB: a local web server for the storage and analysis of metagenomics data

    Science.gov (United States)

    myPhyloDB is a user-friendly personal database with a browser-interface designed to facilitate the storage, processing, analysis, and distribution of metagenomics data. MyPhyloDB archives raw sequencing files, and allows for easy selection of project(s)/sample(s) of any combination from all availab...

  8. MonetDB/X100 - A DBMS in the CPU cache

    NARCIS (Netherlands)

    M. Zukowski (Marcin); P.A. Boncz (Peter); N.J. Nes (Niels); S. Héman (Sándor)

    2005-01-01

    textabstractX100 is a new execution engine for the MonetDB system, that improves execution speed and overcomes its main memory limitation. It introduces the concept of in-cache vectorized processing that strikes a balance between the existing column-at-a-time MIL execution primitives of MonetDB and

  9. Update History of This Database - D-HaploDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us D-HaploDB Update History of This Database Date Update contents 2016/12/13 Description of the.../orca.gen.kyushu-u.ac.jp/) is released. About This Database Database Description Download License Update History of This Database... Site Policy | Contact Us Update History of This Database - D-HaploDB | LSDB Archive ...

  10. InterProScan Result: DB674426 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DB674426 DB674426_4_ORF1 4B0C8A5F848582EF PFAM PF04683 Proteasom_Rpn13 NA ? IPR006773 unintegrated Cellular... Component: nucleus (GO:0005634)|Cellular Component: cytoplasm (GO:0005737) ...

  11. MonetDB: Two Decades of Research in Column-oriented Database Architectures

    NARCIS (Netherlands)

    S. Idreos (Stratos); F.E. Groffen (Fabian); N.J. Nes (Niels); S. Manegold (Stefan); K.S. Mullender (Sjoerd); M.L. Kersten (Martin)

    2012-01-01

    textabstractMonetDB is a state-of-the-art open-source column-store database management system targeting applications in need for analytics over large collections of data. MonetDB is actively used nowadays in health care, in telecommunications as well as in scientific databases and in data management

  12. MonetDB: Two Decades of Research in Column-oriented Database Architectures

    NARCIS (Netherlands)

    Idreos, S.; Groffen, F.; Nes, N.; Manegold, S.; Mullender, S.; Kersten, M.

    2012-01-01

    MonetDB is a state-of-the-art open-source column-store database management system targeting applications in need for analytics over large collections of data. MonetDB is actively used nowadays in health care, in telecommunications as well as in scientific databases and in data management research,

  13. Quantitative GC-MS assay of citric acid from humans and db/db mice blood serum to assist the diagnosis of diabetic nephropathy.

    Science.gov (United States)

    Gao, Haoxue; Yu, Xiaoyi; Sun, Runbin; Yang, Na; He, Jun; Tao, Mingxue; Gu, Huilin; Yan, Caixia; Aa, Jiye; Wang, Guangji

    2018-03-01

    The early diagnosis of diabetic nephropathy (DN) is rather challenging. Our previous study suggested that citric acid is a potential marker for the early diagnosis of diabetic nephropathy in db/db mice. For the first time, in this study, a surrogate analyte of 13 C 6 -citric acid was employed to generate calibration curves for the quantitative measurement of the endogenous citric acid in the sera of db/db mice and diabetic nephropathy patients by GC/MS after the analytes were extracted, methoximated and trimethylsilylated. The constant response factor of 13 C 6 -citric acid versus citric acid over the linear range indicated the identical ionization efficiency of these two compounds. The full validation assessments suggested that the method is sensitive, specific, reliable, reproducible and has acceptable parameters. Statistical analysis revealed cut-off citric acid concentrations of 29.24 μg/mL with a 95% confidence interval between 32.75 and 39.16 μg/mL in the diabetic nephropathy patients and 16.74 and 22.57 μg/mL in the normal controls. The areas under the receiver operating characteristic curves indicated accuracies of over 90% for the diagnoses of early diabetic nephropathy in both humans and db/db mice, which suggests that the serum citric acid level is potentially a biomarker that could assist in the diagnosis of diabetic nephropathy. Copyright © 2018 Elsevier B.V. All rights reserved.

  14. Serotonin- and Dopamine-Related Gene Expression in db/db Mice Islets and in MIN6 β-Cells Treated with Palmitate and Oleate

    Directory of Open Access Journals (Sweden)

    L. R. Cataldo

    2016-01-01

    Full Text Available High circulating nonesterified fatty acids (NEFAs concentration, often reported in diabetes, leads to impaired glucose-stimulated insulin secretion (GSIS through not yet well-defined mechanisms. Serotonin and dopamine might contribute to NEFA-dependent β-cell dysfunction, since extracellular signal of these monoamines decreases GSIS. Moreover, palmitate-treated β-cells may enhance the expression of the serotonin receptor Htr2c, affecting insulin secretion. Additionally, the expression of monoamine-oxidase type B (Maob seems to be lower in islets from humans and mice with diabetes compared to nondiabetic islets, which may lead to increased monoamine concentrations. We assessed the expression of serotonin- and dopamine-related genes in islets from db/db and wild-type (WT mice. In addition, the effect of palmitate and oleate on the expression of such genes, 5HT content, and GSIS in MIN6 β-cell was determined. Lower Maob expression was found in islets from db/db versus WT mice and in MIN6 β-cells in response to palmitate and oleate treatment compared to vehicle. Reduced 5HT content and impaired GSIS in response to palmitate (−25%; p<0.0001 and oleate (−43%; p<0.0001 were detected in MIN6 β-cells. In conclusion, known defects of GSIS in islets from db/db mice and MIN6 β-cells treated with NEFAs are accompanied by reduced Maob expression and reduced 5HT content.

  15. Dipeptidyl peptidase-4 inhibitor, vildagliptin, inhibits pancreatic beta cell apoptosis in association with its effects suppressing endoplasmic reticulum stress in db/db mice.

    Science.gov (United States)

    Wu, Yan-ju; Guo, Xin; Li, Chun-jun; Li, Dai-qing; Zhang, Jie; Yang, Yiping; Kong, Yan; Guo, Hang; Liu, De-min; Chen, Li-ming

    2015-02-01

    Vildagliptin promotes beta cell survival by inhibiting cell apoptosis. It has been suggested that chronic ER (endoplasmic reticulum) stress triggers beta cell apoptosis. The objective of the study is to explore whether the pro-survival effect of vildagliptin is associated with attenuation of endoplasmic reticulum stress in islets of db/db mice. Vildagliptin was orally administered to db/db mice for 6 weeks, followed by evaluation of beta cell apoptosis by caspase3 activity and TUNEL staining method. Endoplasmic reticulum stress markers were determined with quantitative RT-PCR, immunohistochemistry and immunoblot analysis. After 6 weeks of treatment, vildagliptin treatment increased plasma active GLP-1 levels (22.63±1.19 vs. 11.69±0.44, Pvildagliptin treatment down-regulated several genes related to endoplasmic reticulum stress including TRIB3 (tribbles homolog 3) (15.9±0.4 vs. 33.3±1.7, ×10⁻³, PVildagliptin promoted beta cell survival in db/db mice in association with down-regulating markers of endoplasmic reticulum stress including TRIB3, ATF-4 as well as CHOP. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  16. High-fat, carbohydrate-free diet markedly aggravates obesity but prevents beta-cell loss and diabetes in the obese, diabetes-susceptible db/db strain.

    Science.gov (United States)

    Mirhashemi, Farshad; Kluth, Oliver; Scherneck, Stephan; Vogel, Heike; Kluge, Reinhart; Schurmann, Annette; Joost, Hans-Georg; Neschen, Susanne

    2008-01-01

    We have previously reported that a high-fat, carbohydrate-free diet prevents diabetes and beta-cell destruction in the New Zealand Obese (NZO) mouse strain. Here we investigated the effect of diets with and without carbohydrates on obesity and development of beta-cell failure in a second mouse model of type 2 diabetes, the db/db mouse. When kept on a carbohydrate-containing standard (SD; with (w/w) 5.1, 58.3, and 17.6% fat, carbohydrates and protein, respectively) or high-fat diet (HFD; 14.6, 46.7 and 17.1%), db/db mice developed severe diabetes (blood glucose >20 mmol/l, weight loss, polydipsia and polyurea) associated with a selective loss of pancreatic beta-cells, reduced GLUT2 expression in the remaining beta-cells, and reduced plasma insulin levels. In contrast, db/db mice kept on a high-fat, carbohydrate-free diet (CFD; with 30.2 and 26.4% (w/w) fat or protein) did not develop diabetes and exhibited near-normal, hyperplastic islets in spite of a morbid obesity (fat content >60%) associated with hyperinsulinaemia. These data indicate that in genetically different mouse models of obesity-associated diabetes, obesity and dietary fat are not sufficient, and dietary carbohydrates are required, for beta-cell destruction.

  17. A PPARγ, NF-κB and AMPK-dependent mechanism may be involved in the beneficial effects of curcumin in the diabetic db/db mice liver.

    Science.gov (United States)

    Jiménez-Flores, Lizbeth M; López-Briones, Sergio; Macías-Cervantes, Maciste H; Ramírez-Emiliano, Joel; Pérez-Vázquez, Victoriano

    2014-06-18

    Turmeric (Curcuma longa) is a rhizomatous herbaceous perennial plant of the ginger family which has been used to treat biliary disorders, anorexia, cough, rheumatism, cancer, sinusitis, hepatic disorders, hyperglycemia, obesity, and diabetes in both Ayurvedic and Traditional Chinese Medicine. Suggested mechanisms of action include the modulation of signal transduction cascades and effects on gene expression, however they remain to be elucidated. In this study, the expression of some proteins responsible for transcription factors, inflammation, and metabolic control were evaluated by western blot in 15-week-old db/db mice livers treated with curcumin 0.75% mixed in their diet for 8 weeks. In addition, nitrosative stress was evaluated. Curcumin increased the expression of AMPK and PPARγ, and diminished NF-κB protein in db/db mice. However, it did not modify the expression of PGC-1α or SIRT1. Nitrosative stress present in db/db mice livers was determined by a unique nitrotyrosylated protein band (75 kDa) and was not reverted with curcumin. In conclusion, curcumin regulates the expression of AMPK, PPARγ, and NF-κB; suggesting a beneficial effect for treatment of T2DM complications. In order to observe best beneficial effects it is desirable to administer curcumin in the earlier states of T2DM.

  18. A PPARγ, NF-κB and AMPK-Dependent Mechanism May Be Involved in the Beneficial Effects of Curcumin in the Diabetic db/db Mice Liver

    Directory of Open Access Journals (Sweden)

    Lizbeth M. Jiménez-Flores

    2014-06-01

    Full Text Available Turmeric (Curcuma longa is a rhizomatous herbaceous perennial plant of the ginger family which has been used to treat biliary disorders, anorexia, cough, rheumatism, cancer, sinusitis, hepatic disorders, hyperglycemia, obesity, and diabetes in both Ayurvedic and Traditional Chinese Medicine. Suggested mechanisms of action include the modulation of signal transduction cascades and effects on gene expression, however they remain to be elucidated. In this study, the expression of some proteins responsible for transcription factors, inflammation, and metabolic control were evaluated by western blot in 15-week-old db/db mice livers treated with curcumin 0.75% mixed in their diet for 8 weeks. In addition, nitrosative stress was evaluated. Curcumin increased the expression of AMPK and PPARγ, and diminished NF-κB protein in db/db mice. However, it did not modify the expression of PGC-1α or SIRT1. Nitrosative stress present in db/db mice livers was determined by a unique nitrotyrosylated protein band (75 kDa and was not reverted with curcumin. In conclusion, curcumin regulates the expression of AMPK, PPARγ, and NF-κB; suggesting a beneficial effect for treatment of T2DM complications. In order to observe best beneficial effects it is desirable to administer curcumin in the earlier states of T2DM.

  19. The Extract of Litsea japonica Reduced the Development of Diabetic Nephropathy via the Inhibition of Advanced Glycation End Products Accumulation in db/db Mice

    Directory of Open Access Journals (Sweden)

    Eunjin Sohn

    2013-01-01

    Full Text Available Increasing evidence indicates that advanced glycation end products (AGEs contribute to the pathogenesis of diabetic nephropathy. The aim of this study was to investigate the protective effect of L. japonica extract (LJE against renal damage in the db/db mouse. LJE (100 or 250 mg/kg per day was given to diabetic mice for 12 weeks. Body weight, blood glucose levels, glycated hemoglobin (HbA1c levels, and proteinuria were examined. In in vitro assay of the inhibition of AGE formation, immunohistochemical analysis of podocyte loss and AGE accumulations were performed. In 20-week-old db/db mice, severe hyperglycemia developed, and proteinuria was significantly increased. Diabetes induced markedly morphological alterations to the renal glomerular cells. AGE accumulations and podocyte loss were detected in renal glomeruli. LJE treatment significantly reduced proteinuria and AGE accumulations in diabetic mice. Moreover, the loss of nephrin, an important slit diaphragm component in the kidneys, was restored by LJE treatment. Our studies suggest that LJE might be beneficial for the treatment of diabetic nephropathy. The ability of LJE to attenuate proteinuria and podocyte dysfunction may be mediated by the inhibition of AGE accumulation in the context of diabetic nephropathy in db/db mice.

  20. Scientific Data Bases at Scale and SciDB

    CERN Multimedia

    CERN. Geneva

    2013-01-01

    Abstract: As a general rule, scientists have shunned relational data management systems (RDBMS), choosing instead to “roll their own” on top of file system technology.  We first discuss why file systems are a poor choice for science data storage, especially as data volumes become large and scalability becomes important.   Then, we continue with the reasons why RDBMSs work poorly on most science applications.  These include a data model “impedance mismatch” and missing features. We discuss array DBMSs, and why they are a much better choice for science applications, and use SciDB as an exemplar of this new class of DBMSs.   Most science applications require a mix of data management and complex analytics.  In most cases, the analytics entail a sequence of linear algebra computations.  We discuss the possible ways of integrating a DBMS with statistical calculations, and conclude with the mechanism being used by S...

  1. Doubling the number of pulsating DB white dwarfs

    International Nuclear Information System (INIS)

    Nitta, Atsuko; Kleinman, S J; Krzenski, J; Kepler, S O; Metcalfe, T S; Mukadam, Anjum S; Mullally, F; Nather, R E; Winget, D E; Sullivan, D; Thompson, Susan E

    2009-01-01

    We are searching for new pulsating DB white dwarf stars (DBVs) based on the newly found white dwarf stars from the spectra obtained by the Sloan Digital Sky Survey. DBVs pulsate at hotter temperature ranges than their better known cousins, DAVs or ZZ Ceti stars. Since the evolution of white dwarf stars is characterized by cooling, asteroseismological studies of DBVs give us opportunities to study white dwarf structure at a different evolutionary stage than the DAVs. The hottest DBVs are thought to have neutrino luminosities exceeding their photon luminosities (Winget et al. 2004), a quantity measurable through asteroseismology. Therefore, they can also be used to study neutrino physics in the stellar interior. At the time of the meeting, we reported on the nine new DBVs, doubling the number of previously known DBVs. Here we report the new nine pulsators' lightcurves and power spectra.

  2. IntegromeDB: an integrated system and biological search engine.

    Science.gov (United States)

    Baitaluk, Michael; Kozhenkov, Sergey; Dubinina, Yulia; Ponomarenko, Julia

    2012-01-19

    With the growth of biological data in volume and heterogeneity, web search engines become key tools for researchers. However, general-purpose search engines are not specialized for the search of biological data. Here, we present an approach at developing a biological web search engine based on the Semantic Web technologies and demonstrate its implementation for retrieving gene- and protein-centered knowledge. The engine is available at http://www.integromedb.org. The IntegromeDB search engine allows scanning data on gene regulation, gene expression, protein-protein interactions, pathways, metagenomics, mutations, diseases, and other gene- and protein-related data that are automatically retrieved from publicly available databases and web pages using biological ontologies. To perfect the resource design and usability, we welcome and encourage community feedback.

  3. Organization of Proteomics Data With YassDB

    DEFF Research Database (Denmark)

    Lind-Thomsen, Allan; Laukens, Kris; Matthiesen, Rune

    2007-01-01

    In recent years the organization of mass spectrometry (MS) data obtained in large-scale proteomics projects became an important issue. This has catalyzed the development of a few different database schemes for storing MS data, as well as some dedicated user interfaces. However, many of these proj......In recent years the organization of mass spectrometry (MS) data obtained in large-scale proteomics projects became an important issue. This has catalyzed the development of a few different database schemes for storing MS data, as well as some dedicated user interfaces. However, many....... A database application named "YassDB" will be described in this chapter. The application is implemented in a "three-tier" application architecture, with a database layer, a middle layer consisting of web services and a client layer, containing the user interface. This offers high flexibility: it allows other...

  4. DB2 9 for Linux, Unix, and Windows database administration upgrade certification study guide

    CERN Document Server

    Sanders, Roger E

    2007-01-01

    Written by one of the world's leading DB2 authors who is an active participant in the development of the DB2 certification exams, this resource covers everything a database adminstrator needs to know to pass the DB2 9 for Linux, UNIX, and Windows Database Administration Certification Upgrade exam (Exam 736). This comprehensive study guide discusses all exam topics: server management, data placement, XML concepts, analyzing activity, high availability, database security, and much more. Each chapter contains an extensive set of practice questions along with carefully explained answers. Both information-technology professionals who have experience as database administrators and have a current DBA certification on version 8 of DB2 and individuals who would like to learn the new features of DB2 9 will benefit from the information in this reference guide.

  5. SoyDB: a knowledge database of soybean transcription factors

    Directory of Open Access Journals (Sweden)

    Valliyodan Babu

    2010-01-01

    Full Text Available Abstract Background Transcription factors play the crucial rule of regulating gene expression and influence almost all biological processes. Systematically identifying and annotating transcription factors can greatly aid further understanding their functions and mechanisms. In this article, we present SoyDB, a user friendly database containing comprehensive knowledge of soybean transcription factors. Description The soybean genome was recently sequenced by the Department of Energy-Joint Genome Institute (DOE-JGI and is publicly available. Mining of this sequence identified 5,671 soybean genes as putative transcription factors. These genes were comprehensively annotated as an aid to the soybean research community. We developed SoyDB - a knowledge database for all the transcription factors in the soybean genome. The database contains protein sequences, predicted tertiary structures, putative DNA binding sites, domains, homologous templates in the Protein Data Bank (PDB, protein family classifications, multiple sequence alignments, consensus protein sequence motifs, web logo of each family, and web links to the soybean transcription factor database PlantTFDB, known EST sequences, and other general protein databases including Swiss-Prot, Gene Ontology, KEGG, EMBL, TAIR, InterPro, SMART, PROSITE, NCBI, and Pfam. The database can be accessed via an interactive and convenient web server, which supports full-text search, PSI-BLAST sequence search, database browsing by protein family, and automatic classification of a new protein sequence into one of 64 annotated transcription factor families by hidden Markov models. Conclusions A comprehensive soybean transcription factor database was constructed and made publicly accessible at http://casp.rnet.missouri.edu/soydb/.

  6. Generating Concise Natural Language Summaries.

    Science.gov (United States)

    McKeown, Kathleen; And Others

    1995-01-01

    Presents an approach to summarization that combines information from multiple facts into a single sentence using linguistic constructions. Describes two applications: one produces summaries of basketball games, and the other contains summaries of telephone network planning activity. Both summarize input data as opposed to full text. Discusses…

  7. Standards development status. Summary report

    International Nuclear Information System (INIS)

    1981-12-01

    The Standards Development Status Summary Report is designed for scheduling, monitoring, and controlling the process by which Regulatory Standards, Guides, Reports, Petitions, and Environmental Statements are written. It is a summary of the current schedule plans for development of the above products

  8. Statistical summary 1990-91

    International Nuclear Information System (INIS)

    1991-01-01

    The information contained in this statistical summary leaflet summarizes in bar charts or pie charts Nuclear Electric's performance in 1990-91 in the areas of finance, plant and plant operations, safety, commercial operations and manpower. It is intended that the information will provide a basis for comparison in future years. The leaflet also includes a summary of Nuclear Electric's environmental policy statement. (UK)

  9. Spheres of discharge of springs

    Science.gov (United States)

    Springer, Abraham E.; Stevens, Lawrence E.

    2009-02-01

    Although springs have been recognized as important, rare, and globally threatened ecosystems, there is as yet no consistent and comprehensive classification system or common lexicon for springs. In this paper, 12 spheres of discharge of springs are defined, sketched, displayed with photographs, and described relative to their hydrogeology of occurrence, and the microhabitats and ecosystems they support. A few of the spheres of discharge have been previously recognized and used by hydrogeologists for over 80 years, but others have only recently been defined geomorphologically. A comparison of these spheres of discharge to classification systems for wetlands, groundwater dependent ecosystems, karst hydrogeology, running waters, and other systems is provided. With a common lexicon for springs, hydrogeologists can provide more consistent guidance for springs ecosystem conservation, management, and restoration. As additional comprehensive inventories of the physical, biological, and cultural characteristics are conducted and analyzed, it will eventually be possible to associate spheres of discharge with discrete vegetation and aquatic invertebrate assemblages, and better understand the habitat requirements of rare or unique springs species. Given the elevated productivity and biodiversity of springs, and their highly threatened status, identification of geomorphic similarities among spring types is essential for conservation of these important ecosystems.

  10. Problems with textile wastewater discharge

    International Nuclear Information System (INIS)

    Rantala, Pentti

    1987-01-01

    The general character of textile industry wastewaters is briefly discussed. General guidelines and practice in Finland when discharging textile industry wastewaters to municipal sewer systems is described. A survey revealed that most municipalities experience some problems due to textile industry wastewaters. Pretreatment is not always practiced and in some cases pretreatment is not operated efficiently. (author)

  11. Discharge measurements at gaging stations

    Science.gov (United States)

    Turnipseed, D. Phil; Sauer, Vernon B.

    2010-01-01

    The techniques and standards for making discharge measurements at streamflow gaging stations are described in this publication. The vertical axis rotating-element current meter, principally the Price current meter, has been traditionally used for most measurements of discharge; however, advancements in acoustic technology have led to important developments in the use of acoustic Doppler current profilers, acoustic Doppler velocimeters, and other emerging technologies for the measurement of discharge. These new instruments, based on acoustic Doppler theory, have the advantage of no moving parts, and in the case of the acoustic Doppler current profiler, quickly and easily provide three-dimensional stream-velocity profile data through much of the vertical water column. For much of the discussion of acoustic Doppler current profiler moving-boat methodology, the reader is referred to U.S. Geological Survey Techniques and Methods 3-A22 (Mueller and Wagner, 2009). Personal digital assistants (PDAs), electronic field notebooks, and other personal computers provide fast and efficient data-collection methods that are more error-free than traditional hand methods. The use of portable weirs and flumes, floats, volumetric tanks, indirect methods, and tracers in measuring discharge are briefly described.

  12. Ions mobilities in corona discharge

    International Nuclear Information System (INIS)

    Bakhtaev, Sh. A.; Bochkareva, G. V.; Sydykova, G. K.

    2000-01-01

    Ion mobility in unipolar corona at small inter-electron distances (up to 0.01 m) when as coroning element serves micro-wire is consider. Experimental data of ion mobility in corona discharge external zone in atmospheric air are obtained and its comparative analysis with known data is worked out. (author)

  13. Air corona discharge chemical kinetics

    International Nuclear Information System (INIS)

    Kline, L.E.; Kanter, I.E.

    1984-01-01

    We have theoretically studied the initial chemical processing steps which occur in pulseless, negative, dc corona discharges in flowing air. A rate equation model is used because these discharges consist of a very small ionization zone near the pin with most of the pin-plane gap filled by a drift zone where both the electric field and the electron density are relatively uniform. The primary activated species are N 2 (A),O and O 2 (a 1 Δ). The predicted activated species density due to one discharge is 100 ppm per ms . mA cm 2 assuming E/n=60 Td. In pure, dry air the final product due to these activated species is primarily O 3 . The NO /sub x/ production is about 0.5 ppm per mA. In moist air there is an additional production of about 1.5 ppm per mA of HO /sub x/ species. The predicted ozone formation reactions will be ''intercepted'' when impurities are present in the air. Impurities present at densities below about 0.1% will react primarily with the activated species rather than with electrons. Hence the predicted activated species density provides an estimate of the potential chemical processing performance of the discharge

  14. Electronic Discharge Letter Mobile App

    NARCIS (Netherlands)

    Lezcano, Leonardo; Triana, Michel; Ternier, Stefaan; Hartkopf, Kathleen; Stieger, Lina; Schroeder, Hanna; Sopka, Sasa; Drachsler, Hendrik; Maher, Bridget; Henn, Patrick; Orrego, Carola; Specht, Marcus

    2014-01-01

    The electronic discharge letter mobile app takes advantage of Near Field Communication (NFC) within the PATIENT project and a related post-doc study. NFC enabled phones to read passive RFID tags, but can also use this short-range wireless technology to exchange (small) messages. NFC in that sense

  15. Discharge cleaning of carbon deposits

    International Nuclear Information System (INIS)

    Mozetic, M.; Vesel, A.; Drenik, A.

    2006-01-01

    Experimental results of discharge cleaning of carbon deposits are presented. Deposits were prepared by creating plasma in pure methane. The methane was cracked in RF discharge at the output power of 250 W. The resultant radicals were bonded to the wall of discharge vessel forming a thin film of hydrogenated black carbon with the thickness of about 200nm. The film was then cleaned in situ by oxygen plasma with the density of about 1x10 16 m -3 , electron temperature of 5 eV, neutral gas kinetic temperature of about 100 0 C and neutral atom density of 6x10 21 m -3 . The treatment time was 30 minutes. The efficiency of plasma cleaning was monitored by optical emission spectroscopy. As long as the wall was contaminated with carbon deposit, substantial emission of the CO molecules was detected. As the cleaning was in progress, the CO emission was decreasing and vanished after 30 minutes when the discharge vessel became free of any carbon. The results are explained by interaction of plasma radicals with carbon deposits. (author)

  16. Mineral Commodity Summaries 2009

    Science.gov (United States)

    ,

    2009-01-01

    Each chapter of the 2009 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2008 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses. For mineral commodities for which there is a Government stockpile, detailed information concerning the stockpile status is included in the two-page synopsis. Because specific information concerning committed inventory was no longer available from the Defense Logistics Agency, National Defense Stockpile Center, that information, which was included in earlier Mineral Commodity Summaries publications, has been deleted from Mineral Commodity Summaries 2009. National reserves and reserve base information for most mineral commodities found in this report, including those for the United States, are derived from a variety of sources. The ideal source of such information would be comprehensive evaluations that apply the same criteria to deposits in different geographic areas and report the results by country. In the absence of such evaluations, national reserves and reserve base estimates compiled by countries for selected mineral commodities are a primary source of national reserves and reserve base information. Lacking national assessment information by governments, sources such as academic articles, company reports, common business practice, presentations by company representatives, and trade journal articles, or a combination of these, serve as the basis for national reserves and reserve base information reported in the mineral commodity sections of this publication. A national estimate may be assembled from the following: historically reported

  17. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

    2015-08-07

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

  18. Fuel Assembly Damping Summary

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kanghee; Kang, Heungseok; Oh, Dongseok; Yoon, Kyungho; Kim, Hyungkyu; Kim, Jaeyong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2013-10-15

    This paper summary the fuel assembly damping data in air/in still water/under flow, released from foreign fuel vendors, compared our data with the published data. Some technical issues in fuel assembly damping measurement testing are also briefly discussed. Understanding of each fuel assembly damping mechanisms according to the surrounding medium and flow velocity can support the fuel design improvement in fuel assembly dynamics and structural integrity aspect. Because the upgraded requirements of the newly-developed advanced reactor system will demands to minimize fuel design margin in integrity evaluation, reduction in conservatism of fuel assembly damping can contribute to alleviate the fuel design margin for sure. Damping is an energy dissipation mechanism in a vibrating mechanical structure and prevents a resonant structure from having infinite vibration amplitudes. The sources of fuel assembly damping are various from support friction to flow contribution, and it can be increased by the viscosity or drag of surrounding fluid medium or the average velocity of water flowing. Fuel licensing requires fuel design evaluation in transient or accidental condition. Dynamic response analysis of fuel assembly is to show fuel integrity and requires information on assembly-wise damping in dry condition and under wet or water flowing condition. However, damping measurement test for the full-scale fuel assembly prototype is not easy to carry out because of the scale (fuel prototype, test facility), unsteadiness of test data (scattering, random sampling and processing), instrumentation under water flowing (water-proof response measurement), and noise. LWR fuel technology division in KAERI is preparing the infra structure for damping measurement test of full-scale fuel assembly, to support fuel industries and related research activities. Here is a preliminary summary of fuel assembly damping, published in the literature. Some technical issues in fuel assembly damping

  19. Annual report on radioactive discharges and monitoring of the environment 1992. V. 1

    International Nuclear Information System (INIS)

    1993-01-01

    This Annual Report supplements and updates the Company's Environment Annual Report by providing more detailed information on radioactive discharges, monitoring of the environment and critical group doses. BNFL has published Annual Reports on Radioactive Discharges and Monitoring of the Environment since 1977. This year the report is again sub-divided into two complementary volumes. Volume I consists of site papers, one for each of the Company's sites and includes annual data on radioactive discharges into the environment and the associated environmental monitoring programmes. Critical group doses for each site are presented in summary tables at the beginning of each Site paper. Volume II reproduces the Certificates of Authorisation regulating the Company's discharges and the statutory environmental monitoring programmes which relate to them. (Author)

  20. Influences of obese (ob/ob and diabetes (db/db genotype mutations on lumber vertebral radiological and morphometric indices: Skeletal deformation associated with dysregulated systemic glucometabolism

    Directory of Open Access Journals (Sweden)

    Garris David R

    2006-02-01

    Full Text Available Abstract Background Both diabetes and obesity syndromes are recognized to promote lumbar vertebral instability, premature osteodegeneration, exacerbate progressive osteoporosis and increase the propensity towards vertebral degeneration, instability and deformation in humans. Methods The influences of single-gene missense mutations, expressing either diabetes (db/db or obese (ob/ob metabolic syndromes on vertebral maturation and development in C57BL/KsJ mice were evaluated by radiological and macro-morphometric analysis of the resulting variances in osteodevelopment indices relative to control parameters between 8 and 16 weeks of age (syndrome onset @ 4 weeks, and the influences of low-dose 17-B-estradiol therapy on vertebral growth expression evaluated. Results Associated with the indicative genotypic obesity and hyper-glycemic/-insulinemic states, both db/db and ob/ob mutants demonstrated a significant (P ≤ 0.05 elongation of total lumbar vertebrae column (VC regional length, and individual lumbar vertebrae (LV1-5 lengths, relative to control VC and LV parameters. In contrast, LV1-5 width indices were suppressed in db/db and ob/ob mutants relative to control LV growth rates. Between 8 and 16 weeks of age, the suppressed LV1-5 width indices were sustained in both genotype mutant groups relative to control osteomaturation rates. The severity of LV1-5 width osteosuppression correlated with the severe systemic hyperglycemic and hypertriglyceridemic conditions sustained in ob/ob and db/db mutants. Low-dose 17-B-estradiol therapy (E2-HRx: 1.0 ug/ 0.1 ml oil s.c/3.5 days, initiated at 4 weeks of age (i.e., initial onset phase of db/db and ob/ob expressions re-established control LV 1–5 width indices without influencing VC or LV lengths in db/db groups. Conclusion These data demonstrate that the abnormal systemic endometabolic states associated with the expression of db/db and ob/ob genomutation syndromes suppress LV 1–5 width osteomaturation

  1. BEAUTY'99 Conference Summary

    International Nuclear Information System (INIS)

    Eerola, Paula

    2000-01-01

    Investigations of B hadrons are expected to break new ground in measuring CP-violation effects. This series of BEAUTY conferences, originating from the 1993 conference in Liblice, has contributed significantly in developing ideas of CP-violation measurements using B hadrons and formulating and comparing critically the B-physics experiments. In the '99 conference in Bled we saw the ripening of the field and the first fruit emerging - Tevatron have produced beautiful B-physics results and more are expected to come with the next run, while the B-physics experiments at DESY, SLAC and KEK are starting their operation. The longer-term projects at LHC and Tevatron have taken their shape and detailed prototyping work is going on. Meanwhile, on the phenomenological side, there has been impressive theoretical progress in understanding deeper the 'standard' measurements and proposing new signatures. In this summary, I will highlight the status of the field as presented in the conference, concentrating on signatures, experiments and R and D programmes

  2. Astronautics summary and prospects

    CERN Document Server

    Kiselev, Anatoly Ivanovich; Menshikov, Valery Alexandrovich

    2003-01-01

    The monograph by A.I.Kiselev, A.A. Medvedev and Y.A.Menshikov, Astronautics: Summary and Prospects, aroused enthusiasm both among experts and the public at large. This is due to the felicitous choice of presentation that combines a simple description of complex space matters with scientificsubstantiation of the sub­ jectmatter described. The wealth of color photos makes the book still more attractive, and it was nominated for an award at the 14th International Moscow Book Fair, being singled out as the "best publication of the book fair". The book's popularity led to a second edition, substantially revised and enlarged. Since the first edition did not sufficiently cover the issues of space impact on ecology and the prospective development of space systems, the authors revised the entire volume, including in it the chapter "Space activity and ecology" and the section "Multi-function space systems". Using the federal monitoring system, now in the phase of system engi­ neering, as an example, the authors consi...

  3. Summary of the Workshop

    International Nuclear Information System (INIS)

    Myers, S; Zimmermann, F

    2012-01-01

    The summary session of the LHC Performance Workshop in Chamonix, 6-10 February 2012, synthesized one week of presentations and intense discussions on the near-, medium- and long-term strategy for the LHC and LHC upgrades. In particular, Chamonix’12 discussed the lessons from 2011, the strategy, beam energy and beam parameters for 2012, the planning for the Long Shutdown no. 1 (LS1), the measures and schemes for improving or maintaining the machine availability at higher beam energy, the injector performance and injector upgrade schedule, the HL-LHC project as well as possible additional or future LHC upgrades like LHeC and HELHC. Key workshop themes included the risk associated with 4 TeV beam energy in 2012, the beam energy after LS1, the turnaround time, the physics goal and optimized running schedule for 2012, the achievements and plans for Pb-Pb and p-Pb collisions, beam-beam effects, electron-cloud phenomena and UFOs. We report the proposals for decisions which have emerged at the Chamonix’12 workshop. (author)

  4. Mineral commodity summaries 2013

    Science.gov (United States)

    ,

    2013-01-01

    Each chapter of the 2013 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2012 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses. For mineral commodities for which there is a Government stockpile, detailed information concerning the stockpile status is included in the two-page synopsis. Abbreviations and units of measure, and definitions of selected terms used in the report, are in Appendix A and Appendix B, respectively. “Appendix C—Reserves and Resources” includes “Part A—Resource/Reserve Classification for Minerals” and “Part B—Sources of Reserves Data.” A directory of USGS minerals information country specialists and their responsibilities is Appendix D. The USGS continually strives to improve the value of its publications to users. Constructive comments and suggestions by readers of the MCS 2013 are welcomed.

  5. Mineral commodity summaries 2014

    Science.gov (United States)

    ,

    2014-01-01

    Each chapter of the 2014 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2013 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses. For mineral commodities for which there is a Government stockpile, detailed information concerning the stockpile status is included in the two-page synopsis. Abbreviations and units of measure, and definitions of selected terms used in the report, are in Appendix A and Appendix B, respectively. “Appendix C—Reserves and Resources” includes “Part A—Resource/Reserve Classification for Minerals” and “Part B—Sources of Reserves Data.” A directory of USGS minerals information country specialists and their responsibilities is Appendix D. The USGS continually strives to improve the value of its publications to users. Constructive comments and suggestions by readers of the MCS 2014 are welcomed.

  6. Summary of the Workshop

    Energy Technology Data Exchange (ETDEWEB)

    Myers, S; Zimmermann, F [European Organization for Nuclear Research, Geneva (Switzerland)

    2012-07-01

    The summary session of the LHC Performance Workshop in Chamonix, 6-10 February 2012, synthesized one week of presentations and intense discussions on the near-, medium- and long-term strategy for the LHC and LHC upgrades. In particular, Chamonix’12 discussed the lessons from 2011, the strategy, beam energy and beam parameters for 2012, the planning for the Long Shutdown no. 1 (LS1), the measures and schemes for improving or maintaining the machine availability at higher beam energy, the injector performance and injector upgrade schedule, the HL-LHC project as well as possible additional or future LHC upgrades like LHeC and HELHC. Key workshop themes included the risk associated with 4 TeV beam energy in 2012, the beam energy after LS1, the turnaround time, the physics goal and optimized running schedule for 2012, the achievements and plans for Pb-Pb and p-Pb collisions, beam-beam effects, electron-cloud phenomena and UFOs. We report the proposals for decisions which have emerged at the Chamonix’12 workshop. (author)

  7. New discharge tube with virtual cathode

    International Nuclear Information System (INIS)

    Seidelmann, L.; Aubrecht, L.

    2003-01-01

    Till this time known methods of the excitation of the discharge between electrodes are using either secondary or thermo emission of electrons by the cathode. Usually we speak about the self-maintained discharge. Lifetime of the cathode, that is shortened by the emission, limits in principle, the lifetime of the whole discharge tube. The discharge can, according to the present state of the art, be induced also by the inductive way. Arrangement for excitation of such discharge is rather expensive. The construction of the inductive excited discharge tube is considerably influenced by the necessity of the limitation of the losses in excitation magnetic circuits. Especially length of the discharge and pressure of the working gas are limited by the economic standpoints. Function of the discharge is always connected with unwanted electromagnetic radiation, whose restraint is expensive and represents limiting factor for arrangement of the discharge tube (Authors)

  8. Feasibility of wear compensation in micro EDM milling based on discharge counting and discharge population characterization

    DEFF Research Database (Denmark)

    Bissacco, Giuliano; Hansen, Hans Nørgaard; Tristo, G.

    2011-01-01

    This paper investigates the applicability of real time wear compensation in micro EDM milling based on discharge counting and discharge population characterization. Experiments were performed involving discharge counting and tool electrode wear measurement in a wide range of process parameters...

  9. Anti-liver-kidney microsome antibody type 1 recognizes human cytochrome P450 db1.

    Science.gov (United States)

    Gueguen, M; Yamamoto, A M; Bernard, O; Alvarez, F

    1989-03-15

    Anti-liver-kidney microsome antibody type 1 (LKM1), present in the sera of a group of children with autoimmune hepatitis, was recently shown to recognize a 50 kDa protein identified as rat liver cytochromes P450 db1 and db2. High homology between these two members of the rat P450 IID subfamily and human P450 db1 suggested that anti-LKM1 antibody is directed against this human protein. To test this hypothesis, a human liver cDNA expression library in phage lambda GT-11 was screened using rat P450 db1 cDNA as a probe. Two human cDNA clones were found to be identical to human P450 db1 by restriction mapping. Immunoblot analysis using as antigen, the purified fusion protein from one of the human cDNA clones showed that only anti-LKM1 with anti-50 kDa reactivity recognized the fusion protein. This fusion protein was further used to develop an ELISA test that was shown to be specific for sera of children with this disease. These results: 1) identify the human liver antigen recognized by anti-LKM1 auto-antibodies as cytochrome P450 db1, 2) allow to speculate that mutation on the human P450 db1 gene could alter its expression in the hepatocyte and make it auto-antigenic, 3) provide a simple and specific diagnostic test for this disease.

  10. DB 3.0: From plant phosphorylation sites to protein networks.

    Science.gov (United States)

    Yao, Qiuming; Ge, Huangyi; Wu, Shangquan; Zhang, Ning; Chen, Wei; Xu, Chunhui; Gao, Jianjiong; Thelen, Jay J; Xu, Dong

    2014-01-01

    In the past few years, the Plant Protein Phosphorylation Database (P(3)DB, http://p3db.org) has become one of the most significant in vivo data resources for studying plant phosphoproteomics. We have substantially updated P(3)DB with respect to format, new datasets and analytic tools. In the P(3)DB 3.0, there are altogether 47 923 phosphosites in 16 477 phosphoproteins curated across nine plant organisms from 32 studies, which have met our multiple quality standards for acquisition of in vivo phosphorylation site data. Centralized by these phosphorylation data, multiple related data and annotations are provided, including protein-protein interaction (PPI), gene ontology, protein tertiary structures, orthologous sequences, kinase/phosphatase classification and Kinase Client Assay (KiC Assay) data--all of which provides context for the phosphorylation event. In addition, P(3)DB 3.0 incorporates multiple network viewers for the above features, such as PPI network, kinase-substrate network, phosphatase-substrate network, and domain co-occurrence network to help study phosphorylation from a systems point of view. Furthermore, the new P(3)DB reflects a community-based design through which users can share datasets and automate data depository processes for publication purposes. Each of these new features supports the goal of making P(3)DB a comprehensive, systematic and interactive platform for phosphoproteomics research.

  11. Novel anti-diabetic effect of SCM-198 via inhibiting the hepatic NF-κB pathway in db/db mice.

    Science.gov (United States)

    Huang, Hui; Xin, Hong; Liu, Xinhua; Xu, Yajun; Wen, Danyi; Zhang, Yahua; Zhu, Yi Zhun

    2012-04-01

    There are reports of early evidence that suggest the involvement of chronic low-grade inflammation in the pathogenesis of Type 2 diabetes. Thus, substances that have effects in reducing inflammation could be potential drugs for Type 2 diabetes. Leonurine (4-guanidino-n-butyl syringate; SCM-198) is an alkaloid in HL (Herba leonuri), which was reported to possess anti-inflammatory properties. We hypothesize that SCM-198 may have beneficial effects on Type 2 diabetes. In the present study, we attempted to test this hypothesis by evaluating the anti-diabetic effect of SCM-198 and the possible underlying mechanisms of its effects in db/db mice. SCM-198 (50, 100 and 200 mg/kg of body weight), pioglitazone (50 mg/kg of body weight, as a positive control) or 1% CMC-Na (sodium carboxymethylcellulose) were administered to the db/db or db/m mice once daily for 3 weeks. After 3 weeks, SCM-198 (200 mg/kg of body weight) treatment significantly reduced the fasting blood glucose level and increased the plasma insulin concentration in the db/db mice, meanwhile it significantly lowered the plasma TAG (triacylglycerol) concentration and increased the HDL (high-density lipoprotein)-cholesterol concentration. Moreover, the dysregulated transcription of the hepatic glucose metabolic enzymes, including GK (glucokinase), G6Pase (glucose-6-phosphatase) and PEPCK (phosphoenolpyruvate carboxykinase), was recovered by an Akt-dependent pathway. The pro-inflammatory mediators {such as TNFα (tumour necrosis factor α), IL (interleukin)-6, IL-1β, degradation of IκB [inhibitor of NF-κB (nuclear factor-κB)] α and thereafter activation of NF-κB} were reversed by SCM-198 treatment in the db/db mice. The present study provides first evidence that SCM-198 exhibits anti-inflammatory activity and has an ameliorating effect on diabetic symptoms via inhibiting of NF-κB/IKK (IκB kinase) pathway. Consequently, we suggest that SCM-198 may be a prospective agent for prevention and

  12. Relativistic Electrons in Electric Discharges

    DEFF Research Database (Denmark)

    Cinar, Deniz

    at the time when also gigantic electric discharges were observed at 10-90 km altitude in the stratosphere and mesosphere, the so called “jets” and “sprites”, commonly referred to as “Transient Luminous Events” (TLEs). TGFs were _rst thought connected to TLEs, but later research has pointed to lightning......Thunderstorms generate bursts of X- and Gamma radiation. When observed from spacecraft, the bursts are referred to as “Terrestrial Gamma-ray Flashes” (TGFs). They are bremsstrahlung from energetic electrons accelerated in thunderstorm electric _elds. The TGFs were _rst observed in the 90ties...... discharges as the source. The “Atmosphere-Space Interactions Monitor” (ASIM) for the International Space Station in 2016, led by DTU Space, and the French microsatellite TARANIS, also with launch in 2016, will identify with certainty the source of TGFs. In preparation for the missions, the Ph.D. project has...

  13. Runaway electrons in toroidal discharges

    International Nuclear Information System (INIS)

    Knoepfel, H.

    1979-01-01

    Experimental and theoretical studies of runaway electrons in toroidal devices are reviewed here, with particular reference to tokamaks. The complex phenomenology of runaway effects, which have been the subject of research for the past twenty years, is organized within the framework of a number of physical models. The mechanisms and rates for runaway production are discussed first, followed by sections on runaway-driven kinetic relaxation processes and runaway orbit confinement. Next, the equilibrium and stability of runaway-dominated discharges are reviewed. Models for runaway production at early times in the discharge and the scaling of runaway phenomena to larger devices are also discussed. Finally, detection techniques and possible applications of runaways are mentioned. (author)

  14. Energy discharge heater power supply

    International Nuclear Information System (INIS)

    Jaskierny, W.

    1992-11-01

    The heater power supply is intended to supply capacitively stored,energy to embedded heater strips in cryo magnets. The amount of energy can be controlled by setting different charge different capacitor values. Two chassis' can be operated in series or interlocks are provided. The charge voltage, number of capacitors pulse can be monitored. There and dual channel has two discharge supplies in one chassis. This report reviews the characteristics of this power supply further

  15. Electrostatic probes in luminescent discharges

    International Nuclear Information System (INIS)

    Cunha Raposo, C. da.

    1980-01-01

    A system to produce luminescent type plasma by continuos discharge and ionization by high frequency was constructed. The ionization was done in the air and in the argon under pressures from 3 to 10 mmHg. The parameters of a non magnetized collisional plasma and the parameters of a magnetized plasma such as, density, eletron temperature and potential, using a Langmuir probe with plane geometry, were determined. (M.C.K.) [pt

  16. Internal Electrostatic Discharge Monitor - IESDM

    Science.gov (United States)

    Kim, Wousik; Goebel, Dan M.; Jun, Insoo; Garrett, Henry B.

    2011-01-01

    A document discusses an innovation designed to effectively monitor dielectric charging in spacecraft components to measure the potential for discharge in order to prevent damage from internal electrostatic discharge (IESD). High-energy electrons penetrate the structural materials and shielding of a spacecraft and then stop inside dielectrics and keep accumulating. Those deposited charges generate an electric field. If the electric field becomes higher than the breakdown threshold (approx. =2 x 10(exp 5) V/cm), discharge occurs. This monitor measures potentials as a function of dielectric depth. Differentiation of potential with respect to the depth yields electric field. Direct measurement of the depth profile of the potential in a dielectric makes real-time electronic field evaluation possible without simulations. The IESDM has been designed to emulate a multi-layer circuit board, to insert very thin metallic layers between the dielectric layers. The conductors serve as diagnostic monitoring locations to measure the deposited electron-charge and the charge dynamics. Measurement of the time-dependent potential of the metal layers provides information on the amount of charge deposited in the dielectrics and the movement of that charge with time (dynamics).

  17. Current discharge management of acute coronary syndromes: baseline results from a national quality improvement initiative.

    Science.gov (United States)

    Wai, A; Pulver, L K; Oliver, K; Thompson, A

    2012-05-01

    Evidence-practice gaps exist in the continuum of care for patients with acute coronary syndromes (ACS), particularly at hospital discharge. We aimed to describe the methodology and baseline results of the Discharge Management of Acute Coronary Syndromes (DMACS) project, focusing on the prescription of guideline-recommended medications, referral to cardiac rehabilitation and communication between the hospital, patient and their primary healthcare professionals. DMACS employed Drug Use Evaluation methodology involving data collection, evaluation and feedback, and targeted educational interventions. Adult patients with ACS discharged during a 4-month period were eligible to participate. Data were collected (maximum 50 patients) at each site through an inpatient medical record review, a general practitioner (GP) postal/fax survey conducted 14 days post discharge and a patient telephone survey 3 months post discharge. Forty-nine hospitals participated in the audit recruiting 1545 patients. At discharge, 57% of patients were prescribed a combination of antiplatelet agent(s), beta-blocker, statin and angiotensin-converting enzyme inhibitor and/or angiotensin II-antagonist. At 3 months post discharge, 48% of patients reported using the same combination. Some 67% of patients recalled being referred to cardiac rehabilitation; of these, 33% had completed the programme. In total, 83% of patients had a documented ACS management plan at discharge. Of these, 90% included a medication list, 56% a chest pain action plan and 54% risk factor modification advice. Overall, 65% of GPs rated the quality of information received in the discharge summary as 'very good' to 'excellent'. The findings of our baseline audit showed that despite the robust evidence base and availability of national guidelines, the management of patients with ACS can be improved. These findings will inform a multifaceted intervention strategy to improve adherence to guidelines for the discharge management of

  18. High-speed electro-optic switch with -80 dB crosstalk

    Science.gov (United States)

    Pan, J. J.; Su, W. H.; Xu, J. Y.; Grove, C. H.

    1992-01-01

    Special device modeling, design and layout, and precision processing controls were employed to fabricate new balanced-bridge 2x2 and 4x4 switches on X-cut, Y-propagation LiNbO3 substrate using Ti indiffused optical waveguides. The best of these devices achieved extinction ratio and crosstalk isolation of better than 93 dB electrically (46.5 dB optically). The new switches demonstrate good reproducibility with electrical crosstalk less than -80 dB.

  19. MongoDB and Python Patterns and processes for the popular document-oriented database

    CERN Document Server

    O'Higgins, Niall

    2011-01-01

    Learn how to leverage MongoDB with your Python applications, using the hands-on recipes in this book. You get complete code samples for tasks such as making fast geo queries for location-based apps, efficiently indexing your user documents for social-graph lookups, and many other scenarios. This guide explains the basics of the document-oriented database and shows you how to set up a Python environment with it. Learn how to read and write to MongoDB, apply idiomatic MongoDB and Python patterns, and use the database with several popular Python web frameworks. You'll discover how to model your

  20. Development of degradation D/B system for the containment building of NPP

    International Nuclear Information System (INIS)

    Cho, M. S.; Song, Y. C.; Yim, J. H.; Kim, D. K.; Lee, J. S.

    2001-01-01

    The Degradation D/B System is developed for digitalizing the history of the Containment building of nuclear power plant. It have 6 D/B which are consist of General, Design drawing, Material, Construction, ISI·SIT·ILRT D/B. For efficient operation of the system, utilities are also developed such as the aging and repair data management program for concrete and steel structures, the data search engine with various options helping users find what they want, and the data exchange program restoring and updating input data

  1. DB2 9 for zOS Database Administration Certification Study Guide

    CERN Document Server

    Lawson, Susan

    2008-01-01

    In order to become an IBM Certified Database Administrator - DB2 9 DBA for z/OS, you must pass two exams: DB2 9 Fundamentals Exam (Exam 730), and DB2 9 Database Administrator for z/OS (Exam 732)-the primary focus focus of this book. Written by two members of the team who participated in the actual writing of the exam, this specialized study guide covers every topic that you will need to know to pass Exam 732, including database design and implementation, operation and recovery, security and auditing, performance, as well as installation and migration/upgrade. But that is only the beginning.

  2. PhilDB: the time series database with built-in change logging

    Directory of Open Access Journals (Sweden)

    Andrew MacDonald

    2016-03-01

    Full Text Available PhilDB is an open-source time series database that supports storage of time series datasets that are dynamic; that is, it records updates to existing values in a log as they occur. PhilDB eases loading of data for the user by utilising an intelligent data write method. It preserves existing values during updates and abstracts the update complexity required to achieve logging of data value changes. It implements fast reads to make it practical to select data for analysis. Recent open-source systems have been developed to indefinitely store long-period high-resolution time series data without change logging. Unfortunately, such systems generally require a large initial installation investment before use because they are designed to operate over a cluster of servers to achieve high-performance writing of static data in real time. In essence, they have a ‘big data’ approach to storage and access. Other open-source projects for handling time series data that avoid the ‘big data’ approach are also relatively new and are complex or incomplete. None of these systems gracefully handle revision of existing data while tracking values that change. Unlike ‘big data’ solutions, PhilDB has been designed for single machine deployment on commodity hardware, reducing the barrier to deployment. PhilDB takes a unique approach to meta-data tracking; optional attribute attachment. This facilitates scaling the complexities of storing a wide variety of data. That is, it allows time series data to be loaded as time series instances with minimal initial meta-data, yet additional attributes can be created and attached to differentiate the time series instances when a wider variety of data is needed. PhilDB was written in Python, leveraging existing libraries. While some existing systems come close to meeting the needs PhilDB addresses, none cover all the needs at once. PhilDB was written to fill this gap in existing solutions. This paper explores existing time

  3. MonetDB: Two Decades of Research in Column-oriented Database Architectures

    OpenAIRE

    Idreos, Stratos; Groffen, Fabian; Nes, Niels; Manegold, Stefan; Mullender, Sjoerd; Kersten, Martin

    2012-01-01

    textabstractMonetDB is a state-of-the-art open-source column-store database management system targeting applications in need for analytics over large collections of data. MonetDB is actively used nowadays in health care, in telecommunications as well as in scientific databases and in data management research, accumulating on average more than 10,000 downloads on a monthly basis. This paper gives a brief overview of the MonetDB technology as it developed over the past two decades and the main r...

  4. Summary of the Day (CDMP)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Summary of the Day data file contains daily selected elements of observations recorded by certified observers. The stations were located in the U.S. and were...

  5. Long term performance session summary

    Energy Technology Data Exchange (ETDEWEB)

    Hanauer, S.

    1996-05-01

    This paper presents brief summaries of reports given on plutonium disposal. Topics include: performance of waste forms; glass leaching; ceramic leaching; safeguards and security issues; safeguards of vitrification; and proliferation risks of geologic disposal.

  6. Summary of Meson'98 Workshop

    International Nuclear Information System (INIS)

    Henley, E.M.

    1998-01-01

    One never quite knows what to say in a summary. If you were at the sessions, you heard the same talks I did. Perhaps the purpose is to summarize the parallel sessions, but like you, I can only attend one of these sessions. In addition, the time is short, so that this cannot be a real summary. What I will present are impressions of the past two days, and these will certainly be colored by my own views. Thus at the outset, let me apologize for any and all omissions and distortions. I will cover primarily the plenary session talks, but will organize this summary along the following lines: 1. vector (V) mesons; 2. pseudoscalar mesons, and 3. other subjects, notably with electrons. This afternoon's talks are so close in time to this summary that I shall omit them. (author)

  7. Operating reactors licensing actions summary

    International Nuclear Information System (INIS)

    1981-08-01

    The Operating Reactors Licensing Actions Summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors

  8. Summary 2010 Greenhouse Gas Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — This file contains a summary of the publicly available data from the GHG Reporting Program for 2010. This data includes non-confidential data reported by facilities...

  9. Accelerator technology working group summary

    International Nuclear Information System (INIS)

    Jameson, R.A.

    1985-01-01

    A summary is presented of workshop deliberations on basic scaling, the economic viability of laser drive power for HEP accelerators, the availability of electron beam injectors for near-term experiments, and a few very general remarks on technology issues

  10. Summary and conclusions [Chapter 11

    Science.gov (United States)

    Daniel G. Neary; John N. Rinne; Alvin L.. Medina

    2012-01-01

    Summaries and conclusions of each chapter are compiled here to provide a “Quick Reference” guide of major results and recommendations for the UVR. More detail can be obtained from individual chapters.

  11. Safeguards Summary Event List (SSEL)

    International Nuclear Information System (INIS)

    1984-03-01

    The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the U.S. Nuclear Regulatory Commission (NRC). Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, tampering/vandalism, arson, firearms, radiological sabotage and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels

  12. Safeguards Summary Event List (SSEL)

    International Nuclear Information System (INIS)

    1983-02-01

    The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC). Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, vandalism, arson, firearms, radiological sabotage and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels

  13. Safeguards Summary Event List (SSEL)

    International Nuclear Information System (INIS)

    1982-07-01

    The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC). Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, vandalism, arson, firearms, sabotage and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels

  14. Leaving the hospital - your discharge plan

    Science.gov (United States)

    ... patientinstructions/000867.htm Leaving the hospital - your discharge plan To use the sharing features on this page, ... once you leave. This is called a discharge plan. Your health care providers at the hospital will ...

  15. EPA Region 1 No Discharge Zones

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset details No Discharge Zones (NDZ) for New England. Boaters may not discharge waste into these areas. Boundaries were determined mostly by Federal...

  16. Early hospital discharge and early puerperal complications.

    Science.gov (United States)

    Ramírez-Villalobos, Dolores; Hernández-Garduño, Adolfo; Salinas, Aarón; González, Dolores; Walker, Dilys; Rojo-Herrera, Guadalupe; Hernández-Prado, Bernardo

    2009-01-01

    To evaluate the association between time of postpartum discharge and symptoms indicative of complications during the first postpartum week. Women with vaginal delivery at a Mexico City public hospital, without complications before the hospital discharge, were interviewed seven days after delivery. Time of postpartum discharge was classified as early (25 hours). The dependent variable was defined as the occurrence and severity of puerperal complication symptoms. Out of 303 women, 208 (68%) were discharged early. However, women with early discharge and satisfactory prenatal care had lower odds of presenting symptoms in early puerperium than women without early discharge and inadequate prenatal care (OR 0.36; 95% confidence intervals = 0.17-0.76). There was no association between early discharge and symptoms of complications during the first postpartum week; the odds of complications were lower for mothers with early discharge and satisfactory prenatal care.

  17. Early discharge hospital at home.

    Science.gov (United States)

    Gonçalves-Bradley, Daniela C; Iliffe, Steve; Doll, Helen A; Broad, Joanna; Gladman, John; Langhorne, Peter; Richards, Suzanne H; Shepperd, Sasha

    2017-06-26

    Early discharge hospital at home is a service that provides active treatment by healthcare professionals in the patient's home for a condition that otherwise would require acute hospital inpatient care. This is an update of a Cochrane review. To determine the effectiveness and cost of managing patients with early discharge hospital at home compared with inpatient hospital care. We searched the following databases to 9 January 2017: the Cochrane Effective Practice and Organisation of Care Group (EPOC) register, Cochrane Central Register of Controlled Trials (CENTRAL), MEDLINE, Embase, CINAHL, and EconLit. We searched clinical trials registries. Randomised trials comparing early discharge hospital at home with acute hospital inpatient care for adults. We excluded obstetric, paediatric and mental health hospital at home schemes.   DATA COLLECTION AND ANALYSIS: We followed the standard methodological procedures expected by Cochrane and EPOC. We used the GRADE approach to assess the certainty of the body of evidence for the most important outcomes. We included 32 trials (N = 4746), six of them new for this update, mainly conducted in high-income countries. We judged most of the studies to have a low or unclear risk of bias. The intervention was delivered by hospital outreach services (17 trials), community-based services (11 trials), and was co-ordinated by a hospital-based stroke team or physician in conjunction with community-based services in four trials.Studies recruiting people recovering from strokeEarly discharge hospital at home probably makes little or no difference to mortality at three to six months (risk ratio (RR) 0.92, 95% confidence interval (CI) 0.57 to 1.48, N = 1114, 11 trials, moderate-certainty evidence) and may make little or no difference to the risk of hospital readmission (RR 1.09, 95% CI 0.71 to 1.66, N = 345, 5 trials, low-certainty evidence). Hospital at home may lower the risk of living in institutional setting at six months (RR 0.63, 96% CI

  18. Overview and summary

    International Nuclear Information System (INIS)

    1999-01-01

    The ITER Physics Basis presents and evaluates the physics rules and methodologies for plasma performance projections, which provide the basis for the design of a tokamak burning plasma device whose goal is to demonstrate the scientific and technological feasibility of fusion energy for peaceful purposes. This Chapter summarizes the physics basis for burning plasma projections, which is developed in detail by the ITER Physics Expert Groups in subsequent chapters. To set context, the design guidelines and requirements established in the report of ITER Special Working Group 1 are presented, as are the specifics of the tokamak design developed in the Final Design Report of the ITER Engineering Design Activities, which exemplifies burning tokamak plasma experiments. The behaviour of a tokamak plasma is determined by the interaction of many diverse physics processes, all of which bear on projections for both a burning plasma experiment and an eventual tokamak reactor. Key processes summarized here are energy and particle confinement and the H-mode power threshold; MHD stability, including pressure and density limits, neoclassical islands, error fields, disruptions, sawteeth, and ELMs; power and particle exhaust, involving divertor power dispersal, helium exhaust, fuelling and density control, H-mode edge transition region, erosion of plasma facing components, tritium retention; energetic particle physics; auxiliary power physics; and the physics of plasma diagnostics. Summaries of projection methodologies, together with estimates of their attendant uncertainties, are presented in each of these areas. Since each physics element has its own scaling properties, an integrated experimental demonstration of the balance between the combined processes which obtains in a reactor plasma is inaccessible to contemporary experimental facilities: it requires a reactor scale device. It is argued, moreover, that a burning plasma experiment can be sufficiently flexible to permit

  19. RAMP 2003 summary report

    International Nuclear Information System (INIS)

    Moats, D.; Stanley, S.; Abundo, L.; Theriault, C.; Bruce, G.; Gibbons, W.

    2003-01-01

    This report summarized key findings of the 2003 Regional Aquatics Monitoring Program (RAMP) annual technical report. RAMP was formed in 1997 to monitor the health of rivers and lakes in the oil sands region of Alberta and to assess the potential impacts of oil sands development. It was also developed to collect baseline data and compare it with environmental assessment predictions made by oil sand operators in the Wood Buffalo region. In 2003, RAMP monitored fish and fish habitats in the oil sands region, as well as water and sediment quality. Data was also collected on benthic invertebrates; wetlands vegetation; lake acidification data; hydrology; and climate. Studies focused on the Athabasca River and its tributaries; smaller tributaries of the Muskeg River; the North Steepbank River; and the Christina River. Data from wetlands in the vicinity of current and proposed oil sands developments was collected together with data from 50 acid-sensitive lakes in northeastern Alberta. RAMP monitoring activities in 2003 increased in response to increased resource exploitation activities in the region. Information from climate and hydrologic monitoring stations was analyzed in order to model changes resulting from oil sands development. Water levels were monitored to measure discharge, ice thickness, and water depth of selected lakes and streams. Water and sediment quality analyses were conducted to establish the physical and chemical features of the water bodies in the RAMP study area. The analyses suggested that water quality was consistent with previous years. Inputs from tributaries in the oil sands region did not obviously impact water quality in the Athabasca River. Higher levels of polycyclic aromatic hydrocarbons (PAHs) were noted at stations in the oil sands regions. Benthic communities monitored in the study were within expected ranges for undisturbed communities in the region. A RAMP fish monitoring program indicated that spawning runs in the Muskeg River have

  20. Capacitor discharges, magnetohydrodynamics, X-rays, ultrasonics

    CERN Document Server

    Früngel, Frank B A

    1965-01-01

    High Speed Pulse Technology, Volume 1: Capacitor Discharges - Magnetohydrodynamics - X-Rays - Ultrasonics deals with the theoretical and engineering problems that arise in the capacitor discharge technique.This book discusses the characteristics of dielectric material, symmetrical switch tubes with mercury filling, and compensation conductor forms. The transformed discharge for highest current peaks, ignition transformer for internal combustion engines, and X-ray irradiation of subjects in mechanical motion are also elaborated. This text likewise covers the transformed capacitor discharge in w

  1. Basic Studies of Distributed Discharge Limiters

    Science.gov (United States)

    2014-02-10

    electron avalanche ionization discharges induced by a focused 110 GHz millimeter-wave beam in atmospheric air. Discharges take place in a free volume of...plasma. 3.1.7 Vacuum Ultraviolet emission from pulsed discharges at atmospheric pressure. Fig. 6. Energy level diagram for molecular and...the utilized spectral simulation software, SPECTRAPLOT. 3.1.8 Non-intrusive diagnostic method for dissociation degree in pulsed discharges

  2. Radio frequency discharge with dust particles

    NARCIS (Netherlands)

    Chutov, Y. I.; W. J. Goedheer,; Kravchenko, O. Y.; Zuz, V. M.; Yan, M.; Martins, R.; Ferreira, I.; Fortunato, E.; Kroesen, G.

    2000-01-01

    A 1D PIC/MCC method has been developed for computer simulations of low-pressure RF discharges with dust particles using the method for dust-free discharges. A RF discharge in argon with dust particles distributed uniformly in the interelectrode gap is simulated at parameters providing a possibility

  3. 32 CFR 724.117 - Discharge review.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Discharge review. 724.117 Section 724.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.117 Discharge review. A nonadversary administrative reappraisal at the level of...

  4. Expansion of a nitrogen discharge by sound

    International Nuclear Information System (INIS)

    Antinyan, M.A.; Galechyan, G.A.; Tavakalyan, L.B.

    1992-01-01

    When the background pressure and the discharge current in a gas discharge are raised the plasma column is tightened up into a filament. Then the discharge occupies a region of the discharge tube whose transverse dimensions are substantially less than those of the tube. This contraction phenomenon in discharges restricts the range of parameters used in various devices to the range of relatively low discharge currents and low gas pressures. This contraction interferes with creating high-power gas lasers, since it acts destructively on the lasing process. In order to suppress filamentation of discharges the working gas has been pumped through the system at high speed, with considerable success. The turbulent mixing in the stream plays an important role in creating an uncontracted discharge at high pressures. The purpose of the present work is to study the possibility of undoing the contraction of a nitrogen discharge, which is one of the main components in the operation of a CO 2 laser, by introducing an intense sound wave in the discharge tube. Discharge contraction and the effect of a sound wave propagating along the plasma column have been investigated experimentally in nitrogen by studying the current-voltage characteristics of a contracted discharge. 6 refs., 3 figs

  5. On regulation of radioactive airborne discharge

    International Nuclear Information System (INIS)

    Stroganov, A.A.; Kuryndin, A.V.; Shapovalov, A.S.; Orlov, M.Yu.

    2013-01-01

    Authors present the Russian regulatory basis of radioactive airborne discharges which was updated after enactment of the Methodology for airborne discharge limits development. Criteria for establishing of airborne discharge limits, scope and other features of methodology are also considered in the article [ru

  6. Long-term treatment with the sodium glucose cotransporter 2 inhibitor, dapagliflozin, ameliorates glucose homeostasis and diabetic nephropathy in db/db mice.

    Directory of Open Access Journals (Sweden)

    Naoto Terami

    Full Text Available Inhibition of sodium glucose cotransporter 2 (SGLT2 has been reported as a new therapeutic strategy for treating diabetes. However, the effect of SGLT2 inhibitors on the kidney is unknown. In addition, whether SGLT2 inhibitors have an anti-inflammatory or antioxidative stress effect is still unclear. In this study, to resolve these issues, we evaluated the effects of the SGLT2 inhibitor, dapagliflozin, using a mouse model of type 2 diabetes and cultured proximal tubular epithelial (mProx24 cells. Male db/db mice were administered 0.1 or 1.0 mg/kg of dapagliflozin for 12 weeks. Body weight, blood pressure, blood glucose, hemoglobin A1c, albuminuria and creatinine clearance were measured. Mesangial matrix accumulation and interstitial fibrosis in the kidney and pancreatic β-cell mass were evaluated by histological analysis. Furthermore, gene expression of inflammatory mediators, such as osteopontin, monocyte chemoattractant protein-1 and transforming growth factor-β, was evaluated by quantitative reverse transcriptase-PCR. In addition, oxidative stress was evaluated by dihydroethidium and NADPH oxidase 4 staining. Administration of 0.1 or 1.0 mg/kg of dapagliflozin ameliorated hyperglycemia, β-cell damage and albuminuria in db/db mice. Serum creatinine, creatinine clearance and blood pressure were not affected by administration of dapagliflozin, but glomerular mesangial expansion and interstitial fibrosis were suppressed in a dose-dependent manner. Dapagliflozin treatment markedly decreased macrophage infiltration and the gene expression of inflammation and oxidative stress in the kidney of db/db mice. Moreover, dapagliflozin suppressed the high-glucose-induced gene expression of inflammatory cytokines and oxidative stress in cultured mProx24 cells. These data suggest that dapagliflozin ameliorates diabetic nephropathy by improving hyperglycemia along with inhibiting inflammation and oxidative stress.

  7. Adeno-associated virus-mediated expression of myostatin propeptide improves the growth of skeletal muscle and attenuates hyperglycemia in db/db mice.

    Science.gov (United States)

    Jiang, J G; Shen, G F; Li, J; Qiao, C; Xiao, B; Yan, H; Wang, D W; Xiao, X

    2017-03-01

    Inhibition of myostatin, a negative growth modulator for muscle, can functionally enhance muscle mass and improve glucose and fat metabolism in myostatin propeptide (MPRO) transgenic mice. This study was to investigate whether myostatin inhibition by adeno-associated virus (AAV)-mediated gene delivery of MPRO could improve muscle mass and achieve therapeutic effects on glucose regulation and lipid metabolism in the db/db mice and the mechanisms involved in that process. Eight-week-old male db/db mice were administered saline, AAV-GFP and AAV-MPRO/Fc vectors and monitored random blood glucose levels and body weight for 36 weeks. Body weight gain was not different during follow-up among the groups, but AAV-MPRO/Fc vectors resulted high level of MPRO in the blood companied by an increase in skeletal muscle mass and muscle hypertrophy. In addition, AAV-MPRO/Fc-treated db/db mice showed significantly lower blood glucose and insulin levels and significantly increased glucose tolerance and insulin sensitivity compared with the control groups (P<0.05). Moreover, these mice exhibited lower triglyceride (TG) and free fatty acid (FFA) content in the skeletal muscle, although no difference was observed in fat pad weights and serum TG and FFA levels. Finally, AAV-MPRO/Fc-treated mice had enhanced insulin signaling in the skeletal muscle. These data suggest that AAV-mediated MPRO therapy may provide an important clue for potential clinical applications to prevent type II diabetes, and these studies confirm that MPRO is a therapeutic target for type II diabetes.

  8. License - dbQSNP | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...escription Download License Update History of This Database Site Policy | Contact Us License - dbQSNP | LSDB Archive ...

  9. MoonDB — A Data System for Analytical Data of Lunar Samples

    Science.gov (United States)

    Lehnert, K.; Ji, P.; Cai, M.; Evans, C.; Zeigler, R.

    2018-04-01

    MoonDB is a data system that makes analytical data from the Apollo lunar sample collection and lunar meteorites accessible by synthesizing published and unpublished datasets in a relational database with an online search interface.

  10. The Kepler DB, a Database Management System for Arrays, Sparse Arrays and Binary Data

    Science.gov (United States)

    McCauliff, Sean; Cote, Miles T.; Girouard, Forrest R.; Middour, Christopher; Klaus, Todd C.; Wohler, Bill

    2010-01-01

    The Kepler Science Operations Center stores pixel values on approximately six million pixels collected every 30-minutes, as well as data products that are generated as a result of running the Kepler science processing pipeline. The Kepler Database (Kepler DB) management system was created to act as the repository of this information. After one year of ight usage, Kepler DB is managing 3 TiB of data and is expected to grow to over 10 TiB over the course of the mission. Kepler DB is a non-relational, transactional database where data are represented as one dimensional arrays, sparse arrays or binary large objects. We will discuss Kepler DB's APIs, implementation, usage and deployment at the Kepler Science Operations Center.

  11. The Kepler DB: a database management system for arrays, sparse arrays, and binary data

    Science.gov (United States)

    McCauliff, Sean; Cote, Miles T.; Girouard, Forrest R.; Middour, Christopher; Klaus, Todd C.; Wohler, Bill

    2010-07-01

    The Kepler Science Operations Center stores pixel values on approximately six million pixels collected every 30 minutes, as well as data products that are generated as a result of running the Kepler science processing pipeline. The Kepler Database management system (Kepler DB)was created to act as the repository of this information. After one year of flight usage, Kepler DB is managing 3 TiB of data and is expected to grow to over 10 TiB over the course of the mission. Kepler DB is a non-relational, transactional database where data are represented as one-dimensional arrays, sparse arrays or binary large objects. We will discuss Kepler DB's APIs, implementation, usage and deployment at the Kepler Science Operations Center.

  12. Database Description - D-HaploDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 1-8. External Links: Article title: D-HaploDB: a database of definitive haplotypes determined by genotypin...(5):e1000468. External Links: Article title: A definitive haplotype map as determined by genotyping

  13. Protective effects of SGLT2 inhibitor luseogliflozin on pancreatic β-cells in obese type 2 diabetic db/db mice

    Energy Technology Data Exchange (ETDEWEB)

    Okauchi, Seizo, E-mail: okauchi@med.kawasaki-m.ac.jp; Shimoda, Masashi; Obata, Atsushi; Kimura, Tomohiko; Hirukawa, Hidenori; Kohara, Kenji; Mune, Tomoatsu; Kaku, Kohei; Kaneto, Hideaki

    2016-02-12

    It is well known that Sodium-Glucose Co-transporter 2 (SGLT2) inhibitors, new hypoglycemic agents, improve glycemic control by increasing urine glucose excretion, but it remained unclear how they exert protective effects on pancreatic β-cells. In this study, we examined the effects of SGLT2 inhibitor luseogliflozin on β-cell function and mass using obese type 2 diabetic db/db mice. Ten-week-old male diabetic db/db mice were treated with luseogliflozin 0.0025% or 0.01% in chow (Luse 0.0025% or Luse 0.01%) or vehicle (control) for 4 weeks. Urinary glucose excretion was increased in Luse groups (0.0025% and 0.01%) compared to control mice 3 days after the intervention. Fasting blood glucose levels were significantly lower in mice treated with Luse compared to control mice. Fasting serum insulin concentrations were significantly higher in mice treated with Luse compared to control mice. Triglyceride levels tended to be lower in Luse groups compared to control mice. In immunohistochemical study using pancreas tissues, β-cell mass was larger in Luse groups compared to control group which was due to the increase of β-cell proliferation and decrease of β-cell apoptosis. Furthermore, in gene analysis using isolated islets, insulin 1, insulin 2, MafA, PDX-1 and GLUT2 gene expression levels were significantly higher in Luse groups compared to control group. In contrast, expression levels of fibrosis-related gene such as TGFβ, fibronectin, collagen I and collagen III were significantly lower in Luse groups. In conclusion, SGLT2 inhibitor luseogliflozin ameliorates glycemic control and thus exerts protective effects on pancreatic β-cell mass and function. - Highlights: • SGLT2 inhibitor luseogliflozin ameliorates glycemic control in db/db mice. • Luseogliflozin increases β-cell proliferation and decreases β-cell apoptosis. • Luseogliflozin preserves various β-cell-specific gene expression. • Luseogliflozin decreases various fibrosis-related factors in db/db

  14. Peripherally administered baclofen reduced food intake and body weight in db/db as well as diet-induced obese mice.

    Science.gov (United States)

    Sato, Ikuko; Arima, Hiroshi; Ozaki, Noriyuki; Ozaki, Nobuaki; Watanabe, Minemori; Goto, Motomitsu; Shimizu, Hiroshi; Hayashi, Masayuki; Banno, Ryouichi; Nagasaki, Hiroshi; Oiso, Yutaka

    2007-10-16

    Peripheral administration of baclofen significantly reduced food intake and body weight increase in both diabetic (db/db) and diet-induced obese mice for 5 weeks, whereas it had no significant effects on energy balance in their lean control mice. Despite the decreased body weight, neuropeptide Y expression in the arcuate nucleus was significantly decreased, whereas pro-opiomelanocortin expression was significantly increased by baclofen treatment. These data demonstrate that the inhibitory effects of baclofen on body weight in the obese mice were mediated via the arcuate nucleus at least partially, and suggest that GABA(B) agonists could be a new therapeutic reagent for obesity.

  15. Protective effects of SGLT2 inhibitor luseogliflozin on pancreatic β-cells in obese type 2 diabetic db/db mice

    International Nuclear Information System (INIS)

    Okauchi, Seizo; Shimoda, Masashi; Obata, Atsushi; Kimura, Tomohiko; Hirukawa, Hidenori; Kohara, Kenji; Mune, Tomoatsu; Kaku, Kohei; Kaneto, Hideaki

    2016-01-01

    It is well known that Sodium-Glucose Co-transporter 2 (SGLT2) inhibitors, new hypoglycemic agents, improve glycemic control by increasing urine glucose excretion, but it remained unclear how they exert protective effects on pancreatic β-cells. In this study, we examined the effects of SGLT2 inhibitor luseogliflozin on β-cell function and mass using obese type 2 diabetic db/db mice. Ten-week-old male diabetic db/db mice were treated with luseogliflozin 0.0025% or 0.01% in chow (Luse 0.0025% or Luse 0.01%) or vehicle (control) for 4 weeks. Urinary glucose excretion was increased in Luse groups (0.0025% and 0.01%) compared to control mice 3 days after the intervention. Fasting blood glucose levels were significantly lower in mice treated with Luse compared to control mice. Fasting serum insulin concentrations were significantly higher in mice treated with Luse compared to control mice. Triglyceride levels tended to be lower in Luse groups compared to control mice. In immunohistochemical study using pancreas tissues, β-cell mass was larger in Luse groups compared to control group which was due to the increase of β-cell proliferation and decrease of β-cell apoptosis. Furthermore, in gene analysis using isolated islets, insulin 1, insulin 2, MafA, PDX-1 and GLUT2 gene expression levels were significantly higher in Luse groups compared to control group. In contrast, expression levels of fibrosis-related gene such as TGFβ, fibronectin, collagen I and collagen III were significantly lower in Luse groups. In conclusion, SGLT2 inhibitor luseogliflozin ameliorates glycemic control and thus exerts protective effects on pancreatic β-cell mass and function. - Highlights: • SGLT2 inhibitor luseogliflozin ameliorates glycemic control in db/db mice. • Luseogliflozin increases β-cell proliferation and decreases β-cell apoptosis. • Luseogliflozin preserves various β-cell-specific gene expression. • Luseogliflozin decreases various fibrosis-related factors in db/db

  16. Analysis of neuron–astrocyte metabolic cooperation in the brain of db/db mice with cognitive decline using 13C NMR spectroscopy

    OpenAIRE

    Zheng, Hong; Zheng, Yongquan; Wang, Dan; Cai, Aimin; Lin, Qiuting; Zhao, Liangcai; Chen, Minjiang; Deng, Mingjie; Ye, Xinjian; Gao, Hongchang

    2016-01-01

    Type 2 diabetes has been linked to cognitive impairment, but its potential metabolic mechanism is still unclear. The present study aimed to explore neuron–astrocyte metabolic cooperation in the brain of diabetic (db/db, BKS.Cg-m+/+ Leprdb/J) mice with cognitive decline using 13C NMR technique in combination with intravenous [2-13C]-acetate and [3-13C]-lactate infusions. We found that the 13C-enrichment from [2-13C]-acetate into tricarboxylic acid cycle intermediate, succinate, was significant...

  17. Narrow gap electronegative capacitive discharges

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, E.; Lieberman, M. A.; Lichtenberg, A. J. [Department of Electrical Engineering and Computer Sciences, University of California, Berkeley, California 94720 (United States)

    2013-10-15

    Narrow gap electronegative (EN) capacitive discharges are widely used in industry and have unique features not found in conventional discharges. In this paper, plasma parameters are determined over a range of decreasing gap length L from values for which an electropositive (EP) edge exists (2-region case) to smaller L-values for which the EN region connects directly to the sheath (1-region case). Parametric studies are performed at applied voltage V{sub rf}=500 V for pressures of 10, 25, 50, and 100 mTorr, and additionally at 50 mTorr for 1000 and 2000 V. Numerical results are given for a parallel plate oxygen discharge using a planar 1D3v (1 spatial dimension, 3 velocity components) particle-in-cell (PIC) code. New interesting phenomena are found for the case in which an EP edge does not exist. This 1-region case has not previously been investigated in detail, either numerically or analytically. In particular, attachment in the sheaths is important, and the central electron density n{sub e0} is depressed below the density n{sub esh} at the sheath edge. The sheath oscillations also extend into the EN core, creating an edge region lying within the sheath and not characterized by the standard diffusion in an EN plasma. An analytical model is developed using minimal inputs from the PIC results, and compared to the PIC results for a base case at V{sub rf}=500 V and 50 mTorr, showing good agreement. Selected comparisons are made at the other voltages and pressures. A self-consistent model is also developed and compared to the PIC results, giving reasonable agreement.

  18. Cluster (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 0”. This cluster ID is uniquely-assigned by the PGDBj Ortholog Database. Cluster size Number of proteins aff...r About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Cluster (Viridiplantae) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Cluster (Viridiplantae) Data detail Data name Cluster (Viridiplantae) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  19. Cluster (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 3090”. This cluster ID is uniquely-assigned by the PGDBj Ortholog Database. Cluster size Number of proteins ...ster About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Cluster (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Cluster (Cyanobacteria) Data detail Data name Cluster (Cyanobacteria) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data

  20. Determination of DB10B values of single and mixed cultures of ...

    African Journals Online (AJOL)

    The survi-ving fraction of isolates decreased with increased irradiation doses. DB10B values of E. coli, S. aureus and S. parat-hyphi B were respectively 0.27, 0.33 and 0.44 kGy when inoculated as single cultures, and 0.24, 0.28 and 0.32 kGy respectively when inoculated as mixed cultures. DB10B values were lower for ...

  1. GenMapDB: a database of mapped human BAC clones

    OpenAIRE

    Morley, Michael; Arcaro, Melissa; Burdick, Joshua; Yonescu, Raluca; Reid, Thomas; Kirsch, Ilan R.; Cheung, Vivian G.

    2001-01-01

    GenMapDB (http://genomics.med.upenn.edu/genmapdb) is a repository of human bacterial artificial chromosome (BAC) clones mapped by our laboratory to sequence-tagged site markers. Currently, GenMapDB contains over 3000 mapped clones that span 19 chromosomes, chromosomes 2, 4, 5, 9–22, X and Y. This database provides positional information about human BAC clones from the RPCI-11 human male BAC library. It also contains restriction fragment analysis data and end sequen...

  2. DrugMetZ DB: an anthology of human drug metabolizing Chytochrome P450 enzymes.

    Science.gov (United States)

    Antony, Tresa Remya Thomas; Nagarajan, Shanthi

    2006-11-14

    Understandings the basics of Cytochrome P450 (P450 or CYP) will help to discern drug metabolism. CYP, a super-family of heme-thiolate proteins, are found in almost all living organisms and is involved in the biotransformation of a diverse range of xenobiotics, therapeutic drugs and toxins. Here, we describe DrugMetZ DB, a database for CYP metabolizing drugs. The DB is implemented in MySQL, PHP and HTML. www.bicpu.edu.in/DrugMetZDB/

  3. Double discharges in unipolar-pulsed dielectric barrier discharge xenon excimer lamps

    International Nuclear Information System (INIS)

    Liu Shuhai; Neiger, Manfred

    2003-01-01

    Excitation of dielectric barrier discharge xenon excimer lamps by unipolar short square pulses is studied in this paper. Two discharges with different polarity are excited by each voltage pulse (double discharge phenomenon). The primary discharge occurs at the top or at the rising flank of the applied unipolar square pulse, which is directly energized by the external circuit. The secondary discharge with the reversed polarity occurs at the falling flank or shortly after the falling flank end (zero external voltage) depending on the pulse width, which is energized by the energy stored by memory charges deposited by the primary discharge. Fast-speed ICCD imaging shows the primary discharge has a conic discharge appearance with a channel broadening on the anode side. This channel broadening increases with increasing the pulse top level. Only the anode-side surface discharge is observed in the primary discharge. The surface discharge on the cathode side which is present in bipolar sine voltage excitation is not observed. On the contrary, the secondary discharge has only the cathode-side surface discharge. The surface discharge on the anode side is not observed. The secondary discharge is much more diffuse than the primary discharge. Time-resolved emission measurement of double discharges show the secondary discharge emits more VUV xenon excimer radiation but less infrared (IR) xenon atomic emission than the primary discharge. It was found that the IR xenon atomic emission from the secondary discharge can be reduced by shortening the pulse width. The energy efficiency of unipolar-pulsed xenon excimer lamps (the overall energy efficiency of double discharges) is much higher than that obtained under bipolar sine wave excitation. The output VUV spectrum under unipolar pulse excitation is found to be identical to that under sine wave excitation and independent of injected electric power

  4. State waste discharge permit application for cooling water and condensate discharges

    Energy Technology Data Exchange (ETDEWEB)

    Haggard, R.D.

    1996-08-12

    The following presents the Categorical State Waste Discharge Permit (SWDP) Application for the Cooling Water and Condensate Discharges on the Hanford Site. This application is intended to cover existing cooling water and condensate discharges as well as similar future discharges meeting the criteria set forth in this document.

  5. Discharge residence of TLD tagged fish

    International Nuclear Information System (INIS)

    Romberg, G.P.; Prepejchal, W.

    1974-01-01

    Although visual observations suggested that fish remained in the discharge for considerable periods, temperature-sensitive tags indicated the majority of fish spend less than 50 hr or 10 percent of the time at discharge temperatures. During 1974 a second fish tagging study was conducted, using temperature-sensitive tags to yield discharge residence times of Lake Michigan salmonids at Point Beach thermal discharge. Preliminary results revealed that many fish tag values were close to Unit I line indicating that calculated maximum discharge residence times for these fish will be nearly 100 percent of the elapsed time

  6. 7 CFR 3402.12 - Project summary.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Project summary. 3402.12 Section 3402.12 Agriculture... FELLOWSHIP GRANTS PROGRAM Preparation of an Application § 3402.12 Project summary. Using the Project Summary.... The summary should not include any reference to the specific number of fellowships requested. The...

  7. 49 CFR 194.113 - Information summary.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...

  8. Evaluating a Proof-of-Concept Approach of the German Health Telematics Infrastructure in the Context of Discharge Management.

    Science.gov (United States)

    Hübner, Ursula; Schulte, Georg; Sellemann, Björn; Quade, Matthias; Rottmann, Thorsten; Fenske, Matthias; Egbert, Nicole; Kuhlisch, Raik; Rienhoff, Otto

    2015-01-01

    Although national eHealth strategies have existed now for more than a decade in many countries, they have been implemented with varying success. In Germany, the eHealth strategy so far has resulted in a roll out of electronic health cards for all citizens in the statutory health insurance, but in no clinically meaningful IT-applications. The aim of this study was to test the technical and organisation feasibility, usability, and utility of an eDischarge application embedded into a laboratory Health Telematics Infrastructure (TI). The tests embraced the exchange of eDischarge summaries based on the multiprofessional HL7 eNursing Summary standard between a municipal hospital and a nursing home. All in all, 36 transmissions of electronic discharge documents took place. They demonstrated the technical-organisation feasibility and resulted in moderate usability ratings. A comparison between eDischarge and paper-based summaries hinted at higher ratings of utility and information completeness for eDischarges. Despite problems with handling the electronic health card, the proof-of-concept for the first clinically meaningful IT-application in the German Health TI could be regarded as successful.

  9. A MongoDB-Based Management of Planar Spatial Data with a Flattened R-Tree

    Directory of Open Access Journals (Sweden)

    Longgang Xiang

    2016-07-01

    Full Text Available This paper addresses how to manage planar spatial data using MongoDB, a popular NoSQL database characterized as a document-oriented, rich query language and high availability. The core idea is to flatten a hierarchical R-tree structure into a tabular MongoDB collection, during which R-tree nodes are represented as collection documents and R-tree pointers are expressed as document identifiers. By following this strategy, a storage schema to support R-tree-based create, read, update, and delete (CRUD operations is designed and a module to manage planar spatial data by consuming and maintaining flattened R-tree structure is developed. The R-tree module is then seamlessly integrated into MongoDB, so that users could manipulate planar spatial data with existing command interfaces oriented to geodetic spatial data. The experimental evaluation, using real-world datasets with diverse coverage, types, and sizes, shows that planar spatial data can be effectively managed by MongoDB with our flattened R-tree and, therefore, the application extent of MongoDB will be greatly enlarged. Our work resulted in a MongoDB branch with R-tree support, which has been released on GitHub for open access.

  10. Degradation of 2,4-DB in Argentinean agricultural soils with high humic matter content.

    Science.gov (United States)

    Cuadrado, Virginia; Merini, Luciano J; Flocco, Cecilia G; Giulietti, Ana M

    2008-01-01

    The dissipation of 4-(2,4-dichlorophenoxy) butyric acid (2,4-DB) in high-humic-matter-containing soils from agricultural fields of the Argentinean Humid Pampa region was studied, employing soil microcosms under different experimental conditions. The added herbicide was dissipated almost completely by soils with and without history of herbicide use by day 28. At 500 ppm, both soils showed the same degradation rates; but at 5-ppm concentration, the chronically exposed soil demonstrated a faster degradation of the herbicide. 2,4-DB addition produced increases in herbicide-degrading bacteria of three and 1.5 orders of magnitude in soils with and without history of herbicide use, respectively, in microcosms with 5 ppm. At 500-ppm concentration, the increase in 2,4-DB degraders was five orders of magnitude after 14 days, independent of the history of herbicide use. No differences were observed in either 2,4-DB degradation rates or in degrader bacteria numbers in the presence and absence of alfalfa plants, in spite of some differential characteristics in patterns of 2,4-DB metabolite accumulation. The main factor affecting 2,4-DB degradation rate would be the history of herbicide use, as a consequence of the adaptation of the indigenous microflora to the presence of herbicides in the field.

  11. AtomDB Progress Report: Atomic data and new models for X-ray spectroscopy.

    Science.gov (United States)

    Smith, Randall K.; Foster, Adam; Brickhouse, Nancy S.; Stancil, Phillip C.; Cumbee, Renata; Mullen, Patrick Dean; AtomDB Team

    2018-06-01

    The AtomDB project collects atomic data from both theoretical and observational/experimental sources, providing both a convenient interface (http://www.atomdb.org/Webguide/webguide.php) as well as providing input to spectral models for many types of astrophysical X-ray plasmas. We have released several updates to AtomDB in response to the Hitomi data, including new data for the Fe K complex, and have expanded the range of models available in AtomDB to include the Kronos charge exchange models from Mullen at al. (2016, ApJS, 224, 2). Combined with the previous AtomDB charge exchange model (http://www.atomdb.org/CX/), these data enable a velocity-dependent model for X-ray and EUV charge exchange spectra. We also present a new Kappa-distribution spectral model, enabling plasmas with non-Maxwellian electron distributions to be modeled with AtomDB. Tools are provided within pyAtomDB to explore and exploit these new plasma models. This presentation will review these enhancements and describe plans for the new few years of database and code development in preparation for XARM, Athena, and (hopefully) Arcus.

  12. A 60-dB linear VGA with novel exponential gain approximation

    International Nuclear Information System (INIS)

    Zhou Jiaye; Tan Xi; Wang Junyu; Tang Zhangwen; Min Hao

    2009-01-01

    A CMOS variable gain amplifier (VGA) that adopts a novel exponential gain approximation is presented. No additional exponential gain control circuit is required in the proposed VGA used in a direct conversion receiver. A wide gain control voltage from 0.4 to 1.8 V and a high linearity performance are achieved. The three-stage VGA with automatic gain control (AGC) and DC offset cancellation (DCOC) is fabricated in a 0.18-μm CMOS technology and shows a linear gain range of more than 58-dB with a linearity error less than ±1 dB. The 3-dB bandwidth is over 8 MHz at all gain settings. The measured input-referred third intercept point (IIP3) of the proposed VGA varies from -18.1 to 13.5 dBm, and the measured noise figure varies from 27 to 65 dB at a frequency of 1 MHz. The dynamic range of the closed-loop AGC exceeds 56 dB, where the output signal-to-noise-and-distortion ratio (SNDR) reaches 20 dB. The whole circuit, occupying 0.3 mm 2 of chip area, dissipates less than 3.7 mA from a 1.8-V supply.

  13. Antibodies against human cytochrome P-450db1 in autoimmune hepatitis type II.

    Science.gov (United States)

    Zanger, U M; Hauri, H P; Loeper, J; Homberg, J C; Meyer, U A

    1988-11-01

    In a subgroup of children with chronic active hepatitis, circulating autoantibodies occur that bind to liver and kidney endoplasmic reticulum (anti-liver/kidney microsome antibody type I or anti-LKM1). Anti-LKM1 titers follow the severity of the disease and the presence of these antibodies serves as a diagnostic marker for this autoimmune hepatitis type II. We demonstrate that anti-LKM1 IgGs specifically inhibit the hydroxylation of bufuralol in human liver microsomes. Using two assay systems with different selectivity for the two cytochrome P-450 isozymes catalyzing bufuralol metabolism in human liver, we show that anti-LKM1 exclusively recognizes cytochrome P-450db1. Immunopurification of the LKM1 antigen from solubilized human liver microsomes resulted in an electrophoretically homogenous protein that had the same molecular mass (50 kDa) as purified P-450db1 and an identical N-terminal amino acid sequence. Recognition of both purified P-450db1 and the immunoisolated protein on western blots by several monoclonal antibodies confirmed the identity of the LKM1 antigen with cytochrome P-450db1. Cytochrome P-450db1 has been identified as the target of a common genetic polymorphism of drug oxidation. However, the relationship between the polymorphic cytochrome P-450db1 and the appearance of anti-LKM1 autoantibodies as well as their role in the pathogenesis of chronic active hepatitis remains speculative.

  14. SIMS analysis: Development and evaluation program summary

    International Nuclear Information System (INIS)

    Groenewold, G.S.; Appelhans, A.D.; Ingram, J.C.; Delmore, J.E.; Dahl, D.A.

    1996-11-01

    This report provides an overview of the ''SIMS Analysis: Development and Evaluation Program'', which was executed at the Idaho National Engineering Laboratory from mid-FY-92 to the end of FY-96. It should be noted that prior to FY-1994 the name of the program was ''In-Situ SIMS Analysis''. This report will not go into exhaustive detail regarding program accomplishments, because this information is contained in annual reports which are referenced herein. In summary, the program resulted in the design and construction of an ion trap secondary ion mass spectrometer (IT-SIMS), which is capable of the rapid analysis of environmental samples for adsorbed surface contaminants. This instrument achieves efficient secondary ion desorption by use of a molecular, massive ReO 4 - primary ion particle. The instrument manages surface charge buildup using a self-discharging principle, which is compatible with the pulsed nature of the ion trap. The instrument can achieve high selectivity and sensitivity using its selective ion storage and MS/MS capability. The instrument was used for detection of tri-n-butyl phosphate, salt cake (tank cake) characterization, and toxic metal speciation studies (specifically mercury). Technology transfer was also an important component of this program. The approach that was taken toward technology transfer was that of component transfer. This resulted in transfer of data acquisition and instrument control software in FY-94, and ongoing efforts to transfer primary ion gun and detector technology to other manufacturers

  15. [Severe vaginal discharge following rectal surgery].

    Science.gov (United States)

    Burg, L C; Bremers, A J A; Heesakkers, J P F A; Kluivers, K B

    2018-01-01

    Almost 50% of women who have had rectal surgery subsequently develop vaginal discharge. Due to the recurrent and unexpected nature of this heavy discharge, they often experience it as very distressing. Many of these women undergo extensive diagnostic tests that are mainly focused on identifying fistula formation. If no fistula is found, in most cases no other cause for severe vaginal discharge can be demonstrated. In our practice, we saw three patients (49-, 54- and 74-years-old, respectively) with similar severe vaginal discharge after rectal surgery and in whom no explanation for the vaginal discharge could be found. For this reason we conducted a literature search into this condition. Anatomical changes appear to be responsible for heavy vaginal discharge following rectal surgery. Changes in pelvic floor muscles and compression of the distal part of the vagina may lead to pooling of fluid in the proximal part of the vagina, resulting in severe discharge. Symptomatic treatment may reduce the symptoms.

  16. Anisotropic Percolation Analysis of Discharge

    Science.gov (United States)

    Matsumoto, Shogo; Odagaki, Takashi

    2014-03-01

    Exploiting a nonlinear resistor network on a square lattice in two dimensions, we investigate discharge when two opposite sides of the lattice are subjected to a constant voltage difference. Each site is ionized randomly with a probability in proportion to the square of the strength of the electric field, and the resistivity between two ionized sites is assumed to be 10-6 times smaller than the original resistivity. Using Monte Carlo simulation, we obtain the current and distribution of clusters of ionized sites as functions of the fraction of ionized sites. It is found that a wall of potential drop is formed as the fraction approaches a critical value, which is followed by discharge. The critical value is much smaller than the critical percolation probability of the standard site percolation on the square lattice. We also find that a singular behavior of the cluster distribution is expected at a critical fraction differently from that for the current, and that the critical exponents characterizing the cluster distribution satisfy the scaling relation known for two-dimensional percolation, while the critical exponent of the percolation probability is close to the value reported for a directed percolation.

  17. Electrostatic discharge concepts and definitions

    Energy Technology Data Exchange (ETDEWEB)

    Borovina, Dan L [Los Alamos National Laboratory

    2008-01-01

    Many objects -like a human body, plastic wrap, or a rolling cart -that are electrically neutral, overall, can gain a net electrostatic charge by means of one of three methods: induction, physical transfer, or triboelectric charging (separation of conductive surfaces). The result is a voltage difference between the charged object and other objects, creating a situation where current flow is likely if two objects come into contact or close proximity. This current flow is known as electrostatic discharge, or ESD. The energy and voltage of the discharge can be influenced by factors such as the temperature and humidity in the room, the types of materials or flooring involved, or the clothing and footwear a person uses. Given the possible ranges of the current and voltage characteristic of an ESD pulse, it is important to consider the safety risks associated with detonator handling, assembly and disassembly, transportation and maintenance. For main charge detonators, these safety risks include high explosive violent reactions (HEVR) as well as inadvertent nuclear detonations (lND).

  18. Executive Summary - Overview

    International Nuclear Information System (INIS)

    2005-01-01

    Professor Andrzej Budzanowski was Director of IFJ in the years 1990-2004. On September 1st 2004, on IFJ joining the Polish Academy of Sciences, Professor Marek Jezabek has been nominated by the President of PAN as the Director of IFJ, for a 4-year term. Our Institute, with a personnel of 450 (182 research staff) and over 50 Ph.D. students, is presently one of the largest institutes of the Polish Academy of Sciences and one of the largest research institutes in Poland. The scientific staff consists on 120 post-doctoral researchers, 26 Associated Professors and 36 State-Nominated Professors. The total budget of the Institute for the year 2004 was about 56 million Euro. The IFJ is financed mainly from the state budget of the Ministry of Scientific Research and Information Technology. In 2004 this financing was about 4 million Euro, constituting 72% of the Institute's total budget. The remaining part of our 2004 budget came from individual research projects, also sponsored by the Ministry of Scientific Research (688 kEuro), from international projects (368 kEuro) and from the Institute's entrepreneurship activities (498 kEuro). Between 2003 and 2004 we doubled our income from international projects. For further budget information. The Scientific Council of the Institute, which consists of 40 elected members of the Institute's staff and 4 external members (elected representatives from other Polish institutes and universities), is authorized to confer Ph.D. degrees in Physics and related disciplines, and to initiate and conduct habilitation and professorship procedures. In 2003-2004 17 Ph.D. theses and 11 habilitations have been completed. Following their review procedures, 3 Associate Professors at the IFJ became state-nominated Professors, receiving their nominations from Poland's President, Mr. A. Kwasniewski. The Institute is structured into 17 scientific departments which cover the range of our scientific interests. A summary of our main scientific achievements in

  19. Transport, speciation, toxicity, and treatability of highway stormwater discharged to receiving waters in Louisiana : [tech summary].

    Science.gov (United States)

    2013-01-01

    As centralized wastewater treatment continues to improve while increasingly replacing decentralized systems, urban : rainfall-runoff has become the leading contributor of water body impairments in the United States (USEPA, 1996). For : many water bod...

  20. A cascade of classifiers for extracting medication information from discharge summaries

    Directory of Open Access Journals (Sweden)

    Halgrim Scott

    2011-07-01

    Full Text Available Abstract Background Extracting medication information from clinical records has many potential applications, and recently published research, systems, and competitions reflect an interest therein. Much of the early extraction work involved rules and lexicons, but more recently machine learning has been applied to the task. Methods We present a hybrid system consisting of two parts. The first part, field detection, uses a cascade of statistical classifiers to identify medication-related named entities. The second part uses simple heuristics to link those entities into medication events. Results The system achieved performance that is comparable to other approaches to the same task. This performance is further improved by adding features that reference external medication name lists. Conclusions This study demonstrates that our hybrid approach outperforms purely statistical or rule-based systems. The study also shows that a cascade of classifiers works better than a single classifier in extracting medication information. The system is available as is upon request from the first author.