WorldWideScience

Sample records for dick henry jb

  1. Higher dimensional global monopole in Brans–Dicke theory

    Indian Academy of Sciences (India)

    Keywords. Global monopole; Brans–Dicke theory; higher dimension. PACS Nos 04.20.Jb; 98.80.Bp; 04.50.+h. 1. Introduction. The idea of higher dimensional theory was originated in super string and super gravity the- ories to unify gravity with other fundamental forces in nature. Solutions of Einstein field equations in higher ...

  2. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  3. JB*-Algebras of Topological Stable Rank 1

    Directory of Open Access Journals (Sweden)

    Akhlaq A. Siddiqui

    2007-01-01

    Full Text Available In 1976, Kaplansky introduced the class JB*-algebras which includes all C*-algebras as a proper subclass. The notion of topological stable rank 1 for C*-algebras was originally introduced by M. A. Rieffel and was extensively studied by various authors. In this paper, we extend this notion to general JB*-algebras. We show that the complex spin factors are of tsr 1 providing an example of special JBW*-algebras for which the enveloping von Neumann algebras may not be of tsr 1. In the sequel, we prove that every invertible element of a JB*-algebra is positive in certain isotope of ; if the algebra is finite-dimensional, then it is of tsr 1 and every element of is positive in some unitary isotope of . Further, it is established that extreme points of the unit ball sufficiently close to invertible elements in a JB*-algebra must be unitaries and that in any JB*-algebras of tsr 1, all extreme points of the unit ball are unitaries. In the end, we prove the coincidence between the λ-function and λu-function on invertibles in a JB*-algebra.

  4. The complete Brans–Dicke theories

    International Nuclear Information System (INIS)

    Kofinas, Georgios

    2017-01-01

    Given that the simple wave equation of Brans–Dicke theory for the scalar field is preserved, we have investigated, through exhaustively analyzing the Bianchi identities, the consistent theories which violate the exact energy conservation equation. It is found that only three theories exist which are unambiguously determined from consistency, without imposing arbitrary functions by hand. Each of these theories possesses a specific interaction term which controls the energy exchange between the scalar field and ordinary matter. The theories contain new parameters (integration constants from the integration procedure) and when these are switched-off, Brans–Dicke theory emerges. As usually, the vacuum theories can be defined from the complete Brans–Dicke theories when the matter energy–momentum tensor vanishes.

  5. Lovelock-Brans-Dicke gravity

    Science.gov (United States)

    Wenjie Tian, David; Booth, Ivan

    2016-02-01

    According to Lovelock’s theorem, the Hilbert-Einstein and the Lovelock actions are indistinguishable from their field equations. However, they have different scalar-tensor counterparts, which correspond to the Brans-Dicke and the Lovelock-Brans-Dicke (LBD) gravities, respectively. In this paper the LBD model of alternative gravity with the Lagrangian density {{L}}{LBD}=\\frac{1}{16π }≤ft[φ ≤ft(R+\\frac{a}{\\sqrt{-g}}{}*{RR}+b{ G }\\right)-\\frac{{ω }{{L}}}{φ }{{{\

  6. Fermions in Brans-Dicke cosmology

    International Nuclear Information System (INIS)

    Samojeden, L. L.; Devecchi, F. P.; Kremer, G. M.

    2010-01-01

    Using the Brans-Dicke theory of gravitation we put under investigation a hypothetical universe filled with a fermionic field (with a self-interaction potential) and a matter constituent ruled by a barotropic equation of state. It is shown that the fermionic field [in combination with the Brans-Dicke scalar field φ(t)] could be responsible for a final accelerated era, after an initial matter dominated period.

  7. Renormalization in quantum Brans-Dicke gravity

    OpenAIRE

    Haba, Z.

    2002-01-01

    In the Brans-Dicke model we treat the scalar field exactly and expand the gravitational field in a power series. A comparison with 2D sigma models and \\phi^{4} perturbation theory in four dimensions suggests that the perturbation series in 4D Brans-Dicke model is renormalizable.

  8. Cosmic no-hair in Brans-Dicke theory

    International Nuclear Information System (INIS)

    Guzman, E.; Alam, S.

    1993-08-01

    In this short note we report our finding that within the context of alternative version of the Brans-Dicke theory (for ω ≥ -3/2, where ω is the Brans-Dicke parameter) the anisotropic Bianchi type cosmological models evolve towards the de Sitter isotropic universe. In short it is shown that during inflation there is no difference between the Brans-Dicke theory and General Relativity. Our result can thus be viewed as a generalization of the Wald's theorem for General Relativity. (author). 5 refs

  9. Thin-shell wormholes in Brans-Dicke gravity

    International Nuclear Information System (INIS)

    Eiroa, Ernesto F.; Richarte, Martin G.; Simeone, Claudio

    2008-01-01

    Spherically symmetric thin-shell wormholes are constructed within the framework of Brans-Dicke gravity. It is shown that, for appropriate values of the Brans-Dicke constant, these wormholes can be supported by matter satisfying the energy conditions

  10. Thin-shell wormholes in Brans-Dicke gravity

    Energy Technology Data Exchange (ETDEWEB)

    Eiroa, Ernesto F. [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria Pab. I, 1428 Buenos Aires (Argentina); Instituto de Astronomia y Fisica del Espacio, C.C. 67, Suc. 28, 1428 Buenos Aires (Argentina)], E-mail: eiroa@iafe.uba.ar; Richarte, Martin G. [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria Pab. I, 1428 Buenos Aires (Argentina)], E-mail: martin@df.uba.ar; Simeone, Claudio [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria Pab. I, 1428 Buenos Aires (Argentina)], E-mail: csimeone@df.uba.ar

    2008-12-22

    Spherically symmetric thin-shell wormholes are constructed within the framework of Brans-Dicke gravity. It is shown that, for appropriate values of the Brans-Dicke constant, these wormholes can be supported by matter satisfying the energy conditions.

  11. Thermodynamics of black-holes in Brans-Dicke gravity

    International Nuclear Information System (INIS)

    Kim, H.; Kim, Y.

    1997-01-01

    It is recently been argued that non-trivial Brans-Dicke black-hole solutions different from the usual Schwarzschild solution could exist. The authors attempt here to 'censor' these non-trivial Brans-Dicke black-hole solutions by examining their thermodynamics properties. Quantities like Hawking temperature and entropy of the black holes are computed. The analysis of the behaviors of these thermodynamic quantities appears to show that even in Brans-Dicke gravity, the usual Schwarzschild space-time turns out to be the only physically relevant uncharged black-hole solution

  12. False vacuum decay in Jordan-Brans-Dicke cosmologies

    International Nuclear Information System (INIS)

    Holman, R.; Wang, Yun; Weinberg, E.J.

    1989-12-01

    We examine the bubble nucleation rate in a first-order phase transition taking place in a background Jordan-Brans-Dicke cosmology. We compute the leading order terms in the nucleation rate when the Jordan-Brans-Dicke field is large (i.e., late times) by means of a Weyl rescaling of the fields in the theory. We find that despite the fact that the Jordan-Brans-Dicke field (hence the effective gravitational constant) has a time dependence in the false vacuum, at late times the nucleation rate is time independent. 21 refs

  13. Responses of the Brans-Dicke field due to gravitational collapses

    International Nuclear Information System (INIS)

    Hwang, Dong-il; Yeom, Dong-han

    2010-01-01

    We study responses of the Brans-Dicke field due to gravitational collapses of scalar field pulses using numerical simulations. Double-null formalism is employed to implement the numerical simulations. If we supply a scalar field pulse, it will asymptotically form a black hole via dynamical interactions of the Brans-Dicke field. Hence, we can observe the responses of the Brans-Dicke field by two different regions. First, we observe the late time behaviors after the gravitational collapse, which include formations of a singularity and an apparent horizon. Second, we observe the fully dynamical behaviors during the gravitational collapse and view the energy-momentum tensor components. For the late time behaviors, if the Brans-Dicke coupling is greater (or smaller) than -1.5, the Brans-Dicke field decreases (or increases) during the gravitational collapse. Since the Brans-Dicke field should be relaxed to the asymptotic value with the elapse of time, the final apparent horizon becomes time-like (or space-like). For the dynamical behaviors, we observed the energy-momentum tensors around ω ∼ -1.5. If the Brans-Dicke coupling is greater than -1.5, the T uu component can be negative at the outside of the black hole. This can allow an instantaneous inflating region during the gravitational collapse. If the Brans-Dicke coupling is less than -1.5, the oscillation of the T vv component allows the apparent horizon to shrink. This allows a combination that violates weak cosmic censorship. Finally, we discuss the implications of the violation of the null energy condition and weak cosmic censorship.

  14. Responses of the Brans-Dicke field due to gravitational collapses

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Dong-il; Yeom, Dong-han, E-mail: enotsae@gmail.co, E-mail: innocent@muon.kaist.ac.k [Department of Physics, KAIST, Daejeon 305-701 (Korea, Republic of)

    2010-10-21

    We study responses of the Brans-Dicke field due to gravitational collapses of scalar field pulses using numerical simulations. Double-null formalism is employed to implement the numerical simulations. If we supply a scalar field pulse, it will asymptotically form a black hole via dynamical interactions of the Brans-Dicke field. Hence, we can observe the responses of the Brans-Dicke field by two different regions. First, we observe the late time behaviors after the gravitational collapse, which include formations of a singularity and an apparent horizon. Second, we observe the fully dynamical behaviors during the gravitational collapse and view the energy-momentum tensor components. For the late time behaviors, if the Brans-Dicke coupling is greater (or smaller) than -1.5, the Brans-Dicke field decreases (or increases) during the gravitational collapse. Since the Brans-Dicke field should be relaxed to the asymptotic value with the elapse of time, the final apparent horizon becomes time-like (or space-like). For the dynamical behaviors, we observed the energy-momentum tensors around {omega} {approx} -1.5. If the Brans-Dicke coupling is greater than -1.5, the T{sub uu} component can be negative at the outside of the black hole. This can allow an instantaneous inflating region during the gravitational collapse. If the Brans-Dicke coupling is less than -1.5, the oscillation of the T{sub vv} component allows the apparent horizon to shrink. This allows a combination that violates weak cosmic censorship. Finally, we discuss the implications of the violation of the null energy condition and weak cosmic censorship.

  15. Genetic Characterization of Bacillus anthracis 17 JB strain.

    Science.gov (United States)

    Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak

    2015-06-01

    Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.

  16. Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.

    Science.gov (United States)

    Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel

    2013-08-01

    The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.

  17. Analog quantum simulation of generalized Dicke models in trapped ions

    Science.gov (United States)

    Aedo, Ibai; Lamata, Lucas

    2018-04-01

    We propose the analog quantum simulation of generalized Dicke models in trapped ions. By combining bicromatic laser interactions on multiple ions we can generate all regimes of light-matter coupling in these models, where here the light mode is mimicked by a motional mode. We present numerical simulations of the three-qubit Dicke model both in the weak field (WF) regime, where the Jaynes-Cummings behavior arises, and the ultrastrong coupling (USC) regime, where a rotating-wave approximation cannot be considered. We also simulate the two-qubit biased Dicke model in the WF and USC regimes and the two-qubit anisotropic Dicke model in the USC regime and the deep-strong coupling regime. The agreement between the mathematical models and the ion system convinces us that these quantum simulations can be implemented in the laboratory with current or near-future technology. This formalism establishes an avenue for the quantum simulation of many-spin Dicke models in trapped ions.

  18. Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; San Román, L

    1998-02-01

    1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.

  19. JB-300: An advanced medium size transport for 2005

    Science.gov (United States)

    Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold

    1993-01-01

    In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.

  20. Dicke phase transition with multiple superradiant states in quantum chaotic resonators

    KAUST Repository

    Liu, C.; Di, Falco, A.; Fratalocchi, Andrea

    2014-01-01

    We experimentally investigate the Dicke phase transition in chaotic optical resonators realized with two-dimensional photonics crystals. This setup circumvents the constraints of the system originally investigated by Dicke and allows a detailed study of the various properties of the superradiant transition. Our experimental results, analytical prediction, and numerical modeling based on random-matrix theory demonstrate that the probability density P? of the resonance widths provides a new criterion to test the occurrence of the Dicke transition.

  1. Dicke phase transition with multiple superradiant states in quantum chaotic resonators

    KAUST Repository

    Liu, C.

    2014-06-12

    We experimentally investigate the Dicke phase transition in chaotic optical resonators realized with two-dimensional photonics crystals. This setup circumvents the constraints of the system originally investigated by Dicke and allows a detailed study of the various properties of the superradiant transition. Our experimental results, analytical prediction, and numerical modeling based on random-matrix theory demonstrate that the probability density P? of the resonance widths provides a new criterion to test the occurrence of the Dicke transition.

  2. Interacting ghost dark energy in Brans-Dicke theory

    International Nuclear Information System (INIS)

    Ebrahimi, Esmaeil; Sheykhi, Ahmad

    2011-01-01

    We investigate the QCD ghost model of dark energy in the framework of Brans-Dicke cosmology. First, we study the non-interacting ghost dark energy in a flat Brans-Dicke theory. In this case we obtain the equation of state and the deceleration parameters and a differential equation governing the evolution of ghost energy density. Interestingly enough, we find that the equation of state parameter of the non-interacting ghost dark energy can cross the phantom line (w D =-1) provided the parameters of the model are chosen suitably. Then, we generalize the study to the interacting ghost dark energy in both flat and non-flat Brans-Dicke framework and find out that the transition of w D to phantom regime can be more easily achieved for than when resort to the Einstein field equations is made.

  3. Motional frequency shifts of trapped ions in the Lamb-Dicke regime

    International Nuclear Information System (INIS)

    Lizuain, I.; Muga, J. G.; Eschner, J.

    2007-01-01

    First order Doppler effects are usually ignored in laser driven trapped ions when the recoil frequency is much smaller than the trapping frequency (Lamb-Dicke regime). This means that the central, carrier excitation band is supposed to be unaffected by vibronic transitions in which the vibrational number changes. While this is strictly true in the Lamb-Dicke limit (infinitely tight confinement), the vibronic transitions do play a role in the Lamb-Dicke regime. In this paper we quantify the asymptotic behavior of their effect with respect to the Lamb-Dicke parameter. In particular, we give analytical expressions for the frequency shift, 'pulling' or 'pushing', produced in the carrier absorption band by the vibronic transitions both for Rabi and Ramsey schemes. This shift is shown to be independent of the initial vibrational state

  4. Stability of Brans-Dicke thin-shell wormholes

    Energy Technology Data Exchange (ETDEWEB)

    Yue, Xiaojun, E-mail: yuexiaojun@mail.bnu.edu.cn [Department of Physics, Beijing Normal University, Beijing 100875 (China); Gao, Sijie, E-mail: sijie@bnu.edu.cn [Department of Physics, Beijing Normal University, Beijing 100875 (China)

    2011-06-06

    Recently, a class of spherically symmetric thin-shell wormholes in Brans-Dicke gravity have been introduced. Such wormholes can be supported by matter satisfying the weak energy condition (WEC). In this Letter, we first obtain all the exact solutions satisfying the WEC. Then we show these solutions can be stable for certain parameters. A general requirement for stability is that β{sup 2}>1, which may imply that the speed of sound exceeds the speed of light. -- Highlights: → Brans-Dicke thin-shell wormholes can be stable and satisfy the energy condition. → Solutions exist for ω<-2. → The speed of sound in the matter exceeds the speed of light.

  5. What We Talk around when We Talk about "The Dick"

    Science.gov (United States)

    Savage, Elizabeth

    2011-01-01

    Some years ago, the author had her first opportunity to teach an undergraduate American Romanticism course, which meant she had a chance to teach "Moby-Dick" the way she thought it should be taught. Meeting two days a week, her course was set up so that students read about thirty pages of "Moby-Dick" for one class meeting a week paired with…

  6. Obituary: Richard L. (Dick) Walker, Jr., 1938-2005

    Science.gov (United States)

    Pier, Jeffrey R.; Mason, Brian

    2005-12-01

    Dick Walker, 67, died 30 March 2005 in Flagstaff, AZ, following a long illness. He was born on 9 March 1938 in Hampton, Iowa and grew up in Waterloo, Iowa. As a child, Dick was fascinated with astronomy and built his own telescope. He saved his pennies and bought and read every book on the subject he could find. He also raised pigeons, naming four of them Hertzsprung, Hoyle, Gamow, and Kron. In 1957, the year Sputnik was launched, Dick began his college studies at the University of Northern Iowa in Cedar Falls. In 1959, he transferred to the State University of Iowa (subsequently renamed the University of Iowa) in Iowa City, where he earned a BA degree in astronomy and physics in 1963. He joined the staff of the U.S. Naval Observatory in Washington, DC, where he worked in the Time Service Division for a year before his assignment to the Astrometry and Astrophysics Division. Dick relocated to Flagstaff, AZ, in 1966 to continue his Naval Observatory service at the Flagstaff Station. His retirement in May 1999, ended a thirty-six-year career with USNO. Dick was first and foremost an observational astronomer. From the mid 1960s through the late 1970s, much of Dick's time was devoted to the measurement of binary stars, observing with the 12-inch and 26-inch refractors in Washington and later the 40-inch and 61-inch reflectors in Flagstaff. He also made many trips to Lick Observatory to work with the 36-inch Clark Refractor there. During this time he consulted with Charles Worley, who was observing on the 26-inch, to make sure time was well-spent examining doubles that could not be observed in Washington. This period of observing overlapped with the early years of speckle interferometry, and Dick's observations, made with the largest telescope used for micrometry at the time, were very important for ascertaining the veracity of this new technique. He was a studious and very careful observer of doubles and made over 8,000 measures, resulting in almost 3,000 mean positions

  7. Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.

    Science.gov (United States)

    Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K

    2010-09-01

    A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area

  8. JB-9322, a new selective histamine H2-receptor antagonist with potent gastric mucosal protective properties.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; Román, L S

    1995-05-01

    1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.

  9. Overview of the Moby Dick project

    NARCIS (Netherlands)

    Smit, Gerardus Johannes Maria; Havinga, Paul J.M.; Mullender, Sape J.; Helme, A.; Hartvigsen, Gunnar; Fallmyr, Terje; Stabell-Kulo, Tage; Bartoli, Alberto; Dini, Gianluca; Rizzo, Luigi; Avvenuti, Marco; Seppanen, T.

    The Moby Dick project focuses on developing theories, architectures and applications for a new generation of hand-held computers. The combination of an intelligent information system and a location system enables many new types of applications, such as admission control, digital chequebook, paging,

  10. Dicke-model simulation via cavity-assisted Raman transitions

    Science.gov (United States)

    Zhang, Zhiqiang; Lee, Chern Hui; Kumar, Ravi; Arnold, K. J.; Masson, Stuart J.; Grimsmo, A. L.; Parkins, A. S.; Barrett, M. D.

    2018-04-01

    The Dicke model is of fundamental importance in quantum mechanics for understanding the collective behavior of atoms coupled to a single electromagnetic mode. Here, we demonstrate a Dicke-model simulation via cavity-assisted Raman transitions in a configuration using counterpropagating laser beams. The observations indicate that motional effects should be included to fully account for the results. These results are contrary to experiments using single-beam and copropagating configurations. We give a theoretical description that accounts for the beam geometries used in the experiments and indicates the potential role of motional effects. In particular, a model is given that highlights the influence of Doppler broadening on the observed phase-transition thresholds.

  11. Holographic dark energy in Brans-Dicke cosmology with chameleon scalar field

    Energy Technology Data Exchange (ETDEWEB)

    Setare, M.R., E-mail: rezakord@ipm.i [Department of Science of Bijar, University of Kurdistan, Bijar (Iran, Islamic Republic of); Jamil, Mubasher, E-mail: mjamil@camp.edu.p [Center for Advanced Mathematics and Physics, National University of Sciences and Technology, Rawalpindi 46000 (Pakistan)

    2010-06-07

    We study a cosmological implication of holographic dark energy in the Brans-Dicke gravity. We employ the holographic model of dark energy to obtain the equation of state for the holographic energy density in non-flat (closed) universe enclosed by the event horizon measured from the sphere of horizon named L. Our analysis shows that one can obtain the phantom crossing scenario if the model parameter {alpha} (of order unity) is tuned accordingly. Moreover, this behavior is achieved by treating the Brans-Dicke scalar field as a Chameleon scalar field and taking a non-minimal coupling of the scalar field with matter. Hence one can generate phantom-like equation of state from a holographic dark energy model in non-flat universe in the Brans-Dicke cosmology framework.

  12. Holographic dark energy in Brans-Dicke cosmology with chameleon scalar field

    International Nuclear Information System (INIS)

    Setare, M.R.; Jamil, Mubasher

    2010-01-01

    We study a cosmological implication of holographic dark energy in the Brans-Dicke gravity. We employ the holographic model of dark energy to obtain the equation of state for the holographic energy density in non-flat (closed) universe enclosed by the event horizon measured from the sphere of horizon named L. Our analysis shows that one can obtain the phantom crossing scenario if the model parameter α (of order unity) is tuned accordingly. Moreover, this behavior is achieved by treating the Brans-Dicke scalar field as a Chameleon scalar field and taking a non-minimal coupling of the scalar field with matter. Hence one can generate phantom-like equation of state from a holographic dark energy model in non-flat universe in the Brans-Dicke cosmology framework.

  13. Obituary: Henry Emil Kandrup, 1955-2003

    Science.gov (United States)

    Merritt, David; Gottesman, Stephen T.

    2004-12-01

    Henry Emil Kandrup died on 18 October 2003 at his home in Gainesville Florida. Henry was a theoretical astrophysicist specializing in the application of chaotic dynamics to stellar systems. At the time of his death, Henry was a Professor at the University of Florida where he had taught for 13 years. Henry was born in Manhasset, New York on July 24, 1955 and spent most of his childhood in Great Neck. His parents, Jytte and Fred, were immigrants from Denmark where his father had worked as a silver smith. Henry was a precocious child, skipping both third and fifth grades. With the help of Sidney Spivack, a professor of sociology at Columbia University, his parents enrolled Henry in the Brooks Preparatory School in Andover, Massachusetts. After graduating at age 16, Henry enrolled at Cornell, transferring to Princeton the following year. Henry's parents adored their only child and worked hard to provide him with intellectual opportunities. Henry became an accomplished musician (organ, piano, French horn) and linguist (English, Danish, German) and was a passionate devotee of opera and ballet. Henry received his PhD in 1980 from the University of Chicago, where his thesis advisor was James Ipser. He taught at Oakland University in Michigan and Syracuse University in New York before coming to the University of Florida in 1990. Henry was sui generis. He shunned conventionality in his personal appearance and in his public demeanor, and always chose forthrightness and candor over polite silence. But to those of us who knew Henry well, his bluntness was a reflection of his intellectual consistency. Henry always said exactly what he thought, both in his published work and his public presentations, and never compromised himself for the sake of appearances. Nothing that he said or wrote was less than fully thought out. Henry's PhD thesis was entitled "Stochastic Problems in Stellar Dynamics," and most of his subsequent research was in this field. Motion in stellar systems can be

  14. Evolution of the Brans—Dicke Parameter in Generalized Chameleon Cosmology

    International Nuclear Information System (INIS)

    Jamil, Mubasher; Momeni, D.

    2011-01-01

    Motivated by an earlier study of Sahoo and Singh [Mod. Phys. Lett. A 17 (2002) 2409], we investigate the time dependence of the Brans-Dicke parameter ω(t) for an expanding Universe in the generalized Brans-Dicke Chameleon cosmology, and obtain an explicit dependence of ω(t) in different expansion phases of the Universe. Also, we discuss how the observed accelerated expansion of the observable Universe can be accommodated in the present formalism. (geophysics, astronomy, and astrophysics)

  15. Quantum tunneling in the adiabatic Dicke model

    International Nuclear Information System (INIS)

    Chen Gang; Chen Zidong; Liang Jiuqing

    2007-01-01

    The Dicke model describes N two-level atoms interacting with a single-mode bosonic field and exhibits a second-order phase transition from the normal to the superradiant phase. The energy levels are not degenerate in the normal phase but have degeneracy in the superradiant phase, where quantum tunneling occurs. By means of the Born-Oppenheimer approximation and the instanton method in quantum field theory, the tunneling splitting, inversely proportional to the tunneling rate for the adiabatic Dicke model, in the superradiant phase can be evaluated explicitly. It is shown that the tunneling splitting vanishes as exp(-N) for large N, whereas for small N it disappears as √(N)/exp(N). The dependence of the tunneling splitting on the relevant parameters, especially on the atom-field coupling strength, is also discussed

  16. Experimental violation of the local realism for four-qubit Dicke state.

    Science.gov (United States)

    Zhao, Yuan-Yuan; Wu, Yu-Chun; Xiang, Guo-Yong; Li, Chuan-Feng; Guo, Guang-Can

    2015-11-16

    Dicke state is an widely used type of multi-particle entangled state in quantum information. However, very few works have been done on its nonlocality. Here we prepare a four-photon symmetric Dicke state, whose fidelity is as high as 0.904 ± 0.004, and devise a simple Bell-type inequality to demonstrate that it violates the local realism with 12 standard deviation.

  17. Inflation and dark energy from the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Artymowski, Michał [Institute of Physics, Jagiellonian UniversityŁojasiewicza 11, 30-348 Kraków (Poland); Lalak, Zygmunt; Lewicki, Marek [Institute of Theoretical Physics, Faculty of Physics, University of Warsawul. Pasteura 5, 02-093 Warszawa (Poland)

    2015-06-17

    We consider the Brans-Dicke theory motivated by the f(R)=R+αR{sup n}−βR{sup 2−n} model to obtain a stable minimum of the Einstein frame scalar potential of the Brans-Dicke field. As a result we have obtained an inflationary scalar potential with non-zero value of residual vacuum energy, which may be a source of dark energy. In addition we discuss the probability of quantum tunnelling from the minimum of the potential. Our results can be easily consistent with PLANCK or BICEP2 data for appropriate choices of the value of n and ω.

  18. Antigravity in F( R) and Brans-Dicke theories

    Science.gov (United States)

    Oikonomou, V. K.; Karagiannakis, N.

    2014-12-01

    We study antigravity in F( R)-theory originating scalar-tensor theories and also in Brans-Dicke models without cosmological constant. For the F( R) theory case, we obtain the Jordan frame antigravity scalar-tensor theory by using a variant of the Lagrange multipliers method and we numerically study the time dependent effective gravitational constant. As we shall demonstrate in detail by using some viable F( R) models, although the initial F( R) models have no antigravity, their scalar-tensor counterpart theories might or not have antigravity, a fact mainly depending on the parameter that characterizes antigravity. Similar results hold true in the Brans-Dicke model, which we also studied numerically. In addition, regarding the Brans-Dicke model we also found some analytic cosmological solutions. Since antigravity is an unwanted feature in gravitational theories, our findings suggest that in the case of F( R) theories, antigravity does not occur in the real world described by the F( R) theory, but might occur in the Jordan frame scalar-tensor counterpart of the F( R) theory, and this happens under certain circumstances. The central goal of our study is to present all different cases in which antigravity might occur in modified gravity models.

  19. “Not a man from England”: assimilating the exotic ‘other’ through performance, from Henry IV to Henry VI

    OpenAIRE

    Penlington, A.

    2010-01-01

    This essay will consider recent shifts in performance representations of England and the exotic ‘other’ in Shakespeare’s Henry IV, Henry V and Henry VI plays. By tracing the texts’ varied representations of non-English Britons and those for whom English is not their mother tongue (such as Owen Glyndwr in 1 Henry IV and Princess Catherine in Henry V), recent criticism has identified that Shakespeare’s narrative portrays the challenges of assimilating ‘otherness’ within English culture. This es...

  20. Unified dark fluid in Brans-Dicke theory

    International Nuclear Information System (INIS)

    Tripathy, Sunil K.; Behera, Dipanjali; Mishra, Bivudutta

    2015-01-01

    Anisotropic dark energy cosmological models are constructed in the frame work of generalised Brans-Dicke theory with a self-interacting potential. A unified dark fluid characterised by a linear equation of state is considered as the source of dark energy. The shear scalar is considered to be proportional to the expansion scalar simulating an anisotropic relationship among the directional expansion rates. The dynamics of the universe in the presence of a unified dark fluid in anisotropic background have been discussed. The presence of an evolving scalar field makes it possible to get an accelerating phase of expansion even for a linear relationship among the directional Hubble rates. It is found that the anisotropy in expansion rates does not affect the scalar field, the self-interacting potential, but it controls the non-evolving part of the Brans-Dicke parameter. (orig.)

  1. Cometabolic Degradation of Dibenzofuran and Dibenzothiophene by a Naphthalene-Degrading Comamonas sp. JB.

    Science.gov (United States)

    Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan

    2017-12-01

    Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.

  2. Robert H Dicke – Physicist Extraordinaire

    Indian Academy of Sciences (India)

    Dicke started his college education at the University of Rochester intending to major in engineering. He credits Lee A ... War rumblings were growing louder and Professor DuBridge had left to establish the Radiation ... After the war, he returned to the Department of Physics at Princeton University. He spent the next decade ...

  3. Interacting holographic dark energy in Brans-Dicke theory

    International Nuclear Information System (INIS)

    Sheykhi, Ahmad

    2009-01-01

    We study cosmological application of interacting holographic energy density in the framework of Brans-Dicke cosmology. We obtain the equation of state and the deceleration parameter of the holographic dark energy in a non-flat universe. As system's IR cutoff we choose the radius of the event horizon measured on the sphere of the horizon, defined as L=ar(t). We find that the combination of Brans-Dicke field and holographic dark energy can accommodate w D =-1 crossing for the equation of state of noninteracting holographic dark energy. When an interaction between dark energy and dark matter is taken into account, the transition of w D to phantom regime can be more easily accounted for than when resort to the Einstein field equations is made.

  4. Remembering Dick Crane

    Science.gov (United States)

    Jossem, E. Leonard

    2007-09-01

    Physicist, polymath, educator, leader, Horace Richard Crane died on April 19, 2007, a few months short of his 100th birthday. Those of us who were fortunate enough to have had him as a friend mourn his loss, but for all of us he leaves a rich and varied legacy of published works that invite reading and rereading. Dick's work as a physicist was recognized in 1966 by his election to the National Academy of Sciences and in 1986 by the award of the President's National Medal of Science: "For the first measurement of the magnetic moment and spin of free electrons and positrons."

  5. Inflation and dark energy from the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Artymowski, Michał [Institute of Physics, Jagiellonian University Łojasiewicza 11, 30-348 Kraków (Poland); Lalak, Zygmunt; Lewicki, Marek, E-mail: Michal.Artymowski@uj.edu.pl, E-mail: Zygmunt.Lalak@fuw.edu.pl, E-mail: Marek.Lewicki@fuw.edu.pl [Institute of Theoretical Physics, Faculty of Physics, University of Warsaw ul. Pasteura 5, 02-093 Warszawa (Poland)

    2015-06-01

    We consider the Brans-Dicke theory motivated by the f(R) = R + α R{sup n} − β R{sup 2−n} model to obtain a stable minimum of the Einstein frame scalar potential of the Brans-Dicke field. As a result we have obtained an inflationary scalar potential with non-zero value of residual vacuum energy, which may be a source of dark energy. In addition we discuss the probability of quantum tunnelling from the minimum of the potential. Our results can be easily consistent with PLANCK or BICEP2 data for appropriate choices of the value of n and ω.

  6. Effect of accretion on primordial black holes in Brans-Dicke theory

    International Nuclear Information System (INIS)

    Nayak, B.; Singh, L. P.; Majumdar, A. S.

    2009-01-01

    We consider the effect of accretion of radiation in the early Universe on primordial black holes in Brans-Dicke theory. The rate of growth of a primordial black hole due to accretion of radiation in Brans-Dicke theory is considerably smaller than the rate of growth of the cosmological horizon, thus making available sufficient radiation density for the black hole to accrete causally. We show that accretion of radiation by Brans-Dicke black holes overrides the effect of Hawking evaporation during the radiation dominated era. The subsequent evaporation of the black holes in later eras is further modified due to the variable gravitational 'constant', and they could survive up to longer times compared to the case of standard cosmology. We estimate the impact of accretion on modification of the constraint on their initial mass fraction obtained from the γ-ray background limit from presently evaporating primordial black holes.

  7. New Brans-Dicke wormholes

    International Nuclear Information System (INIS)

    He Feng; Kim, Sung-Won

    2002-01-01

    Two new classes of exact solutions in vacuum Brans-Dicke theory are obtained, each of which is a two-way traversable wormhole for the coupling parameter ω<-2 or -2<ω≤0, respectively. Each of the two new classes of exact solutions satisfies not only the general constraints given by Morris and Thorne [Am. J. Phys. 56, 395 (1988)], as concluded earlier, but also the constraints from a trip through a wormhole. It also follows that the scalar field φ plays the role of exotic matter violating the weak energy condition

  8. Henry Gray's Anatomy.

    Science.gov (United States)

    Pearce, J M S

    2009-04-01

    Little is generally known of Henry Gray, the author of Gray's Anatomy, and even less of his colleague Henry Vandyke Carter, who played a vital role in the dissections and illustrations leading to the production of the first volume in 1859. This essay attempts to sketch briefly the salient, know aspects of these two men and their divergent careers. It traces succinctly the subsequent fate of the unique anatomy book that has influenced and instructed almost every student of medicine. (c) 2009 Wiley-Liss, Inc.

  9. Psychoactive bacteria Lactobacillus rhamnosus (JB-1) elicits rapid frequency facilitation in vagal afferents.

    Science.gov (United States)

    Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang

    2013-01-15

    Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.

  10. Dicke superradiance as nondestructive probe for the state of atoms in optical lattices

    Science.gov (United States)

    ten Brinke, Nicolai; Schützhold, Ralf

    2016-04-01

    We present a proposal for a probing scheme utilizing Dicke superradiance to obtain information about ultracold atoms in optical lattices. A probe photon is absorbed collectively by an ensemble of lattice atoms generating a Dicke state. The lattice dynamics (e.g., tunneling) affects the coherence properties of that Dicke state and thus alters the superradiant emission characteristics - which in turn provides insight into the lattice (dynamics). Comparing the Bose-Hubbard and the Fermi-Hubbard model, we find similar superradiance in the strongly interacting Mott insulator regime, but crucial differences in the weakly interacting (superfluid or metallic) phase. Furthermore, we study the possibility to detect whether a quantum phase transition between the two regimes can be considered adiabatic or a quantum quench.

  11. VoxHenry: FFT-Accelerated Inductance Extraction for Voxelized Geometries

    KAUST Repository

    Yucel, Abdulkadir C.; Georgakis, Ioannis P.; Polimeridis, Athanasios G.; Bagci, Hakan; White, Jacob K.

    2018-01-01

    inductance extractor, FastHenry. Just like FastHenry, VoxHenry solves a combination of the electric volume integral equation and the current continuity equation, but with three distinctions that make VoxHenry suitable and extremely efficient for analyzing

  12. γ parameter and Solar System constraint in chameleon-Brans-Dicke theory

    International Nuclear Information System (INIS)

    Saaidi, Kh.; Mohammadi, A.; Sheikhahmadi, H.

    2011-01-01

    The post Newtonian parameter is considered in the chameleon-Brans-Dicke model. In the first step, the general form of this parameter and also effective gravitational constant is obtained. An arbitrary function for f(Φ), which indicates the coupling between matter and scalar field, is introduced to investigate validity of solar system constraint. It is shown that the chameleon-Brans-Dicke model can satisfy the solar system constraint and gives us an ω parameter of order 10 4 , which is in comparable to the constraint which has been indicated in [19].

  13. VoxHenry: FFT-Accelerated Inductance Extraction for Voxelized Geometries

    KAUST Repository

    Yucel, Abdulkadir C.

    2018-01-18

    VoxHenry, a fast Fourier transform (FFT)-accelerated integral-equation-based simulator for extracting frequency-dependent inductances and resistances of structures discretized by voxels, is presented. VoxHenry shares many features with the popular inductance extractor, FastHenry. Just like FastHenry, VoxHenry solves a combination of the electric volume integral equation and the current continuity equation, but with three distinctions that make VoxHenry suitable and extremely efficient for analyzing voxelized geometries: 1) it leverages a carefully selected set of piecewise-constant and piecewise-linear basis functions; 2) it exploits FFTs to accelerate the matrix-vector multiplications during the iterative solution of system of equations; and 3) it employs a sparse preconditioner to ensure the rapid convergence of iterative solution. VoxHenry is capable of accurately computing frequency-dependent inductances and resistances of arbitrarily shaped and large-scale structures on a desktop computer. The accuracy, efficiency, and applicability of VoxHenry are demonstrated through inductance analysis of various structures, including square and circular coils as well as arrays of RF inductors (situated over ground planes).

  14. Henri Poincaré: Death centenary (1854-1912)

    Science.gov (United States)

    Heinzmann, Gerhard; Villani, Cédric

    2014-08-01

    The year 2012 marked the centenary of the death of Henri Poincaré (Nancy, 1854-Paris, 1912), and through the agency of the Henri-Poincaré Institute in Paris, the Henri-Poincaré Archives in Nancy and The London Mathematical Society, brought with it several exhibitions and meetings commemorating one of the greatest minds in contemporary times. Often referred to as the last polymath, Poincaré embraced multiple branches of mathematics, theoretical physics and celestial mechanics, and made significant contributions to philosophy of science (Heinzmann & Stump, Henri Poincaré, 2013). He wrote 25 textbooks and monographs, 500-plus articles, and was deeply involved in the organization and administration of science at both the national and international levels.1

  15. Henry VIII, McLeod syndrome and Jacquetta's curse.

    Science.gov (United States)

    Stride, P; Lopes Floro, K

    2013-01-01

    The mental decline of King Henry VIII from being a jovial, charismatic and athletic young man into an increasingly paranoid, brutal tyrant in later life, ever more concerned at his lack of one or more male heirs, has attracted many medical diagnostic theories. Previous hypotheses have included diabetes, syphilis and hypothyroidism, among others. However, these inadequately explain Henry's failure to produce a male heir, despite multiple pairings. The latest postulated diagnoses for Henry are the coexistence of both Kell blood group antigenicity (possibly inherited from Jacquetta Woodville, Henry's maternal great grandmother) causing related impaired fertility, and McLeod syndrome, causing psychotic changes. As the mutated McLeod protein of the syndrome significantly reduces the expression, effectively inactivating the Kell antigen, we critically review this theory, examining in detail the pathophysiology of these conditions and assessing the genealogy of Henry VIII and its effect in subsequent generations.

  16. Non-static local string in Brans–Dicke theory

    Indian Academy of Sciences (India)

    Abstract. A recent investigation showed that a local gauge string with a phenomenological energy momentum tensor, as prescribed by Vilenkin, is inconsistent in Brans–Dicke theory. In this work it has been shown that such a string is indeed consistent if one introduces time dependences in the metric. A set of solutions of full ...

  17. A Quintessence Problem in Self-interacting Brans-Dicke Theory

    OpenAIRE

    Chakraborty, Subenoy; Chakraborty, N. C.; Debnath, Ujjal

    2003-01-01

    A quintessence scalar field in self-interacting Brans-Dicke theory is shown to give rise to a non-decelerated expansion of the present universe for open, flat and closed models. Along with providing a non-decelerating solution, it can potentially solve the flatness problem too.

  18. HENRY'S "HAND OF GOD"

    Directory of Open Access Journals (Sweden)

    Željko Kaluđerović

    2014-04-01

    Full Text Available In this paper the author discusses the views and statements of the French football player Thierry Henry he gave after his illegal play during the playoff match between France and the Republic of Ireland to claim one of the final spots in the World Cup 2010 in South Africa. First, by controlling the ball with his hand before passing it on for the goal Henry has shown disregard for the constitutive rules of football. Then, by stating that he is "not a referee" he demonstrated that for some players rules are not inherent to football and that they can be relativized, given that for them winning is the goal of the highest ontological status. Furthermore, he has rejected the rules of sportsmanship, thus expressing his opinion that the opponents are just obstacles which have to be removed in order to achieve your goals. Henry's action has disrupted major moral values, such as justice, honesty, responsibility and beneficence. The rules of fair play have totally been ignored both in Henry's action and in the Football Association of France's unwillingness to comment on whether a replay should take place. They have ignored one of the basic principles stated in the "Declaration of the International Fair Play Committee", according to which, fair play is much more than playing to the rules of the game; it's about the attitude of the sportsperson. It's about respecting your opponent and preserving his or her physical and psychological integrity. Finally, the author believes that the rules, moral values and fair play in football are required for this game to become actually possible to play

  19. HENRY'S "HAND OF GOD"

    Directory of Open Access Journals (Sweden)

    Željko Kaluđerović

    2014-04-01

    Full Text Available In this paper the author discusses the views and statements of the French football player Thierry Henry he gave after his illegal play during the playoff match between France and the Republic of Ireland to claim one of the final spots in the World Cup 2010 in South Africa. First, by controlling the ball with his hand before passing it on for the goal Henry has shown disregard for the constitutive rules of football. Then, by stating that he is "not a referee" he demonstrated that for some players rules are not inherent to football and that they can be relativized, given that for them winning is the goal of the highest ontological status. Furthermore, he has rejected the rules of sportsmanship, thus expressing his opinion that the opponents are just obstacles which have to be removed in order to achieve your goals. Henry's action has disrupted major moral values, such as justice, honesty, responsibility and beneficence. The rules of fair play have totally been ignored both in Henry's action and in the Football Association of France's unwillingness to comment on whether a replay should take place. They have ignored one of the basic principles stated in the "Declaration of the International Fair Play Committee", according to which, fair play is much more than playing to the rules of the game; it's about the attitude of the sportsperson. It's about respecting your opponent and preserving his or her physical and psychological integrity. Finally, the author believes that the rules, moral values and fair play in football are required for this game to become actually possible to play.

  20. Isolation of Burkholderia cepacia JB12 from lead- and cadmium-contaminated soil and its potential in promoting phytoremediation with tall fescue and red clover.

    Science.gov (United States)

    Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang

    2013-07-01

    Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.

  1. Interview with Marcel Dicke: the Droste effect in science

    NARCIS (Netherlands)

    Dicke, M.

    2015-01-01

    Marcel Dicke grew up at the outskirts of Rotterdam, The Netherlands. He enjoyed strolling through the meadows and jumping over ditches to observe animals and plants. He was interested in life in general and his interest in biology, and especially ecology, was aroused by his inspiring high school

  2. Joseph Henry's Conception of Scientific Knowledge

    Science.gov (United States)

    Theerman, Paul

    1997-04-01

    Joseph Henry, America's premier physicist and physics teacher in the mid-nineteenth century, had decided views of scientific knowledge. These were expressed in two ways. First of all, scientific knowledge led to moral betterment. Thus the study of science was a morally good thing. This was not only because it led to the contemplation of God's creation, which was a standard reason justifying the study of science dating from the Scientific Revolution and even earlier. More importantly, the study of science itself was a moral discipline, imparting to scientists the habits and virtues of truthfulness, respect for others, care and diligence, and the discernment of meaningful patterns from experience. The moral ideals of science were expressed most strongly in Henry's upholding the international "Republic of Science"; conversely, cheapening science was a sign of moral failure. Second, for Henry and his generation, science provided a path to sure truth, separate from falsehood of both the politics and the quackery that characterized mid-century public life. Henry promoted this in his championing of the Smithsonian Institution a scientific establishment, against the ideas of others who wanted to make it a literary establishment or a training school for teachers. For Henry, the Smithsonian's scientific reputation would be established by relying on careful peer review in its publications, and supporting established scientists to write authoritative popular works. The purpose of both these activities was to raise the profile of science in the United States and further establish science and the scientific method as a guide to public life.

  3. Possible observational manifestations of wormholes in the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Alexeyev, S. O., E-mail: alexeyev@sai.msu.ru; Rannu, K. A., E-mail: rannu@xray.sai.msu.ru [Sternberg Astronomical Institute (Russian Federation); Gareeva, D. V., E-mail: 4elesta@mail.ru [Moscow State University (Russian Federation)

    2011-10-15

    The energy flux emitted during the accretion of matter onto a wormhole in the Brans-Dicke theory has been calculated. This characteristic is compared with its values calculated previously for wormholes in general relativity and for a Schwarzschild black hole.

  4. Minimizing energy consumption for wireless computers in Moby Dick

    NARCIS (Netherlands)

    Havinga, Paul J.M.; Smit, Gerardus Johannes Maria

    1997-01-01

    The Moby Dick project is a joint European project to develop and define the architecture of a new generation of mobile hand-held computers, called Pocket Companions. The Pocket Companion is a hand-held device that is resource-poor, i.e. small amount of memory, limited battery life, low processing

  5. Vanglateenistuse enesekaitsekoolitus / Henri Palm

    Index Scriptorium Estoniae

    Palm, Henri

    2014-01-01

    Vanglateenistus korraldab Tartus, Tallinnas ja Jõhvis enesekaitsekoolitusi gümnaasiumiõpilastele. Jakob Westholmi abiturient Henri Palm on osalenud treeningutel osalenud kolm aastat ning jagab kogemusi

  6. Kolmanda maailma raudteekunn / Henry Posner ; interv. Krister Kivi

    Index Scriptorium Estoniae

    Posner, Henry

    2005-01-01

    Raudteeärimees Henry Posner III, kes kuulub ka Eesti Raudtee omanikeringi, oma äritegevusest, sealhulgas investeeringutest Eestisse. Suhtumisest raudteeturu avamisse. Lisa: Henry Posner mängib rongidega maailma hämarates nurkades

  7. Comparison of the insulin reaction of peripheral blood T cells between healthy Holstein dairy cows and JB during the periparturient period.

    Science.gov (United States)

    Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi

    2006-11-01

    To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.

  8. Interview with Henry Jenkins

    OpenAIRE

    TWC Editor

    2008-01-01

    An interview with Henry Jenkins focussing on Transformative Works and Cultures (TWC), the Organization for Transformative Works (OTW), and Jenkins' academic research into fan and participatory cultures.

  9. Brans-Dicke Theory with Λ>0: Black Holes and Large Scale Structures.

    Science.gov (United States)

    Bhattacharya, Sourav; Dialektopoulos, Konstantinos F; Romano, Antonio Enea; Tomaras, Theodore N

    2015-10-30

    A step-by-step approach is followed to study cosmic structures in the context of Brans-Dicke theory with positive cosmological constant Λ and parameter ω. First, it is shown that regular stationary black-hole solutions not only have constant Brans-Dicke field ϕ, but can exist only for ω=∞, which forces the theory to coincide with the general relativity. Generalizations of the theory in order to evade this black-hole no-hair theorem are presented. It is also shown that in the absence of a stationary cosmological event horizon in the asymptotic region, a stationary black-hole horizon can support a nontrivial Brans-Dicke hair. Even more importantly, it is shown next that the presence of a stationary cosmological event horizon rules out any regular stationary solution, appropriate for the description of a star. Thus, to describe a star one has to assume that there is no such stationary horizon in the faraway asymptotic region. Under this implicit assumption generic spherical cosmic structures are studied perturbatively and it is shown that only for ω>0 or ω≲-5 their predicted maximum sizes are consistent with observations. We also point out how, many of the conclusions of this work differ qualitatively from the Λ=0 spacetimes.

  10. Transactions en eaux troubles : résurgences de la voix shakespearienne dans Moby-Dick Defamiliarising the Bard: The Resurgence of Shakespeare in Moby-Dick

    Directory of Open Access Journals (Sweden)

    Ronan Ludot-Vlasak

    2009-06-01

    Full Text Available This article explores the way Herman Melville appropriates William Shakespeare’s work in Moby-Dick. Its argument is that by defamiliarising some of Shakespeare’s lines—a corpus that was both alien and familiar to nineteenth-century writers— Melville turns them into his own idiom. This resurgence of the Shakespearean voice is double: although the dramatic element in the novel is often associated with the figure of Ahab, Ishmael also incorporates Shakespearean lines into his narrative. What characterises these (intertextual transactions is that instead of quoting directly from Shakespeare’s plays, Melville often blurs references in order to appropriate the works of his predecessor. More than the mere imitation of a model, this complex process reveals Shakespeare’s seminal role in Moby-Dick as well as Melville’s poetics of reinvention. Ultimately, it enables the author to explore the dark forces lying beneath the surface of things.

  11. Brans-Dicke theory in general space-time with torsion

    International Nuclear Information System (INIS)

    Kim, S.

    1986-01-01

    The Brans-Dicke theory in the general space-time endowed with torsion is investigated. Since the gradient of the scalar field as well as the intrinsic spin generate the torsion field, the interaction term of the spin-scalar field appears in the wave equation. The equations of motion are satisfied with the conservation laws

  12. Interview with Henry Jenkins

    Directory of Open Access Journals (Sweden)

    TWC Editor

    2008-09-01

    Full Text Available An interview with Henry Jenkins focussing on Transformative Works and Cultures (TWC, the Organization for Transformative Works (OTW, and Jenkins' academic research into fan and participatory cultures.

  13. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells

    Directory of Open Access Journals (Sweden)

    Saikali Melody

    2012-07-01

    Full Text Available Abstract Background Sesquiterpene lactones (SL are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan isolated from Achillea falcata and salograviolide A (Sal A isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. Methods The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. Results β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. Conclusions These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to

  14. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells.

    Science.gov (United States)

    Saikali, Melody; Ghantous, Akram; Halawi, Racha; Talhouk, Salma N; Saliba, Najat A; Darwiche, Nadine

    2012-07-09

    Sesquiterpene lactones (SL) are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan) isolated from Achillea falcata and salograviolide A (Sal A) isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to the Middle East may provide opportunities for complementary

  15. Dicke coherent narrowing in two-photon and Raman spectroscopy of thin vapor cells

    International Nuclear Information System (INIS)

    Dutier, Gabriel; Todorov, Petko; Hamdi, Ismahene; Maurin, Isabelle; Saltiel, Solomon; Bloch, Daniel; Ducloy, Martial

    2005-01-01

    The principle of coherent Dicke narrowing in a thin vapor cell, in which sub-Doppler spectral line shapes are observed under a normal irradiation for a λ/2 thickness, is generalized to two-photon spectroscopy. Only the sum of the two wave vectors must be normal to the cell, making the two-photon scheme highly versatile. A comparison is provided between the Dicke narrowing with copropagating fields, and the residual Doppler broadening occurring with counterpropagating geometries. The experimental feasibility is discussed on the basis of a first observation of a two-photon resonance in a 300-nm-thick Cs cell. Extension to the Raman situation is finally considered

  16. Henry David Thoreau's Spiritual World

    Institute of Scientific and Technical Information of China (English)

    马云

    2013-01-01

    Henry David Thoreau was wholeheartedly in love with nature and he devoted almost all his life time to observation, appreciation and study of nature. Thus he formed a deep understanding of nature. In 1845, Thoreau began a two-year and two-month residence at Walden Pond. His life was lonely but full of fragrance. He wanted to live meaningfully, confront the essential facts of life and live a simple life. Based on the review of the literature related to this topic, this paper aims to study Henry David Thoreau’s spiritual world, especially reflected in his famous book-Walden.

  17. Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.

    Science.gov (United States)

    Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E

    1999-01-20

    JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999

  18. Brans-Dicke inflation in light of the Planck 2015 data

    International Nuclear Information System (INIS)

    Tahmasebzadeh, B.; Rezazadeh, K.; Karami, K.

    2016-01-01

    We study inflation in the Brans-Dicke gravity as a special model of the scalar-tensor gravity. We obtain the inflationary observables containing the scalar spectral index, the tensor-to-scalar ratio, the running of the scalar spectral index and the equilateral non-Gaussianity parameter in terms of the general form of the potential in the Jordan frame. Then, we compare the results for various inflationary potentials in light of the Planck 2015 data. Our study shows that in the Brans-Dicke gravity, the power-law, inverse power-law and exponential potentials are ruled out by the Planck 2015 data. But, the hilltop, Higgs, Coleman-Weinberg and natural potentials can be compatible with Planck 2015 TT,TE,EE+lowP data at 95% CL. Moreover, the D-brane, SB SUSY and displaced quadratic potentials can be in well agreement with the observational data since their results can lie inside the 68% CL region of Planck 2015 TT,TE,EE+lowP data.

  19. Brans-Dicke inflation in light of the Planck 2015 data

    Energy Technology Data Exchange (ETDEWEB)

    Tahmasebzadeh, B. [Department of Physics, Institute for Advanced Studies in Basic Sciences (IASBS), P.O. Box 45195-1159, Zanjan (Iran, Islamic Republic of); Rezazadeh, K.; Karami, K., E-mail: b.tahmasebzadeh@iasbs.ac.ir, E-mail: rezazadeh86@gmail.com, E-mail: kkarami@uok.ac.ir [Department of Physics, University of Kurdistan, Pasdaran St., P.O. Box 66177-15175, Sanandaj (Iran, Islamic Republic of)

    2016-07-01

    We study inflation in the Brans-Dicke gravity as a special model of the scalar-tensor gravity. We obtain the inflationary observables containing the scalar spectral index, the tensor-to-scalar ratio, the running of the scalar spectral index and the equilateral non-Gaussianity parameter in terms of the general form of the potential in the Jordan frame. Then, we compare the results for various inflationary potentials in light of the Planck 2015 data. Our study shows that in the Brans-Dicke gravity, the power-law, inverse power-law and exponential potentials are ruled out by the Planck 2015 data. But, the hilltop, Higgs, Coleman-Weinberg and natural potentials can be compatible with Planck 2015 TT,TE,EE+lowP data at 95% CL. Moreover, the D-brane, SB SUSY and displaced quadratic potentials can be in well agreement with the observational data since their results can lie inside the 68% CL region of Planck 2015 TT,TE,EE+lowP data.

  20. Effect of a Brans--Dicke cosmology upon stellar evolution and the evolution of galaxies

    International Nuclear Information System (INIS)

    Prather, M.J.

    1976-01-01

    The effect which a variable G cosmology, such as Brans-Dicke, will have on the evolution of individual stars and of galaxies composed of these stars is examined in the hope that present day observation of globular clusters or giant elliptical galaxies will provide a test for the Brans--Dicke theory. The higher value of the gravitational coupling coefficient G in the past history of various Brans--Dicke universes is studied in detail. A low density, open universe is selected for study: fractional closure density = 0.2, present Hubble constant = km/s/Mpc, stellar formation at a red-shift of 5, and the Brans--Dicke parameter omega = 6. In this universe a set of stellar evolutionary tracks is computed from the Zero-Age Main Sequence through the Giant Branch to the Horizontal Branch for approximately solar composition, (Y,Z) = (0.25, 0.02). When compared at equivalent evolutionary phases, the luminosity of individual stars is found to increase greatly with G from the ZAMS to the HB. The higher G greatly speeds up the evolutionary time scale for the main sequence, and it decreases the core mass at the helium flash, leaving the luminosity of the tip of the GB and the HB unchanged. The net effect of a higher G on a cluster of stars is to increase the apparent mass at the turn-off and to reduce the lifetimes of all the evolutionary phases from the ZAMS to the HB by the same factor. Thus, the relative number density of stars in the major phases of stellar evolution is unchanged

  1. Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.

    Science.gov (United States)

    Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D

    2011-01-01

    Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.

  2. Nudging van rijsnelheid via Dick Brunaborden : een veldexperiment : de effecten op werkelijk gereden snelheden in vijf gemeenten onderzocht. In opdracht van Metropoolregio Rotterdam Den Haag.

    NARCIS (Netherlands)

    Goldenbeld, C. Groot-Mesken, J. de & Temürhan, M.

    2017-01-01

    Nudging driving speed using Dick Bruna traffic signs: a field experiment; Study of the actual speeds driven in five municipalities in the Netherlands. This report presents the results of a study into the effect of Dick Bruna (Dick Bruna is a Dutch author, illustrator and graphic designer known for

  3. A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.

    Science.gov (United States)

    Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian

    2016-05-01

    Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.

  4. Henry Ford Health Systems

    Science.gov (United States)

    Henry Ford Health Systems evolved from a hospital into a system delivering care to 2.5 million patients and includes the Cancer Epidemiology, Prevention and Control Program, which focuses on epidemiologic and public health aspects of cancer.

  5. On the action of the complete Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Kofinas, Georgios [University of the Aegean, Research Group of Geometry, Dynamical Systems and Cosmology, Department of Information and Communication Systems Engineering, Karlovassi, Samos (Greece); Tsoukalas, Minas [Bogazici University, Physics Department, Istanbul (Turkey); National Technical University of Athens, Physics Division, Athens (Greece)

    2016-12-15

    Recently the most general completion of Brans-Dicke theory has appeared with energy exchanged between the scalar field and ordinary matter, given that the equation of motion for the scalar field keeps the simple wave form of Brans-Dicke. This class of theories contain undetermined functions, but there exist only three theories which are unambiguously determined from consistency. Here, for the first such theory, the action of the vacuum theory is found, which arises as the limit of the full matter theory. A symmetry transformation of this vacuum action in the Jordan frame is found which consists of a conformal transformation of the metric together with a redefinition of the scalar field. Since the general family of vacuum theories is parametrized by an arbitrary function of the scalar field, the action of this family is also found. As for the full theory with matter the action of the system is only found when the matter Lagrangian vanishes on-shell, as for example for pressureless dust. Due to the interaction, the matter Lagrangian is non-minimally coupled either in the Jordan or the Einstein frame. (orig.)

  6. On the action of the complete Brans-Dicke theory

    International Nuclear Information System (INIS)

    Kofinas, Georgios; Tsoukalas, Minas

    2016-01-01

    Recently the most general completion of Brans-Dicke theory has appeared with energy exchanged between the scalar field and ordinary matter, given that the equation of motion for the scalar field keeps the simple wave form of Brans-Dicke. This class of theories contain undetermined functions, but there exist only three theories which are unambiguously determined from consistency. Here, for the first such theory, the action of the vacuum theory is found, which arises as the limit of the full matter theory. A symmetry transformation of this vacuum action in the Jordan frame is found which consists of a conformal transformation of the metric together with a redefinition of the scalar field. Since the general family of vacuum theories is parametrized by an arbitrary function of the scalar field, the action of this family is also found. As for the full theory with matter the action of the system is only found when the matter Lagrangian vanishes on-shell, as for example for pressureless dust. Due to the interaction, the matter Lagrangian is non-minimally coupled either in the Jordan or the Einstein frame. (orig.)

  7. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Directory of Open Access Journals (Sweden)

    Patrycja Konieczna

    Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  8. Human Dendritic Cell DC-SIGN and TLR-2 Mediate Complementary Immune Regulatory Activities in Response to Lactobacillus rhamnosus JB-1

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O’Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses. PMID:25816321

  9. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  10. The cosmological term and a modified Brans-Dicke cosmology

    International Nuclear Information System (INIS)

    Endo, M.; Fukui, T.

    1977-01-01

    Adding the cosmological term Λ, which is assumed to be variable in this paper, to the Brans-Dicke Lagrangian, an attempt is made to understand the meaning of the term and to relate it to the mass of the universe. The Dirac large-number hypothesis is considered, applying the results obtained from the application of the present theory to a uniform cosmological model. (author)

  11. First-Order Quantum Phase Transition for Dicke Model Induced by Atom-Atom Interaction

    International Nuclear Information System (INIS)

    Zhao Xiu-Qin; Liu Ni; Liang Jiu-Qing

    2017-01-01

    In this article, we use the spin coherent state transformation and the ground state variational method to theoretically calculate the ground function. In order to consider the influence of the atom-atom interaction on the extended Dicke model’s ground state properties, the mean photon number, the scaled atomic population and the average ground energy are displayed. Using the self-consistent field theory to solve the atom-atom interaction, we discover the system undergoes a first-order quantum phase transition from the normal phase to the superradiant phase, but a famous Dicke-type second-order quantum phase transition without the atom-atom interaction. Meanwhile, the atom-atom interaction makes the phase transition point shift to the lower atom-photon collective coupling strength. (paper)

  12. Negotiating Transcendentalism, Escaping « Paradise » : Herman Melville’s Moby-Dick.

    Directory of Open Access Journals (Sweden)

    Ramón Espejo Romero

    2010-06-01

    Full Text Available By reviewing the critical literature on Melville and Transcendentalism and then undertaking a close reading of Moby-Dick (1851, this paper argues that the novel reflects, among other things, an ongoing debate between the novelist and Transcendentalist philosophy. While in later works, Melville seems to express a more robust condemnation of the Concord movement and its dangerous idealism, Moby-Dick occupies less firmly-defined territory. The Transcendentalist urge of an Ahab to be himself is a counterpoint to Ishmael’s more idiosyncratic deployment of self-reliance, communion with the oversoul, and various other concepts easy to trace back to Emerson or Thoreau. The conclusion seems to be that a negotiation is necessary if Transcendentalism is to be heeded at all, precisely the kind of negotiation Ishmael undertakes throughout the novel, one which spares him from the maelstrom created by a more radical approach to self-acceptance and self-fashioning.

  13. Spectroscopy of Atomic Vapors in Nanometer Cells: Dicke Narrowing and Beyond

    International Nuclear Information System (INIS)

    Vartanyan, T A; Khromov, V V

    2012-01-01

    Sub-Doppler spectroscopy of gaseous media confined in thin pillbox-shaped cells was pioneered by R.H. Dicke. In the past, this idea attracted much less attention compared to 'Dicke narrowing' in buffer gas where the atoms or molecules perform a diffusive motion instead of being bounced back and forth between the walls of the cell in a completely predetermined nature. The situation is going to be changed as atomic spectroscopy becoming an essential part of mobile devices for civil and military applications that require tiny spectroscopic cells. In the pillbox shaped cells, the role of the fast moving atoms is diminished, while the slowly moving atoms contribute most to the absorption as well as to the fluorescence. The role of the slowly moving atoms and their transient polarization in selective reflection spectroscopy was highlighted by J.L. Cojan. By merging these two approaches we have developed a theoretical description of optical reflection from and transmission through the narrow slice of atomic vapours.

  14. Parameterized post-Newtonian coefficients for Brans-Dicke gravity with d + 1 dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Klimek, Matthew D, E-mail: klimek@physics.rutgers.ed [Department of Physics and Astronomy, Rutgers University, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States)

    2009-03-21

    We present calculations of post-Newtonian parameters for Brans-Dicke tensor-scalar gravity in an arbitrary number of compact extra dimensions in both the Jordan and Einstein conformal frames. We find that the parameter gamma, which measures the amount of spacetime curvature per unit mass, becomes a function of omega, the coefficient of the scalar kinetic term in the Brans-Dicke Lagrangian. Experiment has placed strong constraints on gamma which require that omega becomes negative in the Jordan frame for any number of extra dimensions, highlighting that this formulation is not physical. We also confirm the well-known result that a compact extra dimension can be equivalently viewed as a massless scalar 'dilaton.' In the Einstein frame, we find that the behavior of gamma as constrained by experiment replicates that which is predicted by string theory.

  15. Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving

    Science.gov (United States)

    Yu, Xin; Huang, Kuibang; Zheng, Miao

    2016-06-01

    A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.

  16. Biosorption of cationic basic dye and cadmium by the novel biosorbent Bacillus catenulatus JB-022 strain.

    Science.gov (United States)

    Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol

    2015-04-01

    Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  17. Charles Dick: Agricultural Regulation in Santa Cruz, 1930- 1967

    OpenAIRE

    Regional History Project, UCSC Library; Dick, Charles; Jarrell, Randall

    1997-01-01

    This is the oral history of the late county agricultural commissioner, who traces the history of California's unique system of agricultural regulation and inspection, which dates from the 1880s. Dick's overview of county agriculture includes the increasing importance of pesticide regulation (which is currently a very debated issue in the strawberry industry); mechanization, changes in local crops and acreages, farm labor and unionization, and the demise of the family farm.

  18. Optimized entanglement witnesses for Dicke states

    Energy Technology Data Exchange (ETDEWEB)

    Bergmann, Marcel; Guehne, Otfried [Naturwissenschaftlich-Technische Fakultaet, Universitaet Siegen, Department Physik, Walter-Flex-Strasse 3, D-57068 Siegen (Germany)

    2013-07-01

    Quantum entanglement is an important resource for applications in quantum information processing like quantum teleportation and cryptography. Moreover, the number of particles that can be entangled experimentally using polarized photons or ion traps has been significantly enlarged. Therefore, criteria to decide the question whether a given multi-particle state is entangled or not have to be improved. Our approach to this problem uses the notion of PPT mixtures which form an approximation to the set of bi-separable states. With this method, entanglement witnesses can be obtained in a natural manner via linear semi-definite programming. In our contribution, we will present analytical results for entanglement witnesses for Dicke states. This allows to overcome the limitations of convex optimization.

  19. Einstein metrics and Brans-Dicke superfields

    International Nuclear Information System (INIS)

    Marques, S.

    1988-01-01

    It is obtained here a space conformal to the Einstein space-time, making the transition from an internal bosonic space, constructed with the Majorana constant spinors in the Majorana representation, to a bosonic ''superspace,'' through the use of Einstein vierbeins. These spaces are related to a Grassmann space constructed with the Majorana spinors referred to above, where the ''metric'' is a function of internal bosonic coordinates. The conformal function is a scale factor in the zone of gravitational radiation. A conformal function dependent on space-time coordinates can be constructed in that region when we introduce Majorana spinors which are functions of those coordinates. With this we obtain a scalar field of Brans-Dicke type. 11 refs

  20. Biodegradation of Benzene, Toluene, Ethylbenzene, and o-, m-, and p-Xylenes by the Newly Isolated Bacterium Comamonas sp. JB.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan

    2015-07-01

    A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.

  1. An extended geometric criterion for chaos in the Dicke model

    International Nuclear Information System (INIS)

    Li Jiangdan; Zhang Suying

    2010-01-01

    We extend HBLSL's (Horwitz, Ben Zion, Lewkowicz, Schiffer and Levitan) new Riemannian geometric criterion for chaotic motion to Hamiltonian systems of weak coupling of potential and momenta by defining the 'mean unstable ratio'. We discuss the Dicke model of an unstable Hamiltonian system in detail and show that our results are in good agreement with that of the computation of Lyapunov characteristic exponents.

  2. Reference Ranges & What They Mean

    Science.gov (United States)

    ... htm. Accessed August 2015. Sources Used in Previous Reviews Books: Clinical Diagnosis and Management by Laboratory Methods. 20th ed. Henry JB, ed. New York: Saunders: 2001. Laboratory Medicine: Test Selection and Interpretation. ...

  3. Straight spinning cosmic strings in Brans-Dicke gravity

    Science.gov (United States)

    Dos Santos, S. Mittmann; da Silva, J. M. Hoff; Cindra, J. L.

    2018-03-01

    An exact solution of straight spinning cosmic strings in Brans-Dicke theory of gravitation is presented. The possibility of the existence of closed time-like curves around these cosmic strings is analyzed. Furthermore, the stability about the formation of the topological defect discussed here is checked. It is shown that the existence of a suitable choice for the integration constants in which closed time-like curves are not allowed. We also study the (im)possibility of using the obtained spacetime in the rotational curves problem.

  4. Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1

    Science.gov (United States)

    We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....

  5. [Hypospadia and infertility of Henry II of France (1519-1559)].

    Science.gov (United States)

    Hatzinger, M; Al-Shajlawi, S; Sohn, M

    2014-03-01

    Henry II (1519-1559) of France was the second son of Francis I (1494-1547) and Claude de France (1498-1524) born in 1519 in St. Germain-en-Laye. After his older brother's and his father's death in 1547, he was anointed the French king in Reims. In 1533 already, as a 14-year-old boy, for reasons of state, he was married to the same aged Catherine de Medici (1519-1589), as her uncle was Pope Clement VII (1478-1534). The marriage remained childless for 11 years since Henry, due to a distinct hypospadia and a completely sexually inexperienced wife was unable to conceive children with her. His existing liaison to Diane de Poitiers (1499-1566) - a 19-year-older maid of honor of his father Francis I from 1537 until his death - influenced his sexual life immensely.The blame for the childless marriage was placed primarily on his wife, as Henry had become father of an illegitimate daughter with a mistress. Catherine then underwent all possible medical and alchemical procedures to finally give birth to the hoped Dauphin. Ironically, her rival for the favor of her husband, Diane de Poitiers was one of her greatest allies. She made clear that the cause lay with Henry and not with his wife. This was confirmed by the added solid physician Jean Fernel (1497-1558). His treatment of Henry and the simultaneous training of the unexperienced Catherine by Diane de Poitiers led to success.The result was the birth of Francis II (1544-1560) in 1544, the first of 10 children in 12 years. Thus, the dynasty was saved. After the death of Henry in a tragic tournament accident in 1559, three of his sons became kings of France. But the line of Valois remained without further descendants and was continued by Henry IV, the first Bourbon king in 1589.

  6. Plane symmetric cosmological model with thick domain walls in Brans-Dicke theory of gravitation

    International Nuclear Information System (INIS)

    Pawar, D.; Bayaskar, S.; Patil, V.

    2009-01-01

    We have investigated plane symmetric cosmological model in presence of thick domain walls in Brans-Dicke theory of gravitation, some geometrical and physical behavior of the model are discussed. (authors)

  7. Qualitative analysis of cosmological models in Brans-Dicke theory, solutions from non-minimal coupling and viscous universe

    International Nuclear Information System (INIS)

    Romero Filho, C.A.

    1988-01-01

    Using dynamical system theory we investigate homogeneous and isotropic models in Brans-Dicke theory for perfect fluids with general equation of state and arbitrary ω. Phase diagrams are drawn on the Poincare sphere which permits a qualitative analysis of the models. Based on this analysis we construct a method for generating classes of solutions in Brans-Dicke theory. The same technique is used for studying models arising from non-minimal coupling of electromagnetism with gravity. In addition, viscous fluids are considered and non-singular solutions with bulk viscosity are found. (author)

  8. Henri Poincaré a biography through the daily papers

    CERN Document Server

    Ginoux, Jean-Marc

    2014-01-01

    On July 17, 2012, the centenary of Henri Poincaré's death was commemorated; his name being associated with so many fields of knowledge that he was considered as the Last Universalist. In Pure and Applied Mathematics, Physics, Astronomy, Engineering and Philosophy, his works have had a great impact all over the world. Poincaré acquired in his lifetime such a reputation that, both nationally and internationally, his life and career were made the object of various articles in the daily papers not only in France, but also in the USA. Some of his philosophical concepts have even caused sharp controversies in the Press (as we will discover in this book).This work presents an original portrait of Henri Poincaré based on various press cuttings from The New York Times, The San Francisco Sunday Call, The Times, The Sun, The Washington Post that chronicled unknown anecdotes of his life (for example, his first name was actually not Henri, but Henry; he obtained his high school diploma in sciences with a zero in mathem...

  9. Louis Dick (1921 - 2014)

    CERN Multimedia

    2014-01-01

    Louis Dick, a CERN experimental physicist of international renown, passed away on 14 July.   Louis in his office, a veritable archaeological wonder with strata of documents corresponding to various eras of physics. Born in Geneva on 27 April 1921, Louis obtained a physics degree at ETH-Zurich in 1946 before moving to the Institut du Radium in Paris, where he joined the group led by Frédéric and Irène Joliot-Curie. He took a leave of absence in 1957 to go to CERN, where he remained until well beyond his retirement in 1986. In the late 1950s and early 1960s, Louis worked at CERN’s Synchrocyclotron (SC) and later on studies at the Proton Synchrotron (PS). When the first polarised proton target arrived at CERN from Saclay in 1963, Louis proposed using it for studies of spin effects in pion-proton elastic scattering at the PS, and between 1964 and 1966 sizeable spin effects were found. Louis and his collaborators then continued these studies wi...

  10. Henry Gray, plagiarist.

    Science.gov (United States)

    Richardson, Ruth

    2016-03-01

    The first edition of Anatomy Descriptive and Surgical (1858) was greeted with accolades, but also provoked serious controversy concerning Henry Gray's failure to acknowledge the work of earlier anatomists. A review in the Medical Times (1859) accused Gray of intellectual theft. The journal took the unusual step of substantiating its indictment by publishing twenty parallel texts from Gray and from a pre-existing textbook, Quain's Anatomy. At the recent "Vesalius Continuum" conference in Zakynthos, Greece (2014) Professor Brion Benninger disputed the theft by announcing from the floor the results of a computer analysis of both texts, which he reported exonerated Gray by revealing no evidence of plagiarism. The analysis has not been forthcoming, however, despite requests. Here the historian of Gray's Anatomy supplements the argument set out in the Medical Times 150 years ago with data suggesting unwelcome personality traits in Henry Gray, and demonstrating the utility of others' work to his professional advancement. Fair dealing in the world of anatomy and indeed the genuineness of the lustre of medical fame are important matters, but whether quantitative evidence has anything to add to the discussion concerning Gray's probity can be assessed only if Benninger makes public his computer analysis. © 2015 Wiley Periodicals, Inc.

  11. Copper and dyes enhance laccase production in gamma-proteobacterium JB.

    Science.gov (United States)

    Malhotra, Kanam; Sharma, Prince; Capalash, Neena

    2004-07-01

    Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.

  12. Isolation of perchlorate-reducing Azospira suillum strain JB524 from tidal flats of the Yellow Sea

    Directory of Open Access Journals (Sweden)

    Nirmala Bardiya

    2016-11-01

    Full Text Available Objective: To isolate and identify perchlorate-reducing bacterium from an enriched consortium from tidal flats of the Yellow Sea. Methods: A perchlorate-enriched consortium from tidal flats of the Yellow Sea was used to isolate Azospira suillum (A. suillum strain JB524. The strain was identified based on partial 16S rDNA sequencing. Perchlorate reduction by the strain was tested with acetate as the e - donor in the presence of NaCl, nitrate and at different growth temperatures using standard anaerobic techniques. The complete enzymatic destruction of perchlorate was confirmed as evolution of O2 by chlorite dismutase in the absence of acetate. Results: Strain JB524 shared 100% 16S rDNA sequence similarity with the type strain A. suillum PST isolated from a swine waste treatment lagoon. Perchlorate reduction coincided with concomitant increase in cell density. Although, acclimatization of the strain PST at suboptimal temperature for perchlorate reduction is not reported, the newly isolated strain could rapidly reduce perchlorate at 22 °C after brief acclimatization. Conclusions: Reduction of perchlorate by A. suillum strain JB524 was negatively affected in the presence of NaCl, suboptimal temperature, presence of nitrate, and limiting amount of acetate as the e-donor.

  13. Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.

    Science.gov (United States)

    West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A

    2017-01-01

    Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1 ™ . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.

  14. Contaminant Monitoring Strategy for Henrys Lake, Idaho

    Energy Technology Data Exchange (ETDEWEB)

    John S. Irving; R. P. Breckenridge

    1992-12-01

    Henrys Lake, located in southeastern Idaho, is a large, shallow lake (6,600 acres, {approx} 17.1 feet maximum depth) located at 6,472 feet elevation in Fremont Co., Idaho at the headwaters of the Henrys Fork of the Snake River. The upper watershed is comprised of high mountains of the Targhee National Forest and the lakeshore is surrounded by extensive flats and wetlands, which are mostly privately owned. The lake has been dammed since 1922, and the upper 12 feet of the lake waters are allocated for downriver use. Henrys Lake is a naturally productive lake supporting a nationally recognized ''Blue Ribbon'' trout fishery. There is concern that increasing housing development and cattle grazing may accelerate eutrophication and result in winter and early spring fish kills. There has not been a recent thorough assessment of lake water quality. However, the Department of Environmental Quality (DEQ) is currently conducting a study of water quality on Henrys Lake and tributary streams. Septic systems and lawn runoff from housing developments on the north, west, and southwest shores could potentially contribute to the nutrient enrichment of the lake. Many houses are on steep hillsides where runoff from lawns, driveways, etc. drain into wetland flats along the lake or directly into the lake. In addition, seepage from septic systems (drainfields) drain directly into the wetlands enter groundwater areas that seep into the lake. Cattle grazing along the lake margin, riparian areas, and uplands is likely accelerating erosion and nutrient enrichment. Also, cattle grazing along riparian areas likely adds to nutrient enrichment of the lake through subsurface flow and direct runoff. Stream bank and lakeshore erosion may also accelerate eutrophication by increasing the sedimentation of the lake. Approximately nine streams feed the lake (see map), but flows are often severely reduced or completely eliminated due to irrigation diversion. In addition, subsurface

  15. Gödel and Gödel-type universes in Brans–Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Agudelo, J.A., E-mail: jaar@fisica.ufmt.br [Instituto de Física, Universidade Federal de Mato Grosso, 78060-900, Cuiabá, Mato Grosso (Brazil); Nascimento, J.R., E-mail: jroberto@fisica.ufpb.br [Departamento de Física, Universidade Federal da Paraíba, Caixa Postal 5008, 58051-970, João Pessoa, Paraíba (Brazil); Petrov, A.Yu., E-mail: petrov@fisica.ufpb.br [Departamento de Física, Universidade Federal da Paraíba, Caixa Postal 5008, 58051-970, João Pessoa, Paraíba (Brazil); Porfírio, P.J., E-mail: pporfirio@fisica.ufpb.br [Departamento de Física, Universidade Federal da Paraíba, Caixa Postal 5008, 58051-970, João Pessoa, Paraíba (Brazil); Santos, A.F., E-mail: alesandroferreira@fisica.ufmt.br [Instituto de Física, Universidade Federal de Mato Grosso, 78060-900, Cuiabá, Mato Grosso (Brazil); Department of Physics and Astronomy, University of Victoria, 3800 Finnerty Road Victoria, BC (Canada)

    2016-11-10

    In this paper, conditions for existence of Gödel and Gödel-type solutions in Brans–Dicke (BD) scalar–tensor theory and their main features are studied. The consistency of equations of motion, causality violation and existence of CTCs (closed time-like curves) are investigated. The role which cosmological constant and Mach principle play to achieve the consistency of this model is studied.

  16. The Life of Henry Eyring

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 7. The Life of Henry Eyring - From Mines to Molecules. Deepika Janakiraman. General Article Volume 17 Issue 7 July 2012 pp 625-634. Fulltext. Click here to view fulltext PDF. Permanent link:

  17. Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.

    Science.gov (United States)

    Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena

    2009-01-01

    Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.

  18. Generation of Symmetric Dicke States of Remote Qubits with Linear Optics

    International Nuclear Information System (INIS)

    Thiel, C.; Zanthier, J. von; Bastin, T.; Solano, E.; Agarwal, G. S.

    2007-01-01

    We propose a method for generating all symmetric Dicke states, either in the long-lived internal levels of N massive particles or in the polarization degrees of freedom of photonic qubits, using linear optical tools only. By means of a suitable multiphoton detection technique, erasing Welcher-Weg information, our proposed scheme allows the generation and measurement of an important class of entangled multiqubit states

  19. New holographic reconstruction of scalar-field dark-energy models in the framework of chameleon Brans-Dicke cosmology

    International Nuclear Information System (INIS)

    Chattopadhyay, Surajit; Pasqua, Antonio; Khurshudyan, Martiros

    2014-01-01

    Motivated by the work of Yang et al. (Mod. Phys. Lett. A 26:191, 2011), we report on a study of the new holographic dark energy (NHDE) model with energy density given by ρ D = (3φ 2 )/(4ω)(μH 2 + νH) in the framework of chameleon Brans-Dicke cosmology. We have studied the correspondence between the quintessence, the DBI-essence, and the tachyon scalar-field models with the NHDE model in the framework of chameleon Brans-Dicke cosmology. Deriving an expression of the Hubble parameter H and, accordingly, ρ D in the context of chameleon Brans-Dicke chameleon cosmology, we have reconstructed the potentials and dynamics for these scalar-field models. Furthermore, we have examined the stability for the obtained solutions of the crossing of the phantom divide under a quantum correction of massless conformally invariant fields, and we have seen that the quantum correction could be small when the phantom crossing occurs and the obtained solutions of the phantom crossing could be stable under the quantum correction. It has also been noted that the potential increases as the matter. chameleon coupling gets stronger with the evolution of the universe. (orig.)

  20. New holographic reconstruction of scalar-field dark-energy models in the framework of chameleon Brans-Dicke cosmology

    Energy Technology Data Exchange (ETDEWEB)

    Chattopadhyay, Surajit [Pailan College of Management and Technology, Kolkata (India); Pasqua, Antonio [University of Trieste, Department of Physics, Trieste (Italy); Khurshudyan, Martiros [Yerevan State University, Department of Theoretical Physics, Yerevan (Armenia); Potsdam-Golm Science Park, Max Planck Institute of Colloids and Interfaces, Potsdam (Germany)

    2014-09-15

    Motivated by the work of Yang et al. (Mod. Phys. Lett. A 26:191, 2011), we report on a study of the new holographic dark energy (NHDE) model with energy density given by ρ{sub D} = (3φ{sup 2})/(4ω)(μH{sup 2} + νH) in the framework of chameleon Brans-Dicke cosmology. We have studied the correspondence between the quintessence, the DBI-essence, and the tachyon scalar-field models with the NHDE model in the framework of chameleon Brans-Dicke cosmology. Deriving an expression of the Hubble parameter H and, accordingly, ρ{sub D} in the context of chameleon Brans-Dicke chameleon cosmology, we have reconstructed the potentials and dynamics for these scalar-field models. Furthermore, we have examined the stability for the obtained solutions of the crossing of the phantom divide under a quantum correction of massless conformally invariant fields, and we have seen that the quantum correction could be small when the phantom crossing occurs and the obtained solutions of the phantom crossing could be stable under the quantum correction. It has also been noted that the potential increases as the matter. chameleon coupling gets stronger with the evolution of the universe. (orig.)

  1. Henrys Fork near Ashton, ID (YHEN)

    Data.gov (United States)

    Department of the Interior — Henrys Fork near Ashton, Idaho (YHEN) Sample Collection: Samples were collected near the USGS stream gage 13046000 (Latitude 44°04'11", Longitude 111°30'38" NAD83)....

  2. Henri Tamm : algul küsiti mult kogu aeg autogrammi / Henri Tamm ; interv. Ada Kallam

    Index Scriptorium Estoniae

    Tamm, Henri

    2005-01-01

    Draamaseriaali "Kodu keset linna" lapsnäitleja. Lisaks kolleegid Henrist : M. Veinmann "Tekst on tal esimesena peas", K. Maibaum "Võrdväärne partner suurtele". Artikkel pealkirjaga "Henri Tamm : nüüd saan veidi puhkust" : Linnaleht nr. 22, 3. juuni 2005, A2-A3

  3. Henry Taube and Coordination Chemistry

    Science.gov (United States)

    dropdown arrow Site Map A-Z Index Menu Synopsis Henry Taube and Coordination Chemistry Resources with Professor of Chemistry, Emeritus, at Stanford University, received the 1983 Nobel Prize in Chemistry " there from 1940-41. "I became deeply interested in chemistry soon after I came to Berkeley,"

  4. Naked singularity formation in Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Ziaie, Amir Hadi; Atazadeh, Khedmat [Department of Physics, Shahid Beheshti University, Evin, Tehran 19839 (Iran, Islamic Republic of); Tavakoli, Yaser, E-mail: am.ziaie@mail.sbu.ac.i, E-mail: k-atazadeh@sbu.ac.i, E-mail: tavakoli@ubi.p [Departamento de Fisica, Universidade da Beira Interior, Rua Marques d' Avila e Bolama, 6200 Covilha (Portugal)

    2010-04-07

    Gravitational collapse of the Brans-Dicke scalar field with non-zero potential in the presence of matter fluid obeying the barotropic equation of state, p = wrho, is studied. Utilizing the concept of the expansion parameter, it is seen that the cosmic censorship conjecture may be violated for w=-1/3 and w=-2/3 which correspond to the cosmic string and domain wall, respectively. We have shown that physically, it is the rate of collapse that governs the formation of a black hole or a naked singularity as the final fate of dynamical evolution and only for these two cases can the singularity be naked as the collapse end state. Also the weak energy condition is satisfied by the collapsing configuration.

  5. W.E. Henry Symposium compendium: The importance of magnetism in physics and material science

    Energy Technology Data Exchange (ETDEWEB)

    Carwell, H.

    1997-09-19

    This compendium contains papers presented at the W. E. Henry Symposium, The Importance of Magnetism in Physics and Material Science. The one-day symposium was conducted to recognize the achievements of Dr. Warren Elliot Henry as educator, scientist, and inventor in a career spanning almost 70 years. Dr. Henry, who is 88 years old, attended the symposium. Nobel Laureate, Dr. Glenn Seaborg, a friend and colleague for over 40 years, attended the event and shared his personal reminiscences. Dr. Seaborg is Associate Director-At-Large at the Lawrence Berkeley National Laboratory. The Compendium begins with three papers which demonstrate the ongoing importance of magnetism in physics and material science. Other contributions cover the highlights of Dr. Henry`s career as a researcher, educator, and inventor. Colleagues and former students share insights on the impact of Dr. Henry`s research in the field of magnetism, low temperature physics, and solid state physics; his influence on students as an educator; and his character, intellect and ingenuity, and passion for learning and teaching. They share a glimpse of the environment and times that molded him as a man, and the circumstances under which he made his great achievements despite the many challenges he faced.

  6. Stability analysis and observational measurement in chameleonic generalised Brans-Dicke cosmology

    International Nuclear Information System (INIS)

    Farajollahi, Hossein; Salehi, Amin

    2011-01-01

    We investigate the dynamics of the chameleonic Generalised Brans-Dicke model in flat FRW cosmology. In a new approach, a framework to study stability and attractor solutions in the phase space for the model is developed by simultaneously best fitting the stability and model parameters with the observational data. The results show that for an accelerating universe the phantom crossing does not occur in the past and near future

  7. Cosmological constraints on Brans-Dicke theory.

    Science.gov (United States)

    Avilez, A; Skordis, C

    2014-07-04

    We report strong cosmological constraints on the Brans-Dicke (BD) theory of gravity using cosmic microwave background data from Planck. We consider two types of models. First, the initial condition of the scalar field is fixed to give the same effective gravitational strength Geff today as the one measured on Earth, GN. In this case, the BD parameter ω is constrained to ω>692 at the 99% confidence level, an order of magnitude improvement over previous constraints. In the second type, the initial condition for the scalar is a free parameter leading to a somewhat stronger constraint of ω>890, while Geff is constrained to 0.981theory and are valid for any Horndeski theory, the most general second-order scalar-tensor theory, which approximates the BD theory on cosmological scales. In this sense, our constraints place strong limits on possible modifications of gravity that might explain cosmic acceleration.

  8. Interaction of Gravitational field and Brans-Dicke field in R/W universe containing Dark Energy like fluid

    International Nuclear Information System (INIS)

    Singh, Kangujam Priyokumar; Dewri, Mukunda; Singh, Koijam Manihar

    2016-01-01

    On studying some new models of Robertson-Walker universes with a Brans-Dicke scalar field, it is found that most of these universes contain a dark energy like fluid which confirms the present scenario of the expansion of the universe. In one of the cases, the exact solution of the field equations gives a universe with a false vacuum, while in another it reduces to that of dust distribution in the Brans-Dicke cosmology when the cosmological constant is not in the picture. In one particular model it is found that the universe may undergo a Big Rip in the future, and thus it will be very interesting to investigate such models further. (paper)

  9. Exact scaling solutions in normal and Brans-Dicke models of dark energy

    International Nuclear Information System (INIS)

    Arias, Olga; Gonzalez, Tame; Leyva, Yoelsy; Quiros, Israel

    2003-01-01

    A linear relationship between the Hubble expansion parameter and the time derivative of the scalar field is explored in order to derive exact cosmological, attractor-like solutions, both in Einstein's theory and in Brans-Dicke gravity with two fluids: a background fluid of ordinary matter and a self-interacting scalar-field fluid accounting for the dark energy in the universe. A priori assumptions about the functional form of the self-interaction potential or about the scale factor behaviour are not necessary. These are obtained as outputs of the assumed relationship between the Hubble parameter and the time derivative of the scalar field. A parametric class of scaling quintessence models given by a self-interaction potential of a peculiar form, a combination of exponentials with dependence on the barotropic index of the background fluid, arises. Both normal quintessence described by a self-interacting scalar field minimally coupled to gravity and Brans-Dicke quintessence given by a non-minimally coupled scalar field are then analysed and the relevance of these models for the description of the cosmic evolution is discussed in some detail. The stability of these solutions is also briefly commented on

  10. Stellar explosion in the weak field approximation of the Brans-Dicke theory

    International Nuclear Information System (INIS)

    Hamity, Victor H; Barraco, Daniel E

    2005-01-01

    We treat a very crude model of an exploding star, in the weak field approximation of the Brans-Dicke theory, in a scenario that resembles some characteristic data of a type Ia supernova. The most noticeable feature, in the electromagnetic component, is the relationship between the absolute magnitude at maximum brightness of the star and the decline rate in one magnitude from that maximum. This characteristic has become one of the most accurate methods to measure luminosity distances to objects at cosmological distances (Phillips M M 1993 Astrophys. J. 413 L105; see www.all-science-fair-projects.com/ science f air p rojects e ncyclopedia/Supernova, for a brief description of supernovae types). An interesting result is that the active mass associated with the scalar field is totally radiated to infinity, representing a mass loss in the ratio of the 'tensor' component to the scalar component of 1 to (2ω + 3) (ω is the Brans-Dicke parameter), in agreement with a general result of Hawking (1972 Commun. Math. Phys. 25 167). Then, this model shows explicitly, in a dynamical case, the mechanism of the radiation of a scalar field, which is necessary to understand the Hawking result

  11. Should bulk cloudwater or fogwater samples obey Henry's law?

    Science.gov (United States)

    Pandis, Spyros N.; Seinfeld, John H.

    1991-06-01

    Mixing of droplets with different pH that are individually in Henry's law equilibrium with the surrounding atmosphere always results in a bulk mixture that is supersaturated with weak acids like S(IV) and HCOOH, and bases like NH3 with respect to the original atmosphere. High supersaturations result only when the pH of the bulk droplet mixture exceeds the pKa of the species, in which pH range large pH differences among droplets of different sizes lead to large deviations from Henry's law for the bulk mixture. The deviation is shown to depend on the ratio of the arithmetic mean to the harmonic mean of the hydrogen ion concentrations of the droplets with the liquid water content used as weighting factor in the calculation of the means. The theory developed can explain observed discrepancies from Henry's law in atmospheric samples and also other observed phenomena like the reported increase of pH values of bulk aqueous samples during storage.

  12. Inflationary phase in Brans-Dicke cosmology with a cosmological constant

    Science.gov (United States)

    Berman, Marcelo Samuel

    1989-12-01

    It has been shown earlier that, for a perfect fluid, a perfect gas law of state, and the Robertson-Walker metric, an exponential phase in Brans-Dicke cosmology is possible, with both positive pressure and density, but not with the violated energy condition p = -ρ. We demonstrate in this paper that the inclusion of a cosmological constant into the theory does not change that picture. Permanent address: Departamento de Ciencias Exatas da Faculdade de Filosofia, Ceincias e Letras da FURJ, Joinville, SC 89200, Brazil.

  13. Bioremediation of Petrochemical Wastewater Containing BTEX Compounds by a New Immobilized Bacterium Comamonas sp. JB in Magnetic Gellan Gum.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan

    2015-05-01

    In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.

  14. Anisotropic string cosmological model in Brans–Dicke theory of gravitation with time-dependent deceleration parameter

    Energy Technology Data Exchange (ETDEWEB)

    Maurya, D. Ch., E-mail: dcmaurya563@gmail.com; Zia, R., E-mail: rashidzya@gmail.com; Pradhan, A., E-mail: pradhan.anirudh@gmail.com [GLA University, Department of Mathematics, Institute of Applied Sciences and Humanities (India)

    2016-10-15

    We discuss a spatially homogeneous and anisotropic string cosmological models in the Brans–Dicke theory of gravitation. For a spatially homogeneous metric, it is assumed that the expansion scalar θ is proportional to the shear scalar σ. This condition leads to A = kB{sup m}, where k and m are constants. With these assumptions and also assuming a variable scale factor a = a(t), we find solutions of the Brans–Dicke field equations. Various phenomena like the Big Bang, expanding universe, and shift from anisotropy to isotropy are observed in the model. It can also be seen that in early stage of the evolution of the universe, strings dominate over particles, whereas the universe is dominated by massive strings at the late time. Some physical and geometrical behaviors of the models are also discussed and observed to be in good agreement with the recent observations of SNe la supernovae.

  15. Exact solution for the inhomogeneous Dicke model in the canonical ensemble: Thermodynamical limit and finite-size corrections

    Energy Technology Data Exchange (ETDEWEB)

    Pogosov, W.V., E-mail: walter.pogosov@gmail.com [N.L. Dukhov All-Russia Research Institute of Automatics, Moscow (Russian Federation); Institute for Theoretical and Applied Electrodynamics, Russian Academy of Sciences, Moscow (Russian Federation); Moscow Institute of Physics and Technology, Dolgoprudny (Russian Federation); Shapiro, D.S. [N.L. Dukhov All-Russia Research Institute of Automatics, Moscow (Russian Federation); Moscow Institute of Physics and Technology, Dolgoprudny (Russian Federation); V.A. Kotel' nikov Institute of Radio Engineering and Electronics, Russian Academy of Sciences, Moscow (Russian Federation); National University of Science and Technology MISIS, Moscow (Russian Federation); Bork, L.V. [N.L. Dukhov All-Russia Research Institute of Automatics, Moscow (Russian Federation); Institute for Theoretical and Experimental Physics, Moscow (Russian Federation); Onishchenko, A.I. [Bogoliubov Laboratory of Theoretical Physics, Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow Institute of Physics and Technology, Dolgoprudny (Russian Federation); Skobeltsyn Institute of Nuclear Physics, Moscow State University, Moscow (Russian Federation)

    2017-06-15

    We consider an exactly solvable inhomogeneous Dicke model which describes an interaction between a disordered ensemble of two-level systems with single mode boson field. The existing method for evaluation of Richardson–Gaudin equations in the thermodynamical limit is extended to the case of Bethe equations in Dicke model. Using this extension, we present expressions both for the ground state and lowest excited states energies as well as leading-order finite-size corrections to these quantities for an arbitrary distribution of individual spin energies. We then evaluate these quantities for an equally-spaced distribution (constant density of states). In particular, we study evolution of the spectral gap and other related quantities. We also reveal regions on the phase diagram, where finite-size corrections are of particular importance.

  16. Attractors, statefinders and observational measurement for chameleonic Brans-Dicke cosmology

    Energy Technology Data Exchange (ETDEWEB)

    Farajollahi, Hossein; Salehi, Amin, E-mail: hosseinf@guilan.ac.ir, E-mail: a.salehi@guilan.ac.ir [Department of Physics, University of Guilan, Rasht (Iran, Islamic Republic of)

    2010-11-01

    We investigate chameleonic Brans-Dicke model applied to the FRW universes. A framework to study stability and attractor solutions in the phase space is developed for the model. We show that depending on the matter field and stability conditions, it is possible to realize phantom-like behavior without introducing phantom filed in the model while the stability is fulfilled and phantom crossing occurs. The statefinder parameters to the model for different kinds of matter interacting with the chameleon scalar field are studied. We also compare our model with present day observations.

  17. Attractors, statefinders and observational measurement for chameleonic Brans-Dicke cosmology

    International Nuclear Information System (INIS)

    Farajollahi, Hossein; Salehi, Amin

    2010-01-01

    We investigate chameleonic Brans-Dicke model applied to the FRW universes. A framework to study stability and attractor solutions in the phase space is developed for the model. We show that depending on the matter field and stability conditions, it is possible to realize phantom-like behavior without introducing phantom filed in the model while the stability is fulfilled and phantom crossing occurs. The statefinder parameters to the model for different kinds of matter interacting with the chameleon scalar field are studied. We also compare our model with present day observations

  18. Translating China : Henri Borel (1869-1933)

    NARCIS (Netherlands)

    Heijns, A.J.

    2016-01-01

    This thesis investigates how Dutch sinologist Henri Borel ‘translated’ China, by examining his renditions of Chinese literature and the writings about China that he produced over a period of forty years. Borel studied Hokkien Chinese at Leiden University and in Xiamen toward a career as Chinese

  19. 46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

  20. Ecrire et souffrir : L’inspiration partagée de Constance Fenimore Woolson et de Henry James Literature and Grief: Constance Fenimore Woolson and Henry James, A Common Inspiration

    Directory of Open Access Journals (Sweden)

    Jeannine Hayat

    2007-01-01

    Full Text Available Miss Grief is a story by Constance Fenimore Woolson, an American novelist who often wrote about the difficulty a woman had in becoming an artist — a writer or a painter — in the nineteenth century. This tale is a very strange text, a kind of anticipation of a meeting to come, in Italy, in 1880, between Woolson and Henry James, and a friendship which lasted until the former’s death in 1894. For thirteen years, both writers would share a common inspiration. Death itself could not break the links between the two authors, who were connected even when settled in different European countries. William James, who was a member of the American Society for Psychical Research, probably helped his brother Henry to communicate — or so it appears — in some way with Woolson, even after her fatal accident, or possible suicide, in Venice. Henry James probably had in mind Miss Grief, a story by his dead friend, before writing some of his books. Indeed, Woolson had been the first to develop the image of “the figure in the carpet,” which was later transformed by Henry James. Woolson was also the first to devise a plot which Henry James would later use as a canvas for his novel The Wings of the Dove. What is an author and what is authorship? It seems impossible to separate what is Woolson’s and what is Henry James’s in four works of fiction that are in fact to be read together : Miss Grief, The Figure in the Carpet, The Beast in the Jungle, The Wings of the Dove.

  1. Interacting HDE and NADE in Brans-Dicke chameleon cosmology

    Energy Technology Data Exchange (ETDEWEB)

    Sheykhi, Ahmad, E-mail: sheykhi@mail.uk.ac.i [Department of Physics, Shahid Bahonar University, P.O. Box 76175, Kerman (Iran, Islamic Republic of); Research Institute for Astronomy and Astrophysics of Maragha (RIAAM), Maragha (Iran, Islamic Republic of); Jamil, Mubasher, E-mail: mjamil@camp.nust.edu.p [Center for Advanced Mathematics and Physics, National University of Sciences and Technology, H-12, Islamabad (Pakistan)

    2011-01-03

    Motivated by the recent work of one of us Setare and Jamil (2010) , we generalize this work to the case where the pressureless dark matter and the holographic dark energy do not conserve separately but interact with each other. We investigate the cosmological applications of interacting holographic dark energy in Brans-Dicke theory with chameleon scalar field which is non-minimally coupled to the matter field. We find out that in this model the phantom crossing can be constructed if the model parameters are chosen suitably. We also perform the study for the new agegraphic dark energy model and calculate some relevant cosmological parameters and their evolution.

  2. Thermodynamics in modified Brans-Dicke gravity with entropy corrections

    Energy Technology Data Exchange (ETDEWEB)

    Rani, Shamaila; Jawad, Abdul; Nawaz, Tanzeela [COMSATS Institute of Information Technology, Department of Mathematics, Lahore (Pakistan); Manzoor, Rubab [University of Management and Technology, Department of Mathematics, Lahore (Pakistan)

    2018-01-15

    In this paper, we investigate the thermodynamics in the frame-work of recently proposed theory called modified Brans-Dicke gravity (Kofinas et al. in Class Quantum Gravity 33:15, 2016). For this purpose, we develop the generalized second law of thermodynamics by assuming usual entropy as well as its corrected forms (logarithmic and power law corrected) on the apparent and event horizons. In order to analyzed the clear view of thermodynamic law, the power law forms of scalar field and scale factor is being assumed. We evaluate the results graphically and found that generalized second law of thermodynamics holds in most of the cases. (orig.)

  3. Interacting HDE and NADE in Brans-Dicke chameleon cosmology

    International Nuclear Information System (INIS)

    Sheykhi, Ahmad; Jamil, Mubasher

    2011-01-01

    Motivated by the recent work of one of us Setare and Jamil (2010) , we generalize this work to the case where the pressureless dark matter and the holographic dark energy do not conserve separately but interact with each other. We investigate the cosmological applications of interacting holographic dark energy in Brans-Dicke theory with chameleon scalar field which is non-minimally coupled to the matter field. We find out that in this model the phantom crossing can be constructed if the model parameters are chosen suitably. We also perform the study for the new agegraphic dark energy model and calculate some relevant cosmological parameters and their evolution.

  4. Thermodynamics in modified Brans-Dicke gravity with entropy corrections

    International Nuclear Information System (INIS)

    Rani, Shamaila; Jawad, Abdul; Nawaz, Tanzeela; Manzoor, Rubab

    2018-01-01

    In this paper, we investigate the thermodynamics in the frame-work of recently proposed theory called modified Brans-Dicke gravity (Kofinas et al. in Class Quantum Gravity 33:15, 2016). For this purpose, we develop the generalized second law of thermodynamics by assuming usual entropy as well as its corrected forms (logarithmic and power law corrected) on the apparent and event horizons. In order to analyzed the clear view of thermodynamic law, the power law forms of scalar field and scale factor is being assumed. We evaluate the results graphically and found that generalized second law of thermodynamics holds in most of the cases. (orig.)

  5. INOVATION AND ANTREPRENEURIAL CREATIVITY BUSINESS DURING HENRY FORD

    Directory of Open Access Journals (Sweden)

    GHICAJANU MIHAELA

    2015-03-01

    Full Text Available In this paper I presented the innovation and entrepeneurial creativity as a basis in the process of business redesign. I chose as a case study the the Ford brand products, because it is considered that Henry Ford is one of the greatest innovators and entrepreneurs of all time and I decided to present and to analyze these things. The first part of the paper will include theoretical approaches on the innovation and creativity business concepts and premises, and then I showed the ways in which four types of economic innovation under the leadership of Henry Ford (innovation in product, in process, market and organizational were achieved, with the purpose to recognize them in other companies, nowadays .

  6. Holographic Dark Energy in Brans-Dicke Theory with Logarithmic Form of Scalar Field

    Science.gov (United States)

    Singh, C. P.; Kumar, Pankaj

    2017-10-01

    In this paper, an interacting holographic dark energy model with Hubble horizon as an infra-red cut-off is considered in the framework of Brans-Dicke theory. We assume the Brans-Dicke scalar field as a logarithmic form ϕ = ϕ 0 l n( α + β a), where a is the scale factor, α and β are arbitrary constants, to interpret the physical phenomena of the Universe. The equation of state parameter w h and deceleration parameter q are obtained to discuss the dynamics of the evolution of the Universe. We present a unified model of holographic dark energy which explains the early time acceleration (inflation), medieval time deceleration and late time acceleration. It is also observed that w h may cross the phantom divide line in the late time evolution. We also discuss the cosmic coincidence problem. We obtain a time-varying density ratio of holographic dark energy to dark matter which is a constant of order one (r˜ O(1)) during early and late time evolution, and may evolve sufficiently slow at present time. Thus, the model successfully resolves the cosmic coincidence problem.

  7. Transcendentalism and Henry Barnard's "School Architecture"

    Science.gov (United States)

    Rothfork, John

    1977-01-01

    Sketches the intellectual and sociological climate that led Henry Barnard to advocate Greek Revival architecture for school buildings, takes a look at why this style and its implicit values were popular in the era between 1820-1860, and examines a few of the plans in Barnard's "School Architecture" (1838-48). (Author/RK)

  8. Explaining fast radio bursts through Dicke's superradiance

    Science.gov (United States)

    Houde, Martin; Mathews, Abhilash; Rajabi, Fereshteh

    2018-03-01

    Fast radio bursts (FRBs), characterized by strong bursts of radiation intensity at radio wavelengths lasting on the order of a millisecond, have yet to be firmly associated with a family, or families, of astronomical sources. It follows that despite the large number of proposed models, no well-defined physical process has been identified to explain this phenomenon. In this paper, we demonstrate how Dicke's superradiance, for which evidence has recently been found in the interstellar medium, can account for the characteristics associated with FRBs. Our analysis and modelling of previously detected FRBs suggest they could originate from regions in many ways similar to those known to harbour masers or megamasers, and result from the coherent radiation emanating from populations of molecules associated with large-scale entangled quantum mechanical states. We estimate this entanglement to involve as many as ˜1030 to ˜1032 molecules over distances spanning 100-1000 au.

  9. Pornografia e transgressão na obra literária de Henry Miller

    Directory of Open Access Journals (Sweden)

    Raquel Catunda Pereira

    2016-07-01

    Full Text Available The North American writer Henry Miller was marginalized by literary critics since the first publications of his works in the 40s. Accused of being a pornographic text, the book Tropic of Cancer (1934 was forbidden in many countries. This article aims to analyze the obscene in Henry Miller’s work to prove that, beyond the erotic intention, Miller’s books are an expression of freedom and rejection of moral standards. In order to achieve our goal, we will use as theoretical basis the articles Criticismo e sexualidade: uma leitura de Tropico of Capricorn de Henry Miller, by Flávia Andréa Rodrigues Benfatt, and Literatura marginal americana: do épico confessional ao niilismo erótico, by Lainister de Oliveira. The texts mentioned above grant us the argumentation necessary to the analysis of pornographic discourse in Henry Miller’s literary works as the author’s aesthetics choice of taking himself as a transgressor in a decadent society.

  10. Kesknoored tegid visiidi Šveitsi / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    Keskerakonna noorte esindus külastas 20.-25. aprillini 2005 Šveitsi, et osaleda sealsete noorte liberaalide Jungfreisinnige Schweizi kongressil. Delegatsiooni kuulusid esimees Tarmo Lausing, välissekretär Olga Sõtnik, endine pressisekretär Raimond Kaljulaid ja noortekogu esimees Henri Kaselo

  11. Robert Dicke and the naissance of experimental gravity physics, 1957-1967

    Science.gov (United States)

    Peebles, Phillip James Edwin

    2017-06-01

    The experimental study of gravity became much more active in the late 1950s, a change pronounced enough be termed the birth, or naissance, of experimental gravity physics. I present a review of developments in this subject since 1915, through the broad range of new approaches that commenced in the late 1950s, and up to the transition of experimental gravity physics to what might be termed a normal and accepted part of physical science in the late 1960s. This review shows the importance of advances in technology, here as in all branches of natural science. The role of contingency is illustrated by Robert Dicke's decision in the mid-1950s to change directions in mid-career, to lead a research group dedicated to the experimental study of gravity. The review also shows the power of nonempirical evidence. Some in the 1950s felt that general relativity theory is so logically sound as to be scarcely worth the testing. But Dicke and others argued that a poorly tested theory is only that, and that other nonempirical arguments, based on Mach's Principle and Dirac's Large Numbers hypothesis, suggested it would be worth looking for a better theory of gravity. I conclude by offering lessons from this history, some peculiar to the study of gravity physics during the naissance, some of more general relevance. The central lesson, which is familiar but not always well advertised, is that physical theories can be empirically established, sometimes with surprising results.

  12. Cylindrically symmetric, static strings with a cosmological constant in Brans-Dicke theory

    International Nuclear Information System (INIS)

    Delice, Oezguer

    2006-01-01

    The static cylindrically symmetric vacuum solutions with a cosmological constant in the framework of the Brans-Dicke theory are investigated. Some of these solutions admitting Lorentz boost invariance along the symmetry axis correspond to local, straight cosmic strings with a cosmological constant. Some physical properties of such solutions are studied. These strings apply attractive or repulsive forces on the test particles. A smooth matching is also performed with a recently introduced interior thick string solution with a cosmological constant

  13. Antoine-Henri Jomini: A Bibliographical Survey.

    Science.gov (United States)

    Alger, John I.

    Although the writings of Antoine-Henri Jomini influenced military thought during the 19th and 20th centuries, the obscurity of their publishing history has led to misunderstandings of the development and substance of Jomini's thought. This review attempts to (1) point out the continuity of his thought on the conduct of war, and (2) provide an…

  14. Application of the functional integration method to the Dicke-type models

    International Nuclear Information System (INIS)

    Popov, V.N.; Fedotov, S.A.

    1981-01-01

    The asymptotics of the statistical model sum of the Dicke-type (Z/Z 6 ) is obtained and strictly proved at large N (N is an atomic number; Z is a statistical model sum; Z 0 is a statistical free system sum) using the functional integration method. The model with one bose-field mode is considered. A detailed proof is carried out at T > Tsub(c). An idea of the proof is planned and asymptotic formulae are presented for T < Tsub(c) and in the vicinity of Tsub(c)

  15. Henry Morgenthau's voice in history.

    Science.gov (United States)

    Steiner, Pamela

    2015-01-01

    Henry Morgenthau (1856-1946) distinguished himself as the U.S. Ambassador to the Ottoman Empire, 1913-1916, and as the chairman of the League of Nations Refugee Settlement Commission (RSC) for Greece, 1923-24. I describe aspects of his early life that shaped the man he became, his accomplishments in these two posts, and his feelings about himself over time. At the end I briefly describe his attitude toward a possible Jewish state in Palestine.

  16. Why it was natural for Henri Becquerel to discover natural radioactivity

    International Nuclear Information System (INIS)

    Barquins, M.

    2002-01-01

    This article presents the scientific saga of the Becquerel family. 4 generations of Becquerel Antoine-Cesar (1788-1878), Edmond (1820-1891), Henri (1852-1906) and Jean (1878-1953) were involved in scientific activities at the highest level. Henri was awarded the Nobel prize of physics (shared with Pierre and Marie Curie) in 1903 for the discovery of radioactivity. The author shows that the discovery of radioactivity was due to talent, family emulation, genetics and chance. (A.C.)

  17. Isotropic LQC and LQC-inspired models with a massless scalar field as generalised Brans-Dicke theories

    Science.gov (United States)

    Rama, S. Kalyana

    2018-06-01

    We explore whether generalised Brans-Dicke theories, which have a scalar field Φ and a function ω (Φ ), can be the effective actions leading to the effective equations of motion of the LQC and the LQC-inspired models, which have a massless scalar field σ and a function f( m). We find that this is possible for isotropic cosmology. We relate the pairs (σ , f) and (Φ , ω ) and, using examples, illustrate these relations. We find that near the bounce of the LQC evolutions for which f(m) = sin m, the corresponding field Φ → 0 and the function ω (Φ ) ∝ Φ ^2. We also find that the class of generalised Brans-Dicke theories, which we had found earlier to lead to non singular isotropic evolutions, may be written as an LQC-inspired model. The relations found here in the isotropic cases do not apply to the anisotropic cases, which perhaps require more general effective actions.

  18. O absurdo em «Caieira», de Ricardo Guilherme Dicke

    Directory of Open Access Journals (Sweden)

    Hilda Gomes Dutra Magalhães

    2012-08-01

    Full Text Available Resumo: Nosso objetivo neste artigo consiste em analisar o espaço do absurdo no romance Caieira, do escritor matogrossense Ricardo Guilherme Dicke. Como suporte teóricometodológico, utilizamos as ideias sobre o absurdo de Camus. Durante a análise, percebemos que o espaço em que se desenvolvem as ações narradas em Caieira representa uma relação de dominação, em que os personagens são reduzidas a fantasmas ou objetos, presas num mundo de cal, árido de humanidade. Mesmo quando o personagem principal tenta reverter o quadro, acaba se transformando num reverso da mesma moeda, repetindo o modelo de dominação contra o qual se insurge, reeditando um ciclo de poder e dominação. Palavras-chave: Literatura brasileira; análise literária; absurdo; espaço.Abstract: Our aim in this paper is to analyze the space of the absurd at the novel Caieira, by Ricardo Guilherme Dicke, writer from Mato Grosso. As a theoretical-methodological support, we use the ideas of on the absurd presented by Camus. During the analysis, we find that the space in which the actions narrated in Caieira develop represents a relationship of domination, in which the characters are reduced to objects or ghosts, trapped in a world of lime, arid of humanity. Even when the main character tries to reverse the situation, eventually becoming a reverse of the same coin, repeating the pattern of domination against which it protests, reissuing a cycle of power and domination. Keywords: Brazilian literature; literary analysis; absurd; space.

  19. Henry P. McKean Jr. selecta

    CERN Document Server

    Moerbeke, Pierre; Moll, Victor

    2015-01-01

    This volume presents a selection of papers by Henry P. McKean, which illustrate the various areas in mathematics in which he has made seminal contributions. Topics covered include probability theory, integrable systems, geometry and financial mathematics. Each paper represents a contribution by Prof. McKean, either alone or together with other researchers, that has had a profound influence in the respective area.

  20. The advantage of using the henry straight line in {gamma} spectrometry (1963); Interet de l'utilisation de la droite de henry en spectrometrie {gamma} (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Jockey, [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1963-07-01

    The Henry construction is a convenient way to interpret the total absorption peaks in gamma spectrometry by exploiting their statistical significance. It is so possible to determine graphically, and accurately, such values as: - position of the peak - resolution, etc. The main practical applications are considered. (author) [French] La construction de la droite de Henry fournit un moyen commode d'interpreter les pics d'absorption totale en spectrometrie gamma en exploitant leur signification statistique, il est ainsi possible de determiner graphiquement, avec precision, des notions telles que: - position du pic - resolution, etc. Les principales applications pratiques sont envisagees. (auteur)

  1. Robert Henry Thurston: Professionalism and Engineering Education

    Science.gov (United States)

    Nienkamp, Paul

    2016-01-01

    Robert Henry Thurston is presented in this article. He provides one the most significant examples of professionalizing engineering through innovative education and promoting scientific education practices in the late nineteenth century. The son of a draftsmen and steam engine mechanic, Thurston spent his early years in Providence, Rhode Island.…

  2. The Teaching Approach of Henry Schaefer-Simmern.

    Science.gov (United States)

    Abrahamson, Roy E.

    1980-01-01

    This description of the teaching approach of Henry Schaefer-Simmern emphasizes his use of questioning to evoke student self-evaluation and to develop clarity of vision and interfunctional unity in students' art products and their mental, artistic conceiving. Two case reports of his work with elementary students are included. (Author/SJL)

  3. Effectiveness of an implementation optimisation intervention aimed at increasing parent engagement in HENRY, a childhood obesity prevention programme - the Optimising Family Engagement in HENRY (OFTEN) trial: study protocol for a randomised controlled trial.

    Science.gov (United States)

    Bryant, Maria; Burton, Wendy; Cundill, Bonnie; Farrin, Amanda J; Nixon, Jane; Stevens, June; Roberts, Kim; Foy, Robbie; Rutter, Harry; Hartley, Suzanne; Tubeuf, Sandy; Collinson, Michelle; Brown, Julia

    2017-01-24

    Family-based interventions to prevent childhood obesity depend upon parents' taking action to improve diet and other lifestyle behaviours in their families. Programmes that attract and retain high numbers of parents provide an enhanced opportunity to improve public health and are also likely to be more cost-effective than those that do not. We have developed a theory-informed optimisation intervention to promote parent engagement within an existing childhood obesity prevention group programme, HENRY (Health Exercise Nutrition for the Really Young). Here, we describe a proposal to evaluate the effectiveness of this optimisation intervention in regard to the engagement of parents and cost-effectiveness. The Optimising Family Engagement in HENRY (OFTEN) trial is a cluster randomised controlled trial being conducted across 24 local authorities (approximately 144 children's centres) which currently deliver HENRY programmes. The primary outcome will be parental enrolment and attendance at the HENRY programme, assessed using routinely collected process data. Cost-effectiveness will be presented in terms of primary outcomes using acceptability curves and through eliciting the willingness to pay for the optimisation from HENRY commissioners. Secondary outcomes include the longitudinal impact of the optimisation, parent-reported infant intake of fruits and vegetables (as a proxy to compliance) and other parent-reported family habits and lifestyle. This innovative trial will provide evidence on the implementation of a theory-informed optimisation intervention to promote parent engagement in HENRY, a community-based childhood obesity prevention programme. The findings will be generalisable to other interventions delivered to parents in other community-based environments. This research meets the expressed needs of commissioners, children's centres and parents to optimise the potential impact that HENRY has on obesity prevention. A subsequent cluster randomised controlled pilot

  4. Evolution of Bianchi I magnetized cosmic strings in Brans–Dicke gravity

    International Nuclear Information System (INIS)

    Sharif, M; Waheed, Saira

    2013-01-01

    In this paper, we consider a locally rotationally symmetric Bianchi I universe filled with magnetized viscous string fluid in Brans–Dicke gravity. For the exact solutions, we use the law of variation of the Hubble parameter that leads to volumetric expansion laws and assume power law ansatz for the scalar field. We discuss the nature of the resulting models through different parameters and their graphs. It is concluded that the constructed universe models yield an accelerated expanding behavior with an isotropic nature for the final stages of the universe evolution, which is consistent with recent observations. (paper)

  5. Henry the Seventh and Italy, an historiographical account

    Directory of Open Access Journals (Sweden)

    Gian Maria Varanini

    2014-06-01

    Full Text Available The article represents an introduction to the contributions published in the monographic section dedicated to the expedition of Henry VII of Luxembourg in Italy (1310-1313. It provides an historiographic overview and some insightful clues.

  6. 1787 and 1776: Patrick Henry, James Madison, and the Revolutionary Legitimacy of the Constitution.

    Science.gov (United States)

    Banning, Lance

    1988-01-01

    Discusses Patrick Henry's and James Madison's opinions on how the U.S. Constitution should be constructed. Describes how Henry introduced a set of substantive objections which were shared by Antifederalists throughout the country and persuaded many Revolutionaries that the Constitution was essentially at odds with the principles of 1776. (BSR)

  7. The Ideas of Henry Jenkins and Libraries

    Science.gov (United States)

    Anderson, Byron

    2008-01-01

    Henry Jenkins, director of the Comparative Media Studies Program at the Massachusetts Institute of Technology and keynote speaker at the 2007 American Library Association's "Gaming, Learning and Libraries Symposium" in Chicago is a visionary leader in the areas of new media and media convergence. In a white paper on digital media and learning…

  8. Notes on the post-Newtonian limit of the massive Brans-Dicke theory

    International Nuclear Information System (INIS)

    Roshan, Mahmood; Shojai, Fatimah

    2011-01-01

    We consider the post-Newtonian limit of the massive Brans-Dicke theory and make some notes about the post-Newtonian limit of the case ω = 0. This case is dynamically equivalent to the metric f(R) theory. It is known that this theory can be compatible with the solar system tests if the Chameleon mechanism occurs. Also, it is known that this mechanism is because of the nonlinearity in the field equations produced by the largeness of the local curvature relative to the background curvature. Thus, the linearization of the field equations breaks down. On the other hand, we know that the Chameleon mechanism exists when a coupling between the matter and the scalar field exists. In the Jordan frame of the Brans-Dicke theory, we have no such coupling. But in the Einstein frame, this theory behaves like a Chameleon scalar field. By confining ourselves to the case ω = 0, we show that 'Chameleon-like' behaviour can exist also in the Jordan frame, but it has an important difference compared with the Chameleon mechanism. Also we show that the conditions which lead to the existence of a 'Chameleon-like' mechanism are consistent with the conditions in the post-Newtonian limit which correspond to a heavy scalar field at the cosmological scale and a small effective cosmological constant. Thus, one can linearize field equations to the post-Newtonian order, and this linearization has no contradiction with the existence of 'Chameleon-like' behaviour.

  9. Henri Fayol and Zero Tolerance Policies

    OpenAIRE

    Lee SCHIMMOELLER

    2012-01-01

    Zero tolerance policies have been increasingly popular in both education and business. Henri Fayol was the one of the earliest and influential thinkers in modern management theory. He defined management as a body of knowledge and defined his 14 administrative principles. It is an interesting exercise to apply Fayol’s teachings to the theory of zero tolerance and attempt to determine what Fayol would think of this new management technique.

  10. Henry James – Modern Theoretician of Narration

    Directory of Open Access Journals (Sweden)

    Alexandra - Denisa IGNA

    2013-01-01

    Full Text Available Henry James, properly named world writer, was one of the first modern novelists, with an exigent writing conscience. The American writer subverted the prejudgement of the omniscient author in favour of the narration which is centred on the characters’ point of view, thus modernising the novel before V. Woolf, Huxley, Thomas Mann, or in our case Camil Petrescu and G. Călinescu. Some bio-bibliographical information familiarises the reader with the life and work of this writer. The larger part of the article is dedicated to a case study of the novel with the metaphorical title: The Figure in the Carpet, where Henry James tries to illustrate in an artistic manner his conception regarding the profundity and ineffability of the literary creation. The conclusion which the author reaches, alternating the familiar plan of the relationship between a married couple with the esthetical plan, is that the relationship between writer and his work represents an act of fully intimacy, just like a ceremony that takes place in the wedding night

  11. Production and Its Anti-hyperglycemic Effects of γ-Aminobutyric Acid from the Wild Yeast Strain Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1.

    Science.gov (United States)

    Han, Sang-Min; Lee, Jong-Soo

    2017-09-01

    This study was done to produce γ-aminobutyric acid (GABA) from wild yeast as well as investigate its anti-hyperglycemic effects. Among ten GABA-producing yeast strains, Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1 produced high GABA concentration of 134.4 µg/mL and 179.2 µg/mL, respectively. P. silvicola UL6-1 showed a maximum GABA yield of 136.5 µg/mL and 200.8 µg/mL from S. carnicolor 402-JB-1 when they were cultured for 30 hr at 30℃ in yeast extract-peptone-dextrose medium. The cell-free extract from P. silvicola UL6-1 and S. carnicolor 402-JB-1 showed very high anti-hyperglycemic α-glucosidase inhibitory activity of 72.3% and 69.9%, respectively. Additionally, their cell-free extract-containing GABA showed the anti-hyperglycemic effect in streptozotocin-induced diabetic Sprague-Dawley rats.

  12. 78 FR 34428 - Missouri Central Railroad Company-Abandonment Exemption-in Cass, Henry, Johnson, and Pettis...

    Science.gov (United States)

    2013-06-07

    ... No. AB 1070; (Sub-No. 1X)] Missouri Central Railroad Company--Abandonment Exemption--in Cass, Henry, Johnson, and Pettis Counties, MO; Central Midland Railway Company--Discontinuance of Service Exemption--in Cass, Henry, Johnson, and Pettis Counties, MO Missouri Central Railroad Company (MCRR) and Central...

  13. Principles in Action: The Work of Henri Wallon

    Science.gov (United States)

    Voyat, Gilbert

    1974-01-01

    An examination of the life and philosophy of Henri Wallon, A French psychiatrist, psychologist, and educator, focusing on his views regarding the role of imitation in adaptation and learning, emotional development, syncretic thought, his differences with Piaget, and an assessment of the impact of his work. (EH)

  14. Majumdar-Papapetrou class of nonstatic cylindrically symmetric Brans-Dicke-Maxwell fields

    International Nuclear Information System (INIS)

    Tiwari, R.N.; Rao, P.P.

    1979-01-01

    Relations have been obtained between certain components of the metric and the electromagnetic potentials for source-free Brans-Dicke-Maxwell fields described by a nonstatic cylindrically symmetric Einstein-Rosen metric. These are important, in the sense that they generate a class of solutions that in a way can be said to belong to the class generated by similar relations obtained by Majumdar (Phys. Rev.; 72: 390 (1947)) and Papapetrou (Proc. R. Ir. Acad. Sect. A.; 51: 191 (1947)) for generalized static Einstein-Maxwell fields. The relations have further been used to reduce the B-D Maxwell equations to B-D vacuum equations and vice versa. (author)

  15. Time variation of the cosmological redshift in Dicke-Brans-Jordan cosmologies

    International Nuclear Information System (INIS)

    Ruediger, R.

    1982-01-01

    In this paper the time variation z of the cosmological redshift z is discussed for Dicke-Brans-Jordan (DBJ) cosmologies. We determine the general z-z relation in the functional form zH -1 0 = F(z; q 0 , sigma 0 ,xi 0 , ω) for small values of z, where all the symbols have their conventional meanings. For certain combinations of cosmological parameters, which are within the present observational limitations, the DBJ terms in the function F can dominate the general relativistic terms. Furthermore, zH -1 0 can be positive in DBJ cosmologies in contrast to general relativistic cosmologies with q 0 >0

  16. Hiina kompartei pole NLKP-ga võrreldav / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    20.-26. novembril Hiinas Pekingis ja sadamalinnas Tianjinis peetud Euroopa ja Aasia noorte kohtumisest, kus Eestit esindasid Keskerakonna noortekogu esimees Henri Kaselo ja Euroopa Noorte Sotsiaaldemokraatide aseesimees ning Toomas Hendrik Ilvese nõunik Rander Läntsi

  17. Evaluating Henry's law constant of N-nitrosodimethylamine (NDMA).

    Science.gov (United States)

    Haruta, Shinsuke; Jiao, Wentao; Chen, Weiping; Chang, Andrew C; Gan, Jay

    2011-01-01

    N-Nitrosodimethylamine (NDMA), a potential carcinogen, may contaminate the groundwater when the reclaimed wastewater is used for irrigation and groundwater recharge. Henry's law constant is a critical parameter to assess the fate and transport of reclaimed wastewater-borne NDMA in the soil profile. We conducted a laboratory experiment in which the change of NDMA concentration in water exposed to the atmosphere was measured with respect to time and, based on the data, obtained the dimensionless Henry's law constant (K(H)') of NDMA, at 1.0 x 10(-4). The K(H)' suggests that NDMA has a relatively high potential to volatilize in the field where NDMA-containing wastewater is used for irrigation and the volatilization loss may be a significant pathway of NDMA transport. The experiment was based on the two boundary-layer approach of mass transfer at the atmosphere-water interface. It is an expedient method to delineate K(H)' for volatile or semi-volatile compounds present in water at low concentrations.

  18. Obituary: Henry Albers (1925-2009)

    Science.gov (United States)

    Chromey, Fred

    2011-12-01

    Henry Albers, professor of astronomy at Vassar College for over thirty years, died March 29, 2009, in Fairhope, Alabama. For his work at Vassar, where he held the Maria Mitchell Chair, Albers received the first Maria Mitchell Women in Science Award for his inspiration of women astronomers. He said "In the final analysis it is the students who bring the joy into teaching." As a professional astronomer, Albers did observational work on Galactic structure in the southern Milky Way, and on the structure of the Magellanic Clouds. In retirement, Albers published Maria Mitchell - A Life in Journals and Letters, the firsthand account of America's first woman astronomer. Albers's research was on photographic near-infrared spectroscopy of red giant stars in the southern Milky Way, some proper motion studies, and on the structure of the Magellanic Clouds. A series of seven NSF grants supported his six trips to Chile to make spectroscopic observations, as well as his sabbatical collaborations at Minnesota, Leiden, and the Royal Observatory in Edinburgh. Henry Albers arrived at Vassar in 1958, to find an astronomy program that had been recently absorbed by the physics department, and that was suffering neglect after the retirement of Maud Makemson. For the next 31 years, with incredible energy -- he sometimes taught seven courses a year -- he built the astronomy program into one double in size (from one to two tenure lines), whose th century facilities have been replaced with a st century observatory. For a remarkable stretch of 20-some-years, Albers and physicist Bob Stearns, with considerable grace, alternated chairmanship of the joint department of physics and astronomy. Henry Albers was a devoted citizen of Vassar College and an enthusiastic participant in the process of faculty governance at that institution. He would have been the first to concede that his enthusiasm was sometimes excessive, and that his contributions at faculty meetings occasionally failed to move the

  19. Decoherence, entanglement, and chaos in the Dicke model

    International Nuclear Information System (INIS)

    Hou Xiwen; Hu Bambi

    2004-01-01

    The dynamical properties of quantum entanglement in the Dicke model without rotating-wave approximation are investigated in terms of the reduced-density linear entropy. The characteristic time of decoherence process in the early-time evolution is numerically obtained and it is shown that the characteristic time decreases as the coupling parameter increases. The mean entanglement, which is defined to be averaged over time, is employed to describe the influences of both quantum phase transition and corresponding classical chaos on the behavior of entanglement. For a given energy, initial conditions are taken to be minimum uncertainty wave packets centered at regular and chaotic regions of the classical phase space. It is shown that the entanglement has a distinct change at the quantum phase transition, and that the entanglement for regular initial conditions is smaller than that for chaotic ones in the case of weak coupling, while it fluctuates with small amplitude in strong coupling and for chaotic initial conditions

  20. Stationary axially symmetric exterior solutions in the five-dimensional representation of the Brans-Dicke-Jordan theory of gravitation

    International Nuclear Information System (INIS)

    Bruckman, W.

    1986-01-01

    The inverse scattering method of Belinsky and Zakharov is used to investigate axially symmetric stationary vacuum soliton solutions in the five-dimensional representation of the Brans-Dicke-Jordan theory of gravitation, where the scalar field of the theory is an element of a five-dimensional metric. The resulting equations for the spacetime metric are similar to those of solitons in general relativity, while the scalar field generated is the product of a simple function of the coordinates and an already known scalar field solution. A family of solutions is considered that reduce, in the absence of rotation, to the five-dimensional form of a well-known Weyl-Levi Civita axially symmetric static vacuum solution. With a suitable choice of parameters, this static limit becomes equivalent to the spherically symmetric solution of the Brans-Dicke theory. An exact metric, in which the Kerr-scalar McIntosh solution is a special case, is given explicitly

  1. Notes on the post-Newtonian limit of the massive Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Roshan, Mahmood; Shojai, Fatimah, E-mail: fshojai@ut.ac.ir [Department of Physics, University of Tehran, Tehran (Iran, Islamic Republic of)

    2011-07-21

    We consider the post-Newtonian limit of the massive Brans-Dicke theory and make some notes about the post-Newtonian limit of the case {omega} = 0. This case is dynamically equivalent to the metric f(R) theory. It is known that this theory can be compatible with the solar system tests if the Chameleon mechanism occurs. Also, it is known that this mechanism is because of the nonlinearity in the field equations produced by the largeness of the local curvature relative to the background curvature. Thus, the linearization of the field equations breaks down. On the other hand, we know that the Chameleon mechanism exists when a coupling between the matter and the scalar field exists. In the Jordan frame of the Brans-Dicke theory, we have no such coupling. But in the Einstein frame, this theory behaves like a Chameleon scalar field. By confining ourselves to the case {omega} = 0, we show that 'Chameleon-like' behaviour can exist also in the Jordan frame, but it has an important difference compared with the Chameleon mechanism. Also we show that the conditions which lead to the existence of a 'Chameleon-like' mechanism are consistent with the conditions in the post-Newtonian limit which correspond to a heavy scalar field at the cosmological scale and a small effective cosmological constant. Thus, one can linearize field equations to the post-Newtonian order, and this linearization has no contradiction with the existence of 'Chameleon-like' behaviour.

  2. Fano and Dicke effects in a double Rashba-ring system

    International Nuclear Information System (INIS)

    Apel, V M; Orellana, P A; Pacheco, M

    2008-01-01

    The electronic transport in a system of two quantum rings side-coupled to a quantum wire is studied via a single-band tunneling tight-binding Hamiltonian. We derived analytical expressions for the conductance and spin polarization when the rings are threaded by magnetic fluxes with Rashba spin-orbit interaction. We show that by using the Fano and Dicke effects this system can be used as an efficient spin filter even for small spin-orbit interaction and small values of magnetic fluxes. We compare the spin-dependent polarization of this design and the polarization obtained with one ring side-coupled to a quantum ring. As a main result, we find better spin polarization capabilities as compared to the one-ring design

  3. Henry's Constants of Persistent Organic Pollutants by a Group-Contribution Method Based on Scaled-Particle Theory.

    Science.gov (United States)

    Razdan, Neil K; Koshy, David M; Prausnitz, John M

    2017-11-07

    A group-contribution method based on scaled-particle theory was developed to predict Henry's constants for six families of persistent organic pollutants: polychlorinated benzenes, polychlorinated biphenyls, polychlorinated dibenzodioxins, polychlorinated dibenzofurans, polychlorinated naphthalenes, and polybrominated diphenyl ethers. The group-contribution model uses limited experimental data to obtain group-interaction parameters for an easy-to-use method to predict Henry's constants for systems where reliable experimental data are scarce. By using group-interaction parameters obtained from data reduction, scaled-particle theory gives the partial molar Gibbs energy of dissolution, Δg̅ 2 , allowing calculation of Henry's constant, H 2 , for more than 700 organic pollutants. The average deviation between predicted values of log H 2 and experiment is 4%. Application of an approximate van't Hoff equation gives the temperature dependence of Henry's constants for polychlorinated biphenyls, polychlorinated naphthalenes, and polybrominated diphenyl ethers in the environmentally relevant range 0-40 °C.

  4. Elliptic solutions of generalized Brans-Dicke gravity with a non-universal coupling

    Energy Technology Data Exchange (ETDEWEB)

    Alimi, J.M.; Reverdy, V. [Observatoire de Paris, Laboratoire Univers et Theories (LUTh), Meudon (France); Golubtsova, A.A. [Observatoire de Paris, Laboratoire Univers et Theories (LUTh), Meudon (France); Peoples' Friendship University of Russia, Institute of Gravitation and Cosmology, Moscow (Russian Federation)

    2014-10-15

    We study a model of the generalized Brans-Dicke gravity presented in both the Jordan and in the Einstein frames, which are conformally related. We show that the scalar field equations in the Einstein frame are reduced to the geodesics equations on the target space of the nonlinear sigma model. The analytical solutions in elliptical functions are obtained when the conformal couplings are given by reciprocal exponential functions. The behavior of the scale factor in the Jordan frame is studied using numerical computations. For certain parameters the solutions can describe an accelerated expansion. We also derive an analytical approximation in exponential functions. (orig.)

  5. Lacan leitor de Melanie Klein: O caso Dick em questão

    OpenAIRE

    Lucero, Ariana; Vorcaro, Angela Maria Resende

    2017-01-01

    RESUMO - O artigo apresenta a leitura que Jacques Lacan faz do caso Dick, de Melanie Klein. Para tanto, a discussão com o flósofo Jean Hyppolite é retomada com o objetivo de explicitarmos como os mecanismos de Ausstossung [expulsão], Verneinung [negação] e Bejahung [afrmação], descritos por Freud em 1925, podem contribuir para a compreensão da constituição psíquicasob uma perspectiva lacaniana. Em seguida, expomos o caso, tanto para apreendermos clinicamente o que foi exposto na teoria, quant...

  6. An efficient single-step scheme for manipulating quantum information of two trapped ions beyond the Lamb-Dicke limit

    International Nuclear Information System (INIS)

    Wei, L.F.; Nori, Franco

    2003-01-01

    Based on the exact conditional quantum dynamics for a two-ion system, we propose an efficient single-step scheme for coherently manipulating quantum information of two trapped cold ions by using a pair of synchronous laser pulses. Neither the auxiliary atomic level nor the Lamb-Dicke approximation are needed

  7. The delusion of the Master: the last days of Henry James.

    Science.gov (United States)

    Bartolomeo, Paolo

    2013-11-01

    The novelist Henry James shared with his brother William, the author of the Principles of Psychology, a deep interest in the ways in which personal identity is built through one's history and experiences. At the end of his life, Henry James suffered a vascular stroke in the right hemisphere and developed a striking identity delusion. He dictated in a perfectly clear and coherent manner two letters as if they were written by Napoleon Bonaparte. He also showed signs of reduplicative paramnesia. Negative symptoms resulting from right hemisphere damage may disrupt the feelings of "warmth and intimacy and immediacy" and the "resemblance among the parts of a continuum of feelings (especially bodily feelings)", which are the foundation of personal identity according to William James. On the other hand, a left hemisphere receiving inadequate input from the damaged right hemisphere may produce positive symptoms such as delusional, confabulatory narratives. Other fragments dictated during Henry James's final disease reveal some form of insight, if partial and disintegrated, into his condition. Thus, even when consciousness is impaired by brain damage, something of its deep nature may persist, as attested by the literary characteristics of the last fragments of the Master.

  8. La Vie et L'oeuvre d'Henri Wallon.

    Science.gov (United States)

    Aubrey, Carol

    1987-01-01

    Outlines the life and philosophy of noted French child psychologist, Henri Wallon (1879-1962). Reviews the philosophical origins of the Wallonian Approach including the theory of emotions, the development of representational thought, the role of imitation in the formation of representation, and the role of language in the development of thought…

  9. Potential Beneficial Effects of Tulbaghia violacea William Henry ...

    African Journals Online (AJOL)

    Tulbaghia violacea William Henry Harvey (Harv. Alliaceae) is a small bulbous herb belonging to the family Alliaceae. It is used in South Africa to treat fever, colds, asthma, paralysis, and hypertension. Meanwhile, cardiovascular disease accounts for about 30 % of total global death, with most of these deaths occurring in low ...

  10. NOAA Ship Henry B. Bigelow Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Henry B. Bigelow Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...

  11. Environmental liabilities in Billings reservoir and its impacts on hydropower generation Plant Henry Borden; Os passivos ambientais no reservatorio Billings e os seus impactos na geracao hidroenergetica da Usina Henry Borden

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Daniel Ladeira [Universidade Federal do ABC (UFABC), Santo Andre, SP (Brazil)

    2010-07-01

    The primary assertion is that this article argues that the recovery in production of hydropower in Henry Borden (UHB) is the reduction of environmental liabilities in the Billings reservoir. In this context, the aim of this paper is to provide a first consideration of the possibility of recovery of production Henry Borden hydropower plant of recovering the multiple uses of the reservoir. From this perspective, we interviewed representatives of CETESB (Sanitation Environmental Technology Company) and EMAE (Metropolitan Water and Energy Company SA) for consideration of actions that include environmental policies aimed at increasing the production of electricity in Henry Borden in order to obtain results that may contribute to the multiple uses of the Billings reservoir. Noting that the range of laws aimed at protecting the water sources was limited to disjointed public policy that has reduced the resilience of the Billings reservoir. (author)

  12. Implications of Two Well-Known Models for Instructional Designers in Distance Education: Dick-Carey versus Morrison-Ross-Kemp

    Science.gov (United States)

    Akbulut, Yavuz

    2007-01-01

    This paper first summarizes, and then compares and contrasts two well-known instructional design models: Dick and Carey Model (DC) and Morrison, Ross and Kemp model (MRK). The target audiences of both models are basically instructional designers. Both models have applications for different instructional design settings. They both see the…

  13. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine.

    Science.gov (United States)

    McVey Neufeld, Karen-Anne; Kay, Sebastian; Bienenstock, John

    2018-01-01

    Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST) and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair-BALB/c and Swiss Webster-with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  14. Iraagi olukorral on poliitiline lahendus / Henry A. Kissinger

    Index Scriptorium Estoniae

    Kissinger, Henry, 1923-

    2007-01-01

    USA endine riigisekretär Henry Kissinger kirjutab, et Ameerika Ühendriikide eesmärgiks peaks olema riikidevaheline kokkulepe, mis tunnistaks Iraagi rahvusvahelist staatust. See oleks vägivalla lõpetamiseks hea alus ja eeltingimuseks vägede väljaviimisele. Vt. samas: Ameerika Ühendriikide vahekokkuvõte Iraagi sõja kohta oli suhteliselt pessimistlik

  15. On the limit of Brans-Dicke theory when omega -> infinity

    CERN Document Server

    Chauvineau, B

    2003-01-01

    We discuss the problem of the limit of the Brans-Dicke theory (BDT) in the limit omega -> infinity, when the trace of the stress tensor is not zero. It is shown that a BDT solution, with T not = 0, known in the framework of anisotropic cosmology, fails to converge to the general relativity theory (GRT) corresponding solution. Considering the spherically symmetric field problem, it is shown that the argument leading to the convergence in the static case is lost when the non-static case is considered. These remarks suggest that the non-convergence of BDT to GRT could be the general behaviour, even if T not = 0, except for some (most?) of the highly symmetric solutions, including most of the known ones. The impact on gravitational radiation detection is emphasized.

  16. Comparison of the acute effects of Tulbaghia violacea William Henry ...

    African Journals Online (AJOL)

    William Henry Harvey (Alliaceae) on blood pressure and heart rate of ... (WKY), and compare the results obtained with those for adult spontaneously hypertensive rats (SHR). Methods: T. ... have similar secondary metabolites and biological ...

  17. Oxalate Content of the Herb Good-King-Henry, Blitum Bonus-Henricus

    Directory of Open Access Journals (Sweden)

    Wanying Li

    2015-05-01

    Full Text Available The total, soluble and insoluble oxalate contents of the leaves, stems and buds of Good-King-Henry (Blitum Bonus-Henricus were extracted and measured using HPLC chromatography. The large, mature leaves contained 42% more total oxalate than in the small leaves and the soluble oxalate content of the large leaves was 33% higher than the smaller leaves. Cooking the mixed leaves, stems and buds in boiling water for two minutes significantly (p < 0.05 reduced the total oxalate when compared to the raw plant parts. Pesto sauce made from mixed leaves contained 257 mg total oxalate/100 g fresh weight; this was largely made up of insoluble oxalates (85% of the total oxalate content. Soup made from mixed leaves contained lower levels of total oxalates (44.26 ± 0.49 mg total oxalate/100 g fresh weight and insoluble oxalate made up 49% of the oxalate contents. The levels of oxalates in the Good-King-Henry leaves were high, suggesting that the leaves should be consumed occasionally as a delicacy because of their unique taste rather than as a significant part of the diet. However, the products made from Good-King-Henry leaves indicated that larger amounts could be consumed as the oxalate levels were reduced by dilution and processing.

  18. c-Jun/AP-1 pathway-mediated cyclin D1 expression participates in low dose arsenite-induced transformation in mouse epidermal JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Zhang Dongyun; Li Jingxia; Gao Jimin; Huang Chuanshu

    2009-01-01

    Arsenic is a well-documented human carcinogen associated with skin carcinogenesis. Our previous work reveals that arsenite exposure is able to induce cell transformation in mouse epidermal cell JB6 Cl41 through the activation of ERK, rather than JNK pathway. Our current studies further evaluate downstream pathway in low dose arsenite-induced cell transformation in JB6 Cl41 cells. Our results showed that treatment of cells with low dose arsenite induced activation of c-Jun/AP-1 pathway, and ectopic expression of dominant negative mutant of c-Jun (TAM67) blocked arsenite-induced transformation. Furthermore, our data indicated that cyclin D1 was an important downstream molecule involved in c-Jun/AP-1-mediated cell transformation upon low dose arsenite exposure, because inhibition of cyclin D1 expression by its specific siRNA in the JB6 Cl41 cells resulted in impairment of anchorage-independent growth of cells induced by low dose arsenite. Collectively, our results demonstrate that c-Jun/AP-1-mediated cyclin D1 expression is at least one of the key events implicated in cell transformation upon low dose arsenite exposure

  19. 2. Robin Attfield Henry Odera Oruka, Ecophilosophy and Climate ...

    African Journals Online (AJOL)

    Attfield

    Henry Odera Oruka, ecophilosophy, climate change ethics, impacts of climate ... One of the fields of environmental philosophy which he would almost ... engineering, and on “Humanity's Carbon Budget”, followed by Conclusions about ... countries that are largely responsible for these emissions must take the lion's share of.

  20. Metallic nickel nano- and fine particles induce JB6 cell apoptosis through a caspase-8/AIF mediated cytochrome c-independent pathway

    Directory of Open Access Journals (Sweden)

    Castranova Vincent

    2009-04-01

    Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death

  1. Henry Fuseli’s Alternative Classicism

    Directory of Open Access Journals (Sweden)

    Martin Myrone

    2015-12-01

    Full Text Available The review considers Andrei Pop’s Antiquity, Theatre & The Painting of Henry Fuseli. This argues for the history painter and writer Fuseli as an exemplary ‘Neopagan’, a term coined by Pop to refer to the new sense of cultural pluralism and historical relativism which emerged in Europe after the discovery of the remains of Pompeii and Herculaneum in 1748. While this perspective offers a fresh view of the artist, relating him to the emergence of modernity, and illuminates some important aspects of his work, the reviewer also suggests that the monographic focus risks re-asserting a sense of Fuseli’s exceptionalism.

  2. Henry constants in polymer solutions with the van der Waals equation of state

    DEFF Research Database (Denmark)

    Bithas, Sotiris; Kalospiros, Nikolaos; Kontogeorgis, Georgios

    1996-01-01

    parameter is satisfactory, with typical errors within the experimental uncertainty and comparable to those with the more complex Perturbed Hard Chain Theory-based equations of state with the same number of adjustable parameters. A predictive scheme for calculating Henry constants is also presented, which...... is a corresponding-states correlation for a dimensionless Henry constant defined based on the van der Waals equation of state. Satisfactory results-often close to the ones from the one-parameter correlation-are obtained for all systems investigated in this work. Compared with literature models that have been applied...

  3. Dynamics of axial symmetric system in self-interacting Brans-Dicke gravity

    International Nuclear Information System (INIS)

    Sharif, M.; Manzoor, Rubab

    2016-01-01

    This paper investigates the dynamics of an axial reflection symmetric model in self-interacting Brans-Dicke gravity for anisotropic fluid. We formulate hydrodynamical equations and discuss oscillations using a time-dependent perturbation for both spin-dependent and spin-independent cases. The expressions of the frequency, the total energy density, and the equation of motion of the oscillating model are obtained. We study the instability of the oscillating models in weak approximations. It is found that the oscillations and stability of the model depend upon the dark energy source along with anisotropy and reflection effects. We conclude that the axial reflection system remains stable for stiffness parameter Γ = 1, collapses for Γ > 1, and becomes unstable for 0 < Γ < 1. (orig.)

  4. Dynamics of axial symmetric system in self-interacting Brans-Dicke gravity

    Energy Technology Data Exchange (ETDEWEB)

    Sharif, M. [University of the Punjab, Department of Mathematics, Lahore (Pakistan); Manzoor, Rubab [University of Management and Technology, Department of Mathematics, Lahore (Pakistan)

    2016-06-15

    This paper investigates the dynamics of an axial reflection symmetric model in self-interacting Brans-Dicke gravity for anisotropic fluid. We formulate hydrodynamical equations and discuss oscillations using a time-dependent perturbation for both spin-dependent and spin-independent cases. The expressions of the frequency, the total energy density, and the equation of motion of the oscillating model are obtained. We study the instability of the oscillating models in weak approximations. It is found that the oscillations and stability of the model depend upon the dark energy source along with anisotropy and reflection effects. We conclude that the axial reflection system remains stable for stiffness parameter Γ = 1, collapses for Γ > 1, and becomes unstable for 0 < Γ < 1. (orig.)

  5. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine

    Directory of Open Access Journals (Sweden)

    Karen-Anne McVey Neufeld

    2018-05-01

    Full Text Available Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair—BALB/c and Swiss Webster—with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  6. The Transformative Intellectual: An Examination of Henry Giroux's Ethics

    Science.gov (United States)

    Kashani, Tony

    2012-01-01

    This article explores Henry Giroux's contributions to critical pedagogy. The author demonstrates how Giroux, as a public intellectual, has found his Ethics in the right place. The author further argues that Giroux's Ethics of virtue are present not only in the public person but also in his transformative writing.

  7. Henri Becquerel and the discovery of natural radioactivity

    International Nuclear Information System (INIS)

    Barquins, M.

    2003-01-01

    This article presents the life and achievements of Henri Becquerel particularly in the domain of natural radioactivity which he discovered. In 1903 H.Becquerel was awarded the Nobel prize of physics (jointly with the Curies). The author highlights the importance of his talent but also the influence of his family background: his grand-father and father were both renowned scientists

  8. NOAA Ship Henry B. Bigelow Underway Meteorological Data, Near Real Time

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Henry B. Bigelow Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System...

  9. M. Pirgerou on D. Izzo and C. Martinez’s Revisionary Interventions into Henry James

    Directory of Open Access Journals (Sweden)

    2009-07-01

    Full Text Available Donatella Izzo and Carlo Martinez. Revisionary Interventions Into Henry James. Eds. Napoli, 2008. Revisionary Interventions into Henry James is a compilation of a series of papers presented at a colloquium which took place at Università Orientale in Naples, Italy, on October 27, 2006. In her introduction to the volume, Donatella Izzo acknowledges the “rather blatant plagiarism” (7 which lent the book its title.  The borrowing, of course, refers to Donald Pease’s landmark Revisionary Interve...

  10. Resonances of the confined hydrogen atom and the Lamb-Dicke effect in non-relativistic qed

    DEFF Research Database (Denmark)

    Faupin, Jeremy

    2008-01-01

    We study a model describing a system of one dynamical nucleus and one electron confined by their center of mass and interacting with the quantized electromagnetic field. We impose an ultraviolet cutoff and assume that the fine-structure constant is sufficiently small. Using a renormalization grou...... method (based on [3, 4]), we prove that the unperturbed eigenvalues turn into resonances when the nucleus and the electron are coupled to the radiation field. This analysis is related to the Lamb–Dicke effect....

  11. Rahvaliit : Henri Kaselo süüdistus on idiootsus / Jüri Saar

    Index Scriptorium Estoniae

    Saar, Jüri, 1946-

    2008-01-01

    Keskerakonna Tartumaa piirkonna esimeheks valitud Tartu linnavolinik Henri Kaselo kritiseeris teravalt Rahvaliitu kuuluvaid Tartumaa vallajuhte, kelle juhtimisstiil ja korruptiivne poliitika polevat nõukogude ajast muutunud

  12. Copper-Mediated Reactions of Nitriles with Nitromethanes: Aza-Henry Reactions and Nitrile Hydrations.

    Science.gov (United States)

    Kuwabara, Jun; Sawada, Yoshiharu; Yoshimatsu, Mitsuhiro

    2018-02-16

    In this study, the first aza-Henry reaction of nitriles with nitromethane in a CuI/Cs 2 CO 3 /DBU system is described. The process was conveniently and directly used for the synthesis of β-aminonitroalkenes 2a-x and tolerated aryl-, alkyl-, hetaryl-, alkenyl-, and alkynylnitriles. The resulting aminonitroalkenes 2 could be successfully transformed to the corresponding 2-nitroacetophenones, 2-amino-1-halonitroalkenes, 2-alkylaminonitroalkenes, or 3-nitropyridines. In the presence of H 2 O, the aza-Henry reaction turned the reaction path to the nitrile hydration to exclusively yield the amides 3a-s.

  13. Henri Fayol’un Yönetim Düşüncesi Üzerine Notlar(Notes on Managerial Thought of Henry Fayol)

    OpenAIRE

    Ramazan ŞENGÜL

    2007-01-01

    Henri Fayol, developed a managerial approach which is a perfect guide for both private and public sectors through focusing systematically upon managerial process. A major advantage of Fayol in creating a general managerial doctrine was his pratician side. His managerial thought which was developed in the early 20th century lasted up to our times. The distinguished characteristic of Fayol’s thought was studying the administrative reality through separating it into its functions, in that it hel...

  14. Henri Pirenne: Historian and Man of the World

    Directory of Open Access Journals (Sweden)

    Sarah Keymeulen

    2016-12-01

    Full Text Available Henri Pirenne (1862-1935 is generally recognised as one of the most influential European historians of the late nineteenth- and early twentieth-century. The combination of his scholarly activity with the social mission that he set himself earned him an extraordinarily successful career and a double reputation: at least in Belgium, he was regarded not only as a ‘father of history’, but also as great citizen. Although his influence was unmistakably large, there is no consensus about the existence or the nature of a ‘Pirennian persona’. He combined the ideal collection of skills, values and standards required of historians with very specific personal characteristics. At the same time he was inextricably linked to a certain era and a certain Belgium that died with him. Pirenne therefore, did not so much represent a new type of scientific persona as the prestige of an idealised, long-vanished Belgium and its corresponding academic culture. Henri Pirenne. Historicus en man van de wereldHenri Pirenne (1862-1935 wordt beschouwd als één van de meest invloedrijke Europese geschiedschrijvers van de laatnegentiende en vroegtwintigste eeuw. Het verband tussen zijn wetenschappelijke activiteit en de maatschappelijke taak die hij voor zichzelf zag weggelegd, leverde hem een uitzonderlijk succesvolle carrière en een dubbele reputatie op. Pirenne staat, althans in België, immers niet alleen geboekstaafd als een ‘vader van de geschiedenis’, maar ook als een groot staatsburger. Hoewel de invloed van Pirenne onmiskenbaar groot is geweest, is er geen consensus over het bestaan of de aard van een ‘pirenniaanse persona’. Hij combineerde het ideaalpakket van vaardigheden, normen en waarden die historici werden geacht te bezitten met zeer specifieke karaktereigenschappen. Tegelijk was hij onlosmakelijk verknoopt met een zeker tijdsgewricht en een zeker België, dat samen met hem ter ziele ging. Pirenne stond dan ook niet zozeer model voor een nieuw

  15. Henri Pirenne: Historian and Man of the World.

    Directory of Open Access Journals (Sweden)

    S. Keymeulen

    2016-12-01

    Full Text Available Henri Pirenne (1862-1935 is generally recognised as one of the most influential European historians of the late nineteenth- and early twentieth-century. The combination of his scholarly activity with the social mission that he set himself earned him an extraordinarily successful career and a double reputation: at least in Belgium, he was regarded not only as a ‘father of history’, but also as great citizen. Although his influence was unmistakably large, there is no consensus about the existence or the nature of a ‘Pirennian persona’. He combined the ideal collection of skills, values and standards required of historians with very specific personal characteristics. At the same time he was inextricably linked to a certain era and a certain Belgium that died with him. Pirenne therefore, did not so much represent a new type of scientific persona as the prestige of an idealised, long-vanished Belgium and its corresponding academic culture. Henri Pirenne. Historicus en man van de wereld. Henri Pirenne (1862-1935 wordt beschouwd als één van de meest invloedrijke Europese geschiedschrijvers van de laatnegentiende en vroegtwintigste eeuw. Het verband tussen zijn wetenschappelijke activiteit en de maatschappelijke taak die hij voor zichzelf zag weggelegd, leverde hem een uitzonderlijk succesvolle carrière en een dubbele reputatie op. Pirenne staat, althans in België, immers niet alleen geboekstaafd als een ‘vader van de geschiedenis’, maar ook als een groot staatsburger. Hoewel de invloed van Pirenne onmiskenbaar groot is geweest, is er geen consensus over het bestaan of de aard van een ‘pirenniaanse persona’. Hij combineerde het ideaalpakket van vaardigheden, normen en waarden die historici werden geacht te bezitten met zeer specifieke karaktereigenschappen. Tegelijk was hij onlosmakelijk verknoopt met een zeker tijdsgewricht en een zeker België, dat samen met hem ter ziele ging. Pirenne stond dan ook niet zozeer model voor een nieuw

  16. Henri Becquerel: the discovery of radioactivity

    International Nuclear Information System (INIS)

    Allisy, A.

    1996-01-01

    This paper recalls the history of the Becquerel family, the fascinating time of the discovery of radioactivity as well as some important related research published before the radium age. Henri Becquerel was the third in the line of a family of scientists which extended over more than a hundred years. Following in the footsteps of his father and grandfather gave him a thorough grounding in scientific research methods. Science at the turn of the century was very exciting, the discovery of X rays had just been announced and scientists everywhere were hoping to discover new phenomena. (author)

  17. The Failed Educations of John Stuart Mill and Henry Adams.

    Science.gov (United States)

    Crossley, Robert

    1979-01-01

    Analyzes and contrasts Mill's "Autobiography" and Adams'"The Education of Henry Adams" in order to present two approaches to the nature of education and of failure. Maintains that their perspectives may serve as catalysts and cautions for contemporary theories of education and its utility and relevance. (CAM)

  18. Comparison of the acute effects of Tulbaghia violacea William Henry ...

    African Journals Online (AJOL)

    Purpose: To assess the effect of the crude methanol leaf extracts of Tulbaghia violacea William Henry Harvey (Alliaceae) on blood pressure (BP) and heart rate in ageing normotensive Wistar Kyoto rats (WKY), and compare the results obtained with those for adult spontaneously hypertensive rats (SHR). Methods: T.

  19. 2008 USGS Lidar: Twelve County, Illinois (Grundy, Kane, McHenry only)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This LiDAR data is within Illinois Department of Transportation districts 1 and 3 covering Grundy, Kane and McHenry counties. The data is updated from its original...

  20. Should bulk cloudwater or fogwater samples obey Henry's law

    Energy Technology Data Exchange (ETDEWEB)

    Pandis, S.N.; Seinfeld, J.H. (Department of Chemical Engineering and Environmental Quality Laboratory, California Institute of Technology, Pasadena, CA (USA))

    1991-06-20

    In this work we prove that mixing of droplets with different {ital p}H that are individually in Henry's law equilibrium with the surrounding atmosphere always results in a bulk mixture that is supersaturated with weak acids like S(IV) and HCOOH and bases like NH{sub 3} with respect to the original atmosphere. The degree of supersaturation of the bulk liquid water sample for a particular species depends on its dissociation constant, on the initial {ital p}H of the bulk droplet mixture, and on the distribution of the {ital p}H and of the liquid water over the droplet spectrum. High supersaturations result only when the {ital p}H of the bulk droplet mixture exceeds the {ital p}K{sub {ital a}} of the species, in which {ital p}H range large {ital p}H differences among droplets of different sizes lead to large deviations from Henry's law for the bulk mixture. The deviation is shown to depend on the ratio of the arithmetic mean to the harmonic mean of the hydrogen ion concentrations of the droplets with the liquid water content used was weighting factor in the calculation of the means. The theory developed can explain observed discrepancies from Henry's law in atmospheric samples and also other observed phenomena like the reported increase of {ital p}H values of bulk aqueous samples during storage. {copyright} American Geophysical Union 1991

  1. The personality of Henry Cavendish a great scientist with extraordinary peculiarities

    CERN Document Server

    McCormmach, Russell

    2014-01-01

    This book explores the 18th century natural philosopher Henry Cavendish, best known for his work in chemistry and physics. It traces aspects of his personality, views and interpretations of him, and explores notions of eccentricity and autism.

  2. Spin squeezing as an indicator of quantum chaos in the Dicke model.

    Science.gov (United States)

    Song, Lijun; Yan, Dong; Ma, Jian; Wang, Xiaoguang

    2009-04-01

    We study spin squeezing, an intrinsic quantum property, in the Dicke model without the rotating-wave approximation. We show that the spin squeezing can reveal the underlying chaotic and regular structures in phase space given by a Poincaré section, namely, it acts as an indicator of quantum chaos. Spin squeezing vanishes after a very short time for an initial coherent state centered in a chaotic region, whereas it persists over a longer time for the coherent state centered in a regular region of the phase space. We also study the distribution of the mean spin directions when quantum dynamics takes place. Finally, we discuss relations among spin squeezing, bosonic quadrature squeezing, and two-qubit entanglement in the dynamical processes.

  3. Study of Antigravity in an F(R) Model and in Brans-Dicke Theory with Cosmological Constant

    OpenAIRE

    Oikonomou, V. K.; Karagiannakis, N.

    2014-01-01

    We study antigravity, that is having an effective gravitational constant with a negative sign, in scalar-tensor theories originating from $F(R)$-theory and in a Brans-Dicke model with cosmological constant. For the $F(R)$ theory case, we obtain the antigravity scalar-tensor theory in the Jordan frame by using a variant of the Lagrange multipliers method and we numerically study the time dependent effective gravitational constant. As we shall demonstrate by using a specific $F(R)$ model, altho...

  4. Shear-free axial model in massive Brans–Dicke gravity

    Energy Technology Data Exchange (ETDEWEB)

    Sharif, M., E-mail: msharif.math@pu.edu.pk [Department of Mathematics, University of the Punjab, Quaid-e-Azam Campus, Lahore-54590 (Pakistan); Manzoor, Rubab, E-mail: rubab.manzoor@umt.edu.pk [Department of Mathematics, University of the Punjab, Quaid-e-Azam Campus, Lahore-54590 (Pakistan); Department of Mathematics, University of Management and Technology, Johar Town Campus, Lahore-54782 (Pakistan)

    2017-01-15

    This paper explores the influences of dark energy on the shear-free axially symmetric evolution by considering self-interacting Brans–Dicke gravity as a dark energy candidate. We describe energy source of the model and derive all the effective dynamical variables as well as effective structure scalars. It is found that scalar field is one of the sources of anisotropy and dissipation. The resulting effective structure scalars help to study the dynamics associated with dark energy in any axial configuration. In order to investigate shear-free evolution, we formulate a set of governing equations along with heat transport equation. We discuss consequences of shear-free condition upon different SBD fluid models like dissipative non-geodesic and geodesic models. For dissipative non-geodesic case, the rotational distribution turns out to be the necessary and sufficient condition for radiating model. The dissipation depends upon inhomogeneous expansion. The geodesic model is found to be irrotational and non-radiating. The non-dissipative geodesic model leads to FRW model for positive values of the expansion parameter.

  5. Results of neutron physics analyses of WWER-440 cores with modified reactor protection and control systems

    International Nuclear Information System (INIS)

    Lehmann, M.; Pecka, M.; Rocek, J.; Zalesky, K.

    1993-12-01

    Detailed results are given of neutron physics analyses performed to assess the efficiency and acceptability of modifications of the WWER-440 core protection and control system; the modifications have been proposed with a view to increasing the proportion of mechanical control in the compensation of reactivity effects during reactor unit operation in the variable load mode. The calculations were carried out using the modular MOBY-DICK macrocode system together with the SMV42G36 library of two-group parametrized diffusion constants, containing corrections which allow new-design WWER-440 fuel assemblies to be discriminated. (J.B). 37 tabs., 18 figs., 5 refs

  6. In praise of the literary eponym--Henry V sign.

    LENUS (Irish Health Repository)

    Shanahan, F

    2013-01-01

    The use of eponyms in medicine is often discouraged. However, the literary eponym should be an exception as it is not linked with many of the difficulties associated with conventional eponyms and offers descriptive brevity and accuracy. Here, we illustrate the point with Henry V sign, which will be familiar to many who have cared for patients in the terminal stage of illness.

  7. Macroscopic Quantum States and Quantum Phase Transition in the Dicke Model

    International Nuclear Information System (INIS)

    Lian Jin-Ling; Zhang Yuan-Wei; Liang Jiu-Qing

    2012-01-01

    The energy spectrum of Dicke Hamiltonians with and without the rotating wave approximation for an arbitrary atom number is obtained analytically by means of the variational method, in which the effective pseudo-spin Hamiltonian resulting from the expectation value in the boson-field coherent state is diagonalized by the spin-coherent-state transformation. In addition to the ground-state energy, an excited macroscopic quantum-state is found corresponding to the south- and north-pole gauges of the spin-coherent states, respectively. Our results of ground-state energies in exact agreement with various approaches show that these models exhibit a zero-temperature quantum phase transition of the second order for any number of atoms, which was commonly considered as a phenomenon of the thermodynamic limit with the atom number tending to infinity. The critical behavior of the geometric phase is analyzed. (general)

  8. SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc

    International Nuclear Information System (INIS)

    Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.

    2012-01-01

    We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core

  9. Taxing junk food: applying the logic of the Henry tax review to food.

    Science.gov (United States)

    Bond, Molly E; Williams, Michael J; Crammond, Brad; Loff, Bebe

    2010-10-18

    The recent review of taxation in Australia - the Henry tax review - has recommended that the federal government increase the taxes already levied on tobacco and alcohol. Tobacco and alcohol taxes are put forward as the best way of reducing the social harms caused by the use and misuse of these substances. Junk foods have the same pattern of misuse and the same social costs as tobacco and alcohol. The Henry tax review rejects the idea of taxing fatty foods, and to date the government has not implemented a tax on junk food. We propose that a tax on junk food be implemented as a tool to reduce consumption and address the obesity epidemic.

  10. Teaching the “Grandsons of Balzac” a Lesson: Henry James in the 1890’s

    Directory of Open Access Journals (Sweden)

    Dennis F. TREDY

    2004-06-01

    Full Text Available Lyall H. Powers, in Henry James and the Naturalist Movement, dubs the period spanning from “The Art of Fiction” in 1884 to The Tragic Muse in 1890 Henry James’s “Naturalist Experiment”, and rightfully so (Powers 3. There is much evidence, in James’s own notebooks, that The Bostonians was influenced by Daudet’s L’Évangeliste, The Princess Casamassima by Turgeneff’s Virgin Soil, and The Tragic Muse by the narrative techniques of Maupassant (NB 47, Powers 91, NB 92, and Powers effectively show...

  11. Basic Fibroblast Growth Factor Regulates Persistent ERK Osciliations in Premaligant but not Malignant JB6 Cells

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.

    2010-05-02

    basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.

  12. Staging Henry Fielding: The Author-Narrator in Tom Jones On Screen

    Directory of Open Access Journals (Sweden)

    Eli Løfaldli

    2017-06-01

    Full Text Available As recent adaptation theory has shown, classic-novel adaptation typically sets issues connected to authorship and literal and figurative ownership into play. This key feature of such adaptations is also central to the screen versions of Henry Fielding’s Tom Jones (1749. In much of Fielding’s fiction, the narrator, typically understood as an embodiment of Fielding himself, is a particularly prominent presence. The author-narrator in Tom Jones is no exception: not only is his presence strongly felt throughout the novel, but through a variety of means, ‘The History of Tom Jones, A Foundling’ is also distinctly marked as being under his control and ownership. The two adaptations of Fielding’s novel, a 1963 film and a 1997 television series, both retain the figure of the author-narrator, but differ greatly in their handling of this device and its consequent thematic ramifications. Although the 1963 film de-emphasises Henry Fielding’s status as proprietor of the story, the author-narrator as represented in the film’s voiceover commentary is a figure of authority and authorial control. In contrast, the 1997 adaptation emphasises Fielding’s ownership of the narrative and even includes the author-narrator as a character in the series, but this ownership is undermined by the irreverent treatment to which he is consistently subjected. The representations of Henry Fielding in the form of the author-narrator in both adaptations are not only indicative of shifting conceptions of authorship, but also of the important interplay between authorship, ownership and adaptation more generally.

  13. Ricardo Guilherme Dicke e o processo de transculturação na l iteratura

    Directory of Open Access Journals (Sweden)

    Adriana Lins Precioso

    2014-01-01

    Full Text Available The article presents a brief overview of the emergence of the cultural studies in England, the concepts of Stuart Hall and the appropriation of these searches by the literary studies, mainly in Latin America represented through the contributions of Ángel R ama. To exemplify this proposal, we analyze excerpts of the short stories „Toada do Esquecido‟ (2006, „Sinfonia equestre‟ (2006, „A proximidade do mar‟ (2011, „O Velho Moço‟ (2011 and „A perseguição‟ (2011, by Ricardo Guilherme Dicke, writer from the state of Mato Grosso, who promotes the dialogue between regional and global issues by the transculturation bias.

  14. [From apprenticeship to Nobel Prize: Henri Moissan's fabulous destiny].

    Science.gov (United States)

    Lafont, O

    2008-01-01

    Born in Paris on September 28, 1852, son of an eastern railways' employee and of a dressmaker, Henri Moissan's secondary schooling in Meaux did not allow him to get access to the sesame diploma "baccalauréat" (GCE). In 1869, he did obtain a special certificate of secondary schooling so that he could become an apprentice in watch making. That could have been the end of the story, but dreadful event for France appeared to have beneficial effects for Moissan. Under the threat of the Prussian army, Moissan's family took refuge near Paris. This gave the young Henri the opportunity to register as a student for the second-class pharmacy diploma, which did not need, at the time, the GCE. Moissan became then a trainee in pharmacy in 1871. Meanwhile, he followed the special schooling of "Ecole de chimie" founded by E. Frémy, and then joined the laboratory of Dehérain at the Museum, where he worked in plant physiology. He finally obtained the famous "baccalauréat" (GCE) and could register as a student in first-class pharmacy. He became a pharmacist as well as a doctor in sciences. In 1883, Moissan was named professor at the school of pharmacy in Paris. In 1886, he isolated fluorine by electrolysis of fluorhydric acid, in the presence of potassium fluoride, at a low temperature. He then studied diamond synthesis and gave a start to high temperature chemistry, designing his famous furnace. These findings and many others allowed Moissan to rise to membership in many learned academies around the world. Crowning achievement, Moissan won the Nobel Prize in 1906. A man of culture, collector of autographs and paintings, he died in 1907. Nothing of that would have been possible if there had not been a second-class pharmacist diploma. The history of Henri Moissan is one of a rise from apprenticeship to the Nobel Prize.

  15. The last ride of Henry II of France: orbital injury and a king's demise.

    Science.gov (United States)

    Eftekhari, Kian; Choe, Christina H; Vagefi, M Reza; Eckstein, Lauren A

    2015-01-01

    Jousting was a popular pastime for royalty in the Renaissance era. Injuries were common, and the eye was particularly at risk from the splinters of the wooden lance. On June 30, 1559, Henry II of France participated in a jousting tournament to celebrate two royal weddings. In the third match, Gabriel de Montgomery struck Henry on the right shoulder and the lance splintered, sending wooden shards into his face and right orbit. Despite being cared for by the prominent physicians Ambroise Paré and Andreas Vesalius, the king died 10 days later and was found to have a cerebral abscess. The wound was not explored immediately after the injury; nevertheless, wooden foreign bodies were discovered in the orbit at the time of autopsy. The dura had not been violated, suggesting that an infection may have traveled from the orbit into the brain. Nostradamus and Luca Guarico, the astrologer to the Medici family, had prophesied the death of Henry II of France, but he ignored their warnings and thus changed the course of history in Renaissance Europe. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Intermediate accelerated solutions as generic late-time attractors in a modified Jordan-Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Cid, Antonella [Grupo de Cosmología y Gravitación GCG-UBB and Departamento de Física, Universidad del Bío-Bío, Casilla 5-C, Concepción (Chile); Leon, Genly [Instituto de Física, Pontificia Universidad Católica de Valparaíso, Casilla 4950, Valparaíso (Chile); Leyva, Yoelsy, E-mail: acidm@ubiobio.cl, E-mail: genly.leon@ucv.cl, E-mail: yoelsy.leyva@uta.cl [Departamento de Física, Facultad de Ciencias, Universidad de Tarapacá, Casilla 7-D, Arica (Chile)

    2016-02-01

    In this paper we investigate the evolution of a Jordan-Brans-Dicke scalar field, Φ, with a power-law potential in the presence of a second scalar field, φ, with an exponential potential, in both the Jordan and the Einstein frames. We present the relation of our model with the induced gravity model with power-law potential and the integrability of this kind of models is discussed when the quintessence field φ is massless, and has a small velocity. The fact that for some fine-tuned values of the parameters we may get some integrable cosmological models, makes our choice of potentials very interesting. We prove that in Jordan-Brans-Dicke theory, the de Sitter solution is not a natural attractor. Instead, we show that the attractor in the Jordan frame corresponds to an ''intermediate accelerated'' solution of the form a(t) ≅ e{sup α{sub 1} t{sup p{sup {sub 1}}}}, as t → ∞ where α{sub 1} > 0 and 0 < p{sub 1} < 1, for a wide range of parameters. Furthermore, when we work in the Einstein frame we get that the attractor is also an ''intermediate accelerated'' solution of the form a(t) ≅ e{sup α{sub 2} tp{sub 2}} as t → ∞ where α{sub 2} > 0 and 0

  17. Intermediate accelerated solutions as generic late-time attractors in a modified Jordan-Brans-Dicke theory

    International Nuclear Information System (INIS)

    Cid, Antonella; Leon, Genly; Leyva, Yoelsy

    2016-01-01

    In this paper we investigate the evolution of a Jordan-Brans-Dicke scalar field, Φ, with a power-law potential in the presence of a second scalar field, φ, with an exponential potential, in both the Jordan and the Einstein frames. We present the relation of our model with the induced gravity model with power-law potential and the integrability of this kind of models is discussed when the quintessence field φ is massless, and has a small velocity. The fact that for some fine-tuned values of the parameters we may get some integrable cosmological models, makes our choice of potentials very interesting. We prove that in Jordan-Brans-Dicke theory, the de Sitter solution is not a natural attractor. Instead, we show that the attractor in the Jordan frame corresponds to an ''intermediate accelerated'' solution of the form a(t) ≅ e α 1  t p 1 , as t → ∞ where α 1  > 0 and 0 < p 1  < 1, for a wide range of parameters. Furthermore, when we work in the Einstein frame we get that the attractor is also an ''intermediate accelerated'' solution of the form a(t) ≅ e α 2  tp 2 as t → ∞ where α 2  > 0 and 0

  18. Beïnvloeding van snelheidsgedrag door nudging : vragenlijstonderzoek naar het effect van Dick Bruna-borden op geschatte rijsnelheid binnen de bebouwde kom.

    NARCIS (Netherlands)

    Goldenbeld, C. Groot-Mesken, J. de & Rijsdijk, H.A.

    2016-01-01

    Influencing speed behaviour by nudging : questionnaire study into the effect of Dick Bruna1 traffic signs on the estimated driving speeds in urban areas. Speed is an important risk factor in traffic. Measurements within urban areas on 30- and 50 km/hour roads show that the percentage of speeders on

  19. Kierkegaard se, drei grossen ideen” en die ini- siasie van henry van eeden (sewe dae b y die silbersteins

    Directory of Open Access Journals (Sweden)

    L. S. Venter

    1977-03-01

    Full Text Available Die doel van Henry se verblyf by die Silbersteins word vroeg in Sewe dae verwoord as Jock tydens die eerste aandbyeenkoms sê dat Henry „van sekere gevestigde idees” (p. 16 ontslae moet raak. Ook mrs. Silberstein beskou dit as noodsaaklik dat sy on­ skuld vemietig moet word (p. 22. Op die oggendwandeling van die tweede dag herhaal Jock sy stelling van die vorige aand en voeg daaraan toe dat daar baie dinge is wat Henry ,,sal moet leer en verleer” (p. 28. Vir die modeme mens, wat „van die vrug van kennis geëet” het, is daar „geen illussies meer nie” (p. 32.

  20. Henri Wallon's Theory of Early Child Development: The Role of Emotions.

    Science.gov (United States)

    Van der Veer, Rene

    1996-01-01

    Discusses the stage theory of early child development of French theorist Henri Wallon. Describes Wallon's efforts (in contrast to contemporary Piaget) to describe emotional development and the role emotions play in establishing the child-caregiver bond. Argues that Wallon's theory is unique in its focus, influenced theorists such as Vygotsky, and…

  1. The Critical Point Entanglement and Chaos in the Dicke Model

    Directory of Open Access Journals (Sweden)

    Lina Bao

    2015-07-01

    Full Text Available Ground state properties and level statistics of the Dicke model for a finite number of atoms are investigated based on a progressive diagonalization scheme (PDS. Particle number statistics, the entanglement measure and the Shannon information entropy at the resonance point in cases with a finite number of atoms as functions of the coupling parameter are calculated. It is shown that the entanglement measure defined in terms of the normalized von Neumann entropy of the reduced density matrix of the atoms reaches its maximum value at the critical point of the quantum phase transition where the system is most chaotic. Noticeable change in the Shannon information entropy near or at the critical point of the quantum phase transition is also observed. In addition, the quantum phase transition may be observed not only in the ground state mean photon number and the ground state atomic inversion as shown previously, but also in fluctuations of these two quantities in the ground state, especially in the atomic inversion fluctuation.

  2. Henri Fayol, théoricien de l’entreprise innovante

    OpenAIRE

    Hatchuel , Armand; Segrestin , Blanche

    2016-01-01

    International audience; Have we correctly read Henri Fayol? His work is still reduced to general principles of administration that seem rigid and trivial. Yet, he has been a great innovative leader that considered scientific research as a major task of the business executive. A new reading of Fayol's masterpiece shows that he introduced sophisticated notions: " the unknown " , " the program of action " , " the advancement " , which meaning was erased by his translators or forgotten. Coming fr...

  3. Enter the Madcap Prince of Wales: Students Directing "Henry IV, Part I."

    Science.gov (United States)

    Earthman, Elise Ann

    1993-01-01

    Argues that William Shakespeare's "Henry IV, Part I" is an appropriate and useful text for secondary English classrooms. Shows how the play lends itself to performance-based instruction. Outlines ways of accomplishing student engagement, using film versions, and assigning written work. (HB)

  4. Strelku vsjo ravno perevedut. No v kakuju storonu? / Henry Posner ; interv. Eteri Kekelidze

    Index Scriptorium Estoniae

    Posner, Henry

    2006-01-01

    Eesti Raudtee üks erastajaist, RDC juht Henry Posner III meenutab ER erastamist 2001. a., investeeringutest, reeglite muutmisest, Eesti Raudtee müümise põhjustest, Eesti transiidi tulevikust. Diagramm: Eesti Raudtee kasum 1998-2004

  5. The Royal Entries of Henry VI in a London Civic Manuscript

    DEFF Research Database (Denmark)

    Bourassa, Kristin

    2016-01-01

    London Metropolitan Archives, MS Letter Book K, contains descriptions of Henry VI’s royal entries into both Paris (1431) and London (1432). Their placement one after the other in a London Letter Book was likely the work of the city’s common clerk, John Carpenter, who was the author of the descrip...

  6. Mounting a Curricular Revolution: An Interview with Henry Louis Gates, Jr.

    Science.gov (United States)

    von Zastrow, Claus

    2009-01-01

    This article presents an interview with Henry Louis Gates, Jr., Harvard professor and cultural critic who has captured 25 million viewers with his PBS documentary series, African American Lives (WNET). Using genealogical research and DNA science, Gates traces the family history of 19 famous African Americans. What results is a rich and moving…

  7. Henry Evelyn Bliss--The Other Immortal, or a Prophet without Honour?

    Science.gov (United States)

    Broughton, Vanda

    2008-01-01

    The paper takes a retrospective look at the work of Henry Evelyn Bliss, classificationist theorist and author of the "Bibliographic Classification". Major features of his writings and philosophy are examined and evaluated for the originality of their contribution to the corpus of knowledge in the discipline. Reactions to Bliss's work are analysed,…

  8. HENRY C. WALLICH: A THIRD GENERATION BANKER

    Directory of Open Access Journals (Sweden)

    Saul Engelbourg

    2001-01-01

    Full Text Available Born in Germany and descendant of a wealthy banking family, Henry C. Wallich emigrated to the United States like others of Jewish ancestry who fled during the 1930s. A professor of money and banking at Yale for two decades, Wallich capped his career as a Governor of the Federal Reserve. During the stagflation of the late 1960s, Wallich, a dissenter, tirelessly advocated tighter monetary policy to stem inflation. Always a scholar, Wallich published extensively; he also served as the Fed’s public spokesman. Owing to his Harvard doctorate and his eminence as an economist, Wallich knew everyone worth knowing in the economics profession.

  9. Henri de Régnier portraitiste du Parnasse

    OpenAIRE

    Mortelette, Yann

    2016-01-01

    Henri de Régnier disait de José-Maria de Heredia qu’il avait fait le lien entre le Parnasse et le symbolisme. Lui-même fit le lien entre le symbolisme et le Parnasse. En 1895, il notait dans son journal intime : « J’ai subi de grandes influences. Aux premiers jours, Mallarmé m’a […] nettoyé l’esprit ; j’en ai été affiné et ankylosé. Puis j’ai subi les contacts plus vivants d’Heredia. » Cette seconde influence contrebalança la première. Régnier fréquenta les samedis de la rue Balzac avec autan...

  10. Validade da equação de Henry e Rees que estima a taxa metabólica de repouso em adolescentes masculinos Validez de la ecuación de Henry y Rees que estima la tasa metabólica de reposo en adolescentes masculinos Validity of the equation of Henry and Rees that estimates the resting metabolic rate in male adolescents

    Directory of Open Access Journals (Sweden)

    Paulo Henrique S. Fonseca

    2011-06-01

    Full Text Available OBJETIVO: Analisar a validade da equação de predição da taxa metabólica de repouso proposta por Henry e Rees (1991 em adolescentes do sexo masculino. MÉTODOS: Estudo transversal, com amostra de conveniência constituída de 52 meninos, entre dez e 17 anos, sendo mensuradas a massa corporal e a calorimetria indireta. A massa corporal foi substituída na equação de Henry e Rees para determinar a taxa metabólica de repouso predita. A calorimetria indireta foi determinada pelos valores do consumo de O2 e produção de CO2, e usada na equação de Weir (1949, considerada método padrão para o cálculo da taxa metabólica de repouso. Todas as medidas foram realizadas pela manhã, com o indivíduo em jejum de seis horas, em posição supina e em repouso muscular. Realizaram-se os seguintes procedimentos estatísticos: teste t pareado; erro constante (com diferença aceita entre as médias OBJETIVO: Analizar la validez de la ecuación de predicción de la tasa metabólica de reposo (TMR propuesta por Henry y Rees (1991 en adolescentes del sexo masculino. MÉTODOS: Estudio transversal, con muestra de conveniencia constituida por 52 niños, entre 10 y 17 años, siendo medidas las variables a continuación: masa corporal y calorimetría indirecta (CI. La masa corporal fue sustituida en la ecuación de Henry y Rees (1991 para determinar la TMR predicha. La CI fue determinada por los valores del consumo de O2 y producción de CO2 y usada en la ecuación de Weir (1949, considerada como método estándar de la TMR. Todas las medidas fueron realizadas por la mañana, con el individuo en ayuno de 6 horas, en posición supina y en reposo muscular. Se realizaron los siguientes procedimientos estadísticos: prueba “t” pareada; error constante (EC - con diferencia aceptada entre los promedios menor que 5% y, para análisis de la concordancia entre los dos métodos, el procedimiento gráfico de Bland y Altman. RESULTADOS: La ecuación propuesta por

  11. W.E. Henry Symposium Compendium, Lawrence Berkeley National Laboratory, September 19, 1997

    Science.gov (United States)

    1997-09-19

    Society • Philosophical Society of Washington • Washington Academy of Sciences • New York Academy of Sciences • Institut International du Froid ...Powered Magnets" Reports of NRL Progress, Nov. 1958. 29. Henry, Warren E. "Aimantation dans les champs forts et approche a la saturation absolue du

  12. História e psicologia em Henri Berr

    OpenAIRE

    Waeny, Maria Fernanda Costa

    2017-01-01

    O artigo aborda algumas das idéias de Henri Berr; trata de sua proposta em história, especialmente no que ela se opõe à filosofia da história e à história alemãs; e examina como esta concepção de história à la francesa introduz a psicologia nas pesquisas em história e inaugura a psicologia histórica.Palavras-chave: História da Psicologia; Psicologia Histórica; História das Ciências Humanas; História das Idéias; Annales

  13. O pensamento crítico de Henri Lefebvre

    Directory of Open Access Journals (Sweden)

    William Gómez Soto

    2012-12-01

    Full Text Available Este trabalho é uma análise da presença de Henri Lefebvre na sociologia brasileira. Lefebvre faz uma leitura crítica de Marx, recuperando o método dialético e propondo uma teoria da vida cotidiana. José de Souza Martins influenciado por Lefebvre e utilizando o método dialético, analisa o processo histórico da constituição do capitalismo brasileiro. Apesar de que há certa presença de Lefebvre na sociologia brasileira, ainda a riqueza de sua obra está para ser descoberta.

  14. The Henry-Saltwater Intrusion Benchmark – Alternatives in Multiphysics Formulations and Solution Strategies

    Directory of Open Access Journals (Sweden)

    E Holzbecher

    2016-03-01

    Full Text Available In a classical paper Henry set up a conceptual model for simulating saltwater intrusion into coastal aquifers. Up to now the problem has been taken up by software developers and modellers as a benchmark for codes simulating coupled flow and transport in porous media. The Henry test case has been treated using different numerical methods based on various formulations of differential equations. We compare several of these approaches using multiphysics software. We model the problem using Finite Elements, utilizing the primitive variables and the streamfunction approach, both with and without using the Oberbeck-Boussinesq assumption. We compare directly coupled solvers with segregated solver strategies. Changing finite element orders and mesh refinement, we find that models based on the streamfunction converge 2-4 times faster than runs based on primitive variables. Concerning the solution strategy, we find an advantage of Picard iterations compared to monolithic Newton iterations.

  15. [Henri Ellenberger, Henri Ey and the Traité de Psychiatrie in the "Encyclopédie Médico-Chirurgicale": an American career under the auspices of the "Evolution Psychiatrique"].

    Science.gov (United States)

    Delille, Emmanuel

    2006-01-01

    Henri Ellenberger, psychiatrist and historian, experienced a decisive period in his career in the early fifties of the last century. Educated in France, intern at Sainte-Anne Hospital, he was working in Switzerland after the war and then tried to move to the United States. It was during his participation in the French group "l'Evolution Psychiatrique" that he happened to contribute to the treatise of psychiatry (1955) of the French medical and surgical encyclopaedia ("EMC") and organise an observation trip to the United States. He was supported at that time by Henri Ey, key figure of French psychiatry. While going back to his career, we would like to emphasise on his comments about the "Psychotherapy of schizophrenia". Even though later Ellenberger became a well-known researcher in North America, it is more a question for us to discuss the scientific ambition he had in this particular context of a French learned society as a member of "l'Evolution Psychiatrique" and as a psychiatrist formerly intern from the "Hôpitaux psychiatriques de la Seine" (Parisian district).

  16. Henri Fayol’un Yönetim Düşüncesi Üzerine Notlar(Notes on Managerial Thought of Henry Fayol

    Directory of Open Access Journals (Sweden)

    Ramazan ŞENGÜL

    2007-01-01

    Full Text Available Henri Fayol, developed a managerial approach which is a perfect guide for both private and public sectors through focusing systematically upon managerial process. A major advantage of Fayol in creating a general managerial doctrine was his pratician side. His managerial thought which was developed in the early 20th century lasted up to our times. The distinguished characteristic of Fayol’s thought was studying the administrative reality through separating it into its functions, in that it helps to understand evolution and operation of organisations. The importance of his doctrine for today is that adapting contemporary managerial techniques into organisations of various kinds needs to refer Fayol’s managerial aproach in one way or another.

  17. The radiation linked to uranium natural radioactivity enlightened by Abel Niepce long time before Henri Becquerel;Les rayonnements lies a la radioactivite naturelle de l'uranium mis en evidence par Abel Niepce bien avant Henri Becquerel

    Energy Technology Data Exchange (ETDEWEB)

    Fournier, J.; Niepce, J.C.

    2009-09-15

    Abel Niepce was rarely mentioned during the celebration of the centenary of the radioactivity discovery.This discovery, supposed due to chance alone, is entirely attributed to Henri Becquerel. But Abel Niepce who made the first observation of radiation from uranium with the impression of a photographic plate, but without giving it meaning. This is a slow process which in forty years, from an observation misunderstood by Abel Niepce to its interpretation by Frederick Soddy, through the experiments of Henri Becquerel and thanks to developments in other knowledge (electron, X-rays) has led to a scientific progress known under the term of radioactivity, name given by Marie Slodowska-Curie. (N.C.)

  18. On the emergence of the ΛCDM model from self-interacting Brans-Dicke theory in d= 5

    Science.gov (United States)

    Reyes, Luz Marina; Perez Bergliaffa, Santiago Esteban

    2018-01-01

    We investigate whether a self-interacting Brans-Dicke theory in d=5 without matter and with a time-dependent metric can describe, after dimensional reduction to d=4, the FLRW model with accelerated expansion and non-relativistic matter. By rewriting the effective 4-dimensional theory as an autonomous 3-dimensional dynamical system and studying its critical points, we show that the ΛCDM cosmology cannot emerge from such a model. This result suggests that a richer structure in d=5 may be needed to obtain the accelerated expansion as well as the matter content of the 4-dimensional universe.

  19. On the emergence of the ΛCDM model from self-interacting Brans-Dicke theory in d = 5

    Energy Technology Data Exchange (ETDEWEB)

    Reyes, Luz Marina [CUCEI, Universidad de Guadalajara, Departamento de Ciencias Computacionales, Guadalajara (Mexico); Perez Bergliaffa, Santiago Esteban [Universidade do Estado do Rio de Janeiro, Departamento de Fisica Teorica, Instituto de Fisica, Rio de Janeiro (Brazil)

    2018-01-15

    We investigate whether a self-interacting Brans-Dicke theory in d = 5 without matter and with a time-dependent metric can describe, after dimensional reduction to d = 4, the FLRW model with accelerated expansion and non-relativistic matter. By rewriting the effective 4-dimensional theory as an autonomous 3-dimensional dynamical system and studying its critical points, we show that the ΛCDM cosmology cannot emerge from such a model. This result suggests that a richer structure in d = 5 may be needed to obtain the accelerated expansion as well as the matter content of the 4-dimensional universe. (orig.)

  20. Lacan Leitor de Melanie Klein: O Caso Dick em Questão

    Directory of Open Access Journals (Sweden)

    Ariana Lucero

    Full Text Available RESUMO O artigo apresenta a leitura que Jacques Lacan faz do caso Dick, de Melanie Klein. Para tanto, a discussão com o filósofo Jean Hyppolite é retomada com o objetivo de explicitarmos como os mecanismos de Ausstossung [expulsão], Verneinung [negação] e Bejahung [afirmação], descritos por Freud em 1925, podem contribuir para a compreensão da constituição psíquica sob uma perspectiva lacaniana. Em seguida, expomos o caso, tanto para apreendermos clinicamente o que foi exposto na teoria, quanto para evidenciarmos como Lacan se distancia da concepção de fantasia de M. Klein. O tema do diagnóstico, no entanto, aparece em ambos ligado a uma forma de organização subjetiva ainda em constituição na infância, o que traz elementos para refletirmos sobre essa questão na atualidade.

  1. Thomas Henry Huxley et la Bible Thomas Henry Huxley and the Bible

    Directory of Open Access Journals (Sweden)

    Christophe Duvey

    2009-10-01

    Full Text Available Thomas Henry Huxley devoted several essays to the study of the Bible. This interest can only be accounted for if his ideas on history, religion as well as epistemology are examined. According to him, a struggle between free thought and supernaturalism was culminating during the Victorian era, hence the need for a “New Reformation” which was heir to the ideals of freedom defended by the humanists of the Renaissance. This movement opposed the principles of the supporters of what he called “ecclesiasticism”. The advocates of the “New Reformation” could rely on the progress of modern science, and agnosticism, which Huxley identified with scientific method, became its epistemological foundation. As a result, Huxley thought that the authority of physical science was in conflict with the infallibility of the Scriptures and with the theological arguments which rested on it, and this notably led him to the conclusion that the biblical narrative of the Flood was unhistorical. The naturalisation of the Scriptures seems then logically to follow his philosophical views based on the limits of human knowledge.It appears that it was the question of authority which underlay Huxley’s interest in the Bible. He thought that the authority of the Scriptures must be replaced by that of science.

  2. Quantum signature of chaos and thermalization in the kicked Dicke model

    Science.gov (United States)

    Ray, S.; Ghosh, A.; Sinha, S.

    2016-09-01

    We study the quantum dynamics of the kicked Dicke model (KDM) in terms of the Floquet operator, and we analyze the connection between chaos and thermalization in this context. The Hamiltonian map is constructed by suitably taking the classical limit of the Heisenberg equation of motion to study the corresponding phase-space dynamics, which shows a crossover from regular to chaotic motion by tuning the kicking strength. The fixed-point analysis and calculation of the Lyapunov exponent (LE) provide us with a complete picture of the onset of chaos in phase-space dynamics. We carry out a spectral analysis of the Floquet operator, which includes a calculation of the quasienergy spacing distribution and structural entropy to show the correspondence to the random matrix theory in the chaotic regime. Finally, we analyze the thermodynamics and statistical properties of the bosonic sector as well as the spin sector, and we discuss how such a periodically kicked system relaxes to a thermalized state in accordance with the laws of statistical mechanics.

  3. Modified Holographic Ricci Dark Energy in Chameleon Brans–Dicke Cosmology and Its Thermodynamic Consequence

    International Nuclear Information System (INIS)

    Jawad, A.; Chattopadhyay, S.; Bhattacharya, S.; Pasqua, A.

    2015-01-01

    The objective of this paper is to discuss the Chameleon Brans–Dicke gravity with non-minimally matter coupling of scalar field. We take modified Holographic Ricci dark energy model in this gravity with its energy density in interaction with energy density of cold dark matter. We assume power-law ansatz for scale factor and scalar field to discuss potential as well as coupling functions in the evolving universe. These reconstructed functions are plotted versus scalar field and time for different values of power component of scale factor n. We observe that potential and coupling functions represent increasing behavior, in particular, consistent results for a specific value of n. Finally, we have examined validity of the generalized second law of thermodynamics and we have observed its validity for all values of n. (paper)

  4. Fano-Agarwal couplings and non-rotating wave approximation in single-photon timed Dicke subradiance

    Science.gov (United States)

    Mirza, Imran M.; Begzjav, Tuguldur

    2016-04-01

    Recently a new class of single-photon timed Dicke (TD) subradiant states has been introduced with possible applications in single-photon-based quantum information storage and on demand ultrafast retrieval (Scully M. O., Phys. Rev. Lett., 115 (2015) 243602). However, the influence of any kind of virtual processes on the decay of these new kind of subradiant states has been left as an open question. In the present paper, we focus on this problem in detail. In particular, we investigate how pure Fano-Agarwal couplings and other virtual processes arising from non-rotating wave approximation impact the decay of otherwise sub- and superradiant states. In addition to the overall virtual couplings among all TD states, we also focus on the dominant role played by the couplings between specific TD states.

  5. Henry Duméry and the sacredness of history

    OpenAIRE

    Labèque, Marcelo Horacio; Pontificia Universidad Católica Argentina

    2014-01-01

    Following the steps of the French phenomenologist HenryDuméry, It is pursued to identify the particularities of what have been called before the «historical sacred», in the most general frame of a «morphology of sacred». In that sense it is intended to demonstrate that the originality of the experience and configuration of the sacred, in both Jewish and Christian religion, comes out from a transformation of cosmic archaic experiences and points of view, leading into a new way of sacred that g...

  6. A French description of German psychology laboratories in 1893 by Victor Henri, a collaborator of Binet.

    Science.gov (United States)

    Nicolas, Serge; Barnes, Marissa E; Murray, David J

    2015-05-01

    There is a rich tradition of writings about the foundation of psychology laboratories, particularly in the United States but also in France. Various documents exist concerning former German laboratories in American and French literature. But the most interesting French paper was certainly written by a young psychologist named Victor Henri (1872-1940) who was a close collaborator of Alfred Binet (1857-1911) in the 1890s. Visiting various psychology laboratories, he wrote, in 1893, a clear description of the laboratories of Wundt, G. E. Müller, Martius and Ebbinghaus. An English translation is given of Henri's paper and the historical importance of his contribution is here expounded by contrasting the German and French psychologies of the time.

  7. L'Abbe Henri Breuil: Archaeologist

    Directory of Open Access Journals (Sweden)

    Lawrence Guy Straus

    1992-05-01

    Full Text Available In his otherwise excellent book, A History of Archaeological Thought, Trigger (1989: 156 makes only one passing reference in a half-sentence to the central figure in the development of Paleolithic prehistory in the first half of the 20th century -- and manages to get his name wrong, confusing Henri Breuil with his long-time, close colleague, Hugo Obenrnaie . Thirty years after his death, Breuil's role in the history of Old World prehistory required more serious consideration. He was a seminal figure not only in rock art studies, but also in the archaeology of at least France, Spain, England, Portugal, South Africa, and China. Before I had read Trigger's work or Sackett's (1991 critique of my supposed misinterpretation of Breuil's theoretical stance (e.g., Straus 1986, 1987, I had presented a review of Breuil's contributions in the 1991 Annual Snead-Wertheim Lecture in Anthropology and History at the University of New Mexico (Straus n.d.. The following is a brief summary of some of my conclusions.

  8. A nearly cylindrically symmetric source in Brans-Dicke gravity as the generator of the rotational curves of the galaxies

    Energy Technology Data Exchange (ETDEWEB)

    Santos, S.M. dos [Universidade Estadual Paulista Julio de Mesquita Filho-UNESP, Guaratingueta, SP (Brazil); Instituto Federal de Educacao, Ciencia e Tecnologia do Rio Grande do Sul-IFRS, Porto Alegre, RS (Brazil); Silva, J.M.H. da [Universidade Estadual Paulista Julio de Mesquita Filho-UNESP, Guaratingueta, SP (Brazil); Guimaraes, M.E.X. [Universidade Federal Fluminense-UFF, Instituto de Fisica, Niteroi, RJ (Brazil); Neto, J.L. [Universidade Federal do Rio de Janeiro-UFRJ, Instituto de Fisica, Rio de Janeiro, RJ (Brazil)

    2017-12-15

    Observation shows that the velocities of stars grow by approximately 2-3 orders of magnitude when the distances from the centers of the galaxies are in the range of 0.5-82.3 kpc, before they begin to tend to a constant value. Up to now, the reason for this behavior is still a matter for debate. In this work, we propose a model which adequately describes this unusual behavior using a (nearly) cylindrical symmetrical solution in the framework of a scalar-tensor-like (the Brans-Dicke model) theory of gravity. (orig.)

  9. A nearly cylindrically symmetric source in Brans-Dicke gravity as the generator of the rotational curves of the galaxies

    Science.gov (United States)

    dos Santos, S. Mittmann; da Silva, J. M. Hoff; Guimarães, M. E. X.; Neto, J. L.

    2017-12-01

    Observation shows that the velocities of stars grow by approximately 2-3 orders of magnitude when the distances from the centers of the galaxies are in the range of 0.5-82.3 kpc, before they begin to tend to a constant value. Up to now, the reason for this behavior is still a matter for debate. In this work, we propose a model which adequately describes this unusual behavior using a (nearly) cylindrical symmetrical solution in the framework of a scalar-tensor-like (the Brans-Dicke model) theory of gravity.

  10. The Brans-Dicke gravity as a theory of dark matter

    International Nuclear Information System (INIS)

    Kim, Hongsu

    2010-01-01

    The pure Brans-Dicke (BD) gravity with or without the cosmological constant Λ has been taken as a model theory for dark matter. Indeed, there has been a consensus that unless one modifies either the standard theory of gravity, namely, general relativity, or the standard model for particle physics, or both, one can never achieve a satisfying understanding of the phenomena associated with dark matter and dark energy. Along this line, our dark matter model in this work can be thought of as an attempt to modify the gravity side alone in the simplest fashion to achieve the goal. Among others, it is demonstrated that our model theory can successfully predict the emergence of a dark matter halo-like configuration in terms of a self-gravitating spacetime solution to the BD field equations and reproduce the flattened rotation curve in this dark halo-like object in terms of the non-trivial energy density of the BD scalar field, which was absent in the context of general relativity, where Newton's constant is strictly a 'constant' having no dynamics. Our model theory, however, is not entirely without flaw, such as the prediction of relativistic jets in all types of galaxies, which actually is not the case.

  11. From the "metaphysics of the individual" to the critique of society: on the practical significance of Michel Henry's phenomenology of life.

    Science.gov (United States)

    Staudigl, Michael

    This essay explores the practical significance of Michel Henry's "material phenomenology." Commencing with an exposition of his most basic philosophical intuition, i.e., his insight that transcendental affectivity is the primordial mode of revelation of our selfhood, the essay then brings to light how this intuition also establishes our relation to both the world and others. Animated by a radical form of the phenomenological reduction, Henry's material phenomenology brackets the exterior world in a bid to reach the concrete interior transcendental experience at the base of all exteriority. The essay argues that this "counter reduction," designed as a practical orientation to the world, suspends all traditional parameters of onto(theo)logical individuation in order to rethink subjectivity in terms of its transcendental corporeality, i.e., in terms of the invisible display of "affective flesh." The development of this "metaphysics of the individual" anchors his "practical philosophy" as he developed it-under shifting accents-throughout his oeuvre. In particular, the essay brings into focus Henry's reflections on modernity, the industry of mass culture and their "barbaric" movements. The essay briefly puts these cultural and political areas of Henry's of thinking into contact with his late "theological turn," i.e., his Christological account of Life and the (inter)subjective self-realization to which it gives rise.

  12. Edward Henry Sieveking and the demise of essential epilepsy.

    Science.gov (United States)

    Bladin, Peter F

    2008-04-01

    Edward Henry Sieveking, eminent London physician of Victorian times, is best known as the speaker at the historic meeting at which the chairman, Sir Charles Locock, seem to overshadow him in announcing the introduction of bromide--the first effective anti-convulsant. But in fact Sieveking had announced a most important conceptual advance in epileptology--the demise of "essential epilepsy". In addition his book, published soon after and based upon his lecture, is an important historical resumé of Victorian era concepts and management of epilepsy. His important contributions to the understanding and management of this condition are discussed herein.

  13. Henri Ey's neojacksonism and the psychopathology of disintegrated mind.

    Science.gov (United States)

    Farina, Benedetto; Ceccarelli, Maurizio; Di Giannantonio, Massimo

    2005-01-01

    The French psychiatrist Henri Ey developed his organo-dynamic theory of the mind function and consciousness 50 years ago incorporating Hughling Jackson's thinking, along with psychiatric and philosophical theorizations by Janet and Bergson. This model has not received the attention it deserved, but recent advances in neuroscience rekindled interest for Ey's theory. By overcoming the Cartesian mind-body dualism and treating the mind-body unit as an inseparable whole, this model opens the way for the integrated treatment of mental disorders. Ey's conceptualization of consciousness as being simultaneously both synchronous and diachronic anticipates current theories of consciousness (Damasio, Edelman, Mesulam).

  14. Dilatonic Brans-Dicke Anisotropic Collapsing Fluid Sphere And de Broglie Quantum Wave Motion

    International Nuclear Information System (INIS)

    Ghaffarnejad, Hossein

    2016-01-01

    Two dimensional (2D) analogue of vacuum sector of the Brans Dicke (BD) gravity [1] is studied to obtain dynamics of anisotropic spherically symmetric perfect fluid. Our obtained static solutions behave as dark matter with state equation but in non-static regimes behave as regular perfect fluid with barotropic index ϒ > 0. Positivity property of total mass of the fluid causes that the BD parameter to be ω >2/3 and/or ω 0 the apparent horizon is covered by event horizon where the cosmic censorship hypothesis is still valid. According to the model [1], we obtain de Broglie pilot wave of our metric solution which describes particles ensemble which become distinguishable via different values of ω . Incident current density of particles ensemble on the horizons is evaluated which describe the ‘Hawking radiation’. The de Brogle-Bohm quantum potential effect is calculated also on the event (apparent) horizon which is independent (dependent) to values of ω . (paper)

  15. Eternal extended inflation and graceful exit from old inflation without Jordan-Brans-Dicke

    International Nuclear Information System (INIS)

    Linde, A.

    1990-01-01

    Recently a possible solution to the graceful exit problem of the old inflation was proposed in the context of the Jordan-Brans-Dicke theory (extended inflation). In this paper we will argue that inflation in this theory occurs in a most natural way if it starts near the Planck density, as in the standard version of chaotic inflation. With most natural initial conditions, the inflationary universe in the JBD theory enters the stage of permanent reproduction of new inflationary domains (eternal extended inflation). In order to realize the extended inflation scenario at least two classical scalar fields driving inflation are necessary, as distinct from the simplest versions of new and chaotic inflation. It is shown that in the theory of two scalar fields one can solve the graceful exit problem even without modifying the Einstein gravity theory, due to the possibility that the decay rate of the false vacuum in old inflation depends on the value of the second scalar field and hence on time. (orig.)

  16. Ernest Henry Starling (1866-1927): the scientist and the man

    DEFF Research Database (Denmark)

    Henriksen, Jens H

    2005-01-01

    The pre-eminent achievements of the English physician and physiologist Ernest Henry Starling were his quantitative explanation of the transcapillary transport of fluid, the discovery of the first hormone, secretin, and his formulation of the law of the heart. In some ways Starling was an outsider...... and he was the centre of several scientific and social controversies. However, throughout his life he stressed fundamental scientific attitudes and ideas with remarkable persistence and power, although also balance, and his scientific achievements have stood the test of time....

  17. Publicações póstumas de Henri Fayol: revisitando sua teoria administrativa.

    Directory of Open Access Journals (Sweden)

    Edson Miranda de Souza

    2011-02-01

    Full Text Available O engenheiro francês Henri Fayol (1841-1925 é usualmente apresentado aos estudantes de Administração como o Pai da Escola Clássica de Administração, o que demonstra uma representação limitada da amplitude de sua contribuição para a evolução do pensamento administrativo. Além disso, é frequentemente associado ao seu contemporâneo, o teórico norte-americano Frederick Taylor, sendo aos dois atribuída a defesa de um modelo autoritário de administração. Entretanto, recentemente, pesquisadores descobriram, através do exame de documentos raros e inéditos, um desconhecido retrato desse pioneiro. Este trabalho resulta de uma investigação que buscou levantar fontes de informação bibliográfica disponíveis, publicadas ou não, incluindo resultados de trabalhos de pesquisadores da França, dos Estados Unidos, do Canadá, da Austrália e do Japão. Esses pesquisadores compõem um reduzido grupo de estudiosos, aqui denominados “novos fayolistas” porque retomam, depois de anos de quase amnésia no meio acadêmico, o interesse pelas contribuições de Henri Fayol. Tais estudos revelam conceitos desenvolvidos por Fayol que antecipam aspectos de teorias e práticas da Administração que, somente mais tarde, seriam desenvolvidas, como a Escola de Relações Humanas, a Teoria Contingencial e o Planejamento Estratégico. Ao apresentar as recentes pesquisas sobre o homem e o teórico Henri Fayol, este estudo permite, aos docentes e estudantes de língua portuguesa, acesso a escritos e palestras de sua autoria que, até então, permaneciam desconhecidos.

  18. Fin-de-Siecle Advances in Neuroeducation: Henry Herbert Donaldson and Reuben Post Halleck

    Science.gov (United States)

    Theodoridou, Zoe D.; Triarhou, Lazaros C.

    2009-01-01

    This article focuses on two early attempts at bridging neuroscience and education, made by Henry Herbert Donaldson (1857-1938), a neurologist, and Reuben Post Halleck (1859-1936), an educator. Their works, respectively entitled "The Growth of the Brain: A Study of the Nervous System in Relation to Education" (1895) and "The Education of the…

  19. Henry's law and accumulation of weak source for crust-derived helium: A case study of Weihe Basin, China

    Directory of Open Access Journals (Sweden)

    Yuhong Li

    2017-12-01

    Full Text Available Crust-derived helium is generated from the radioactive decay of uranium, thorium and other radioactive elements in geological bodies. Compared with conventional natural gas, helium is a typical weak source gas as a result of extremely slow generation rate and absence of helium-generating peak. It is associated with methane or carbon dioxide reservoirs frequently and related to groundwater closely. Helium can meet the industry standard with 0.1% in volume fraction. In order to study the accumulation mechanism of helium, the previous research on Henry's coefficient and solubility of helium, nitrogen and methane are summarized and the key roles of Henry's Law in the helium migration, accumulation and preservation are discussed by simulating calculation taking Weihe Basin as an example. According to the Law, the gas solubility in dilute solution is controlled by the gas partial pressure and the Henry's coefficient. Compared with the carrier gases, the Henry's constant of helium is high, with striking difference at low and high temperature. In addition, the helium partial pressure is greatly different in helium source rocks and gas reservoirs, resulting in the great differences of helium solubility in the two places. The accumulation progresses are as follows. Firstly, helium can dissolve into water and migrate out of helium source rocks due to the high helium solubility, which is caused by high helium partial pressure and high temperature in source rock. Secondly, when dissolved helium is transported to the shallow gas reservoir, it is prone to be out of solution and into reservoir due to the extremely low partial pressure and low temperature. Meanwhile part of carrier gases dissolves into water, as if helium is “replaced” out. Furthermore, the low concentration funnel of dissolved helium is formed near the gas reservoir, then other dissolved helium continues to migrate towards the gas reservoir, which greatly improves the helium accumulation

  20. A highly thermostable alkaline cellulase-free xylanase from thermoalkalophilic Bacillus sp. JB 99 suitable for paper and pulp industry: purification and characterization.

    Science.gov (United States)

    Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra

    2010-11-01

    A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.

  1. Paul Henry Latimer (1925-2011): discoverer of selective scattering in photosynthetic systems.

    Science.gov (United States)

    Latimer, Margaret Gwyn; Bannister, Thomas T; Govindjee

    2017-10-01

    We provide here a brief tribute to Paul Henry Latimer (November 25, 1925 to October 1, 2011), a dedicated biological physicist, discoverer of selective scattering in biological systems, a wonderful teacher, husband, and father. We provide here a glimpse of his personal and professional life, including reminiscences from F. Dudley Bryant, Dan A. Cross, Bobby E. Pyle, Bryan L. Seiber, and Bruce A. Seiber.

  2. Non-singular Brans–Dicke collapse in deformed phase space

    Energy Technology Data Exchange (ETDEWEB)

    Rasouli, S.M.M., E-mail: mrasouli@ubi.pt [Departamento de Física, Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal); Centro de Matemática e Aplicações (CMA - UBI), Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal); Physics Group, Qazvin Branch, Islamic Azad University, Qazvin (Iran, Islamic Republic of); Ziaie, A.H., E-mail: ah_ziaie@sbu.ac.ir [Department of Physics, Shahid Beheshti University, G. C., Evin, 19839 Tehran (Iran, Islamic Republic of); Department of Physics, Shahid Bahonar University, PO Box 76175, Kerman (Iran, Islamic Republic of); Jalalzadeh, S., E-mail: shahram.jalalzadeh@unila.edu.br [Federal University of Latin-American Integration, Technological Park of Itaipu PO box 2123, Foz do Iguaçu-PR, 85867-670 (Brazil); Moniz, P.V., E-mail: pmoniz@ubi.pt [Departamento de Física, Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal); Centro de Matemática e Aplicações (CMA - UBI), Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal)

    2016-12-15

    We study the collapse process of a homogeneous perfect fluid (in FLRW background) with a barotropic equation of state in Brans–Dicke (BD) theory in the presence of phase space deformation effects. Such a deformation is introduced as a particular type of non-commutativity between phase space coordinates. For the commutative case, it has been shown in the literature (Scheel, 1995), that the dust collapse in BD theory leads to the formation of a spacetime singularity which is covered by an event horizon. In comparison to general relativity (GR), the authors concluded that the final state of black holes in BD theory is identical to the GR case but differs from GR during the dynamical evolution of the collapse process. However, the presence of non-commutative effects influences the dynamics of the collapse scenario and consequently a non-singular evolution is developed in the sense that a bounce emerges at a minimum radius, after which an expanding phase begins. Such a behavior is observed for positive values of the BD coupling parameter. For large positive values of the BD coupling parameter, when non-commutative effects are present, the dynamics of collapse process differs from the GR case. Finally, we show that for negative values of the BD coupling parameter, the singularity is replaced by an oscillatory bounce occurring at a finite time, with the frequency of oscillation and amplitude being damped at late times.

  3. Non-singular Brans–Dicke collapse in deformed phase space

    International Nuclear Information System (INIS)

    Rasouli, S.M.M.; Ziaie, A.H.; Jalalzadeh, S.; Moniz, P.V.

    2016-01-01

    We study the collapse process of a homogeneous perfect fluid (in FLRW background) with a barotropic equation of state in Brans–Dicke (BD) theory in the presence of phase space deformation effects. Such a deformation is introduced as a particular type of non-commutativity between phase space coordinates. For the commutative case, it has been shown in the literature (Scheel, 1995), that the dust collapse in BD theory leads to the formation of a spacetime singularity which is covered by an event horizon. In comparison to general relativity (GR), the authors concluded that the final state of black holes in BD theory is identical to the GR case but differs from GR during the dynamical evolution of the collapse process. However, the presence of non-commutative effects influences the dynamics of the collapse scenario and consequently a non-singular evolution is developed in the sense that a bounce emerges at a minimum radius, after which an expanding phase begins. Such a behavior is observed for positive values of the BD coupling parameter. For large positive values of the BD coupling parameter, when non-commutative effects are present, the dynamics of collapse process differs from the GR case. Finally, we show that for negative values of the BD coupling parameter, the singularity is replaced by an oscillatory bounce occurring at a finite time, with the frequency of oscillation and amplitude being damped at late times.

  4. Staging Henry Fielding: The Author-Narrator in Tom Jones On Screen

    OpenAIRE

    Løfaldli, Eli

    2017-01-01

    As recent adaptation theory has shown, classic-novel adaptation typically sets issues connected to authorship and literal and figurative ownership into play. This key feature of such adaptations is also central to the screen versions of Henry Fielding’s Tom Jones (1749). In much of Fielding’s fiction, the narrator, typically understood as an embodiment of Fielding himself, is a particularly prominent presence. The author-narrator in Tom Jones is no exception: not only is his presence strongly...

  5. DNA-Catalyzed Henry Reaction in Pure Water and the Striking Influence of Organic Buffer Systems

    Directory of Open Access Journals (Sweden)

    Marleen Häring

    2015-03-01

    Full Text Available In this manuscript we report a critical evaluation of the ability of natural DNA to mediate the nitroaldol (Henry reaction at physiological temperature in pure water. Under these conditions, no background reaction took place (i.e., control experiment without DNA. Both heteroaromatic aldehydes (e.g., 2-pyridinecarboxaldehyde and aromatic aldehydes bearing strong or moderate electron-withdrawing groups reacted satisfactorily with nitromethane obeying first order kinetics and affording the corresponding β-nitroalcohols in good yields within 24 h. In contrast, aliphatic aldehydes and aromatic aldehydes having electron-donating groups either did not react or were poorly converted. Moreover, we discovered that a number of metal-free organic buffers efficiently promote the Henry reaction when they were used as reaction media without adding external catalysts. This constitutes an important observation because the influence of organic buffers in chemical processes has been traditionally underestimated.

  6. Beyond the Historical Record? Henry James in “The Master at St. Bartholomew’s Hospital

    Directory of Open Access Journals (Sweden)

    Elena Ogliari

    2018-02-01

    Full Text Available The article analyses the short-story “The Master at St Bartholomew’s Hospital 1914–1916” by Joyce Carol Oates (2007 in the broader context of the Jamesian biofiction, a series of novels and tales featuring Henry James as their protagonist. The addition of the prefix “bio-” to “fiction” points out the hybrid nature of these texts, which are a melange of biography, autobiography, criticism and fiction. Oates’s story not only epitomizes this hybridity, but it also proves to be an exploration of the potentiality of this subgenre to penetrate the mystery surrounding James’s persona and saturate the lacunae in his biography by resorting to what David Lodge defined as “the novelist’s licence”. The short-story is yet another evidence of Oates’s fascination with the unsaid in James’s life and prose, because it revolves around the silence into which he sank at the outbreak of the Great War, when he did not write anything in his pocket diaries for three months. In an attempt to go beyond the limits of the historical record, Oates gives insights into the mind of the author by depicting a Henry James in crisis – nagged by doubts about his artistic legacy – in an atmosphere of uncertainty enhanced by a complex intertextual play. The result is ‘a Henry James’ slightly divergent from the historical one: thus, the tale advocates the inaccessibility of the private life of a real individual. Nonetheless, the acknowledgement of this limit spurs the celebration of fictional imagination.

  7. Henri Fayol. Performativity of his ideas and oblivion of their creator

    OpenAIRE

    Dumez , Hervé

    2018-01-01

    Henri Fayol formulated one of the first theories of management and allows us to see how one of the first scientific approaches of management could or could not perform management practices. Therefore, Fayol is particularly interesting from the point of view of performativity (Callon, 1998, 2007, MacKenzie et al., 2007, Muniesa, 2014). The case is all the richer because it presents the rare characteristic of a direct confrontation between two rival theories, his and Taylor's, at the level of t...

  8. [The electric furnace of Henri Moissan at one hundred years: connection with the electric furnace, the solar furnace, the plasma furnace?].

    Science.gov (United States)

    Royère, C

    1999-03-01

    The trace of Henri Moissan's pioneer work 100 years ago is clearly evidenced by an overview of achievements in high temperature devices; 1987: "Le four électrique" by Henri Moissan; 1948-1952: "High temperature heating in a cavity rotary kiln using focusing of solar radiation" by Félix Trombe; 1962: "The cavity rotary kiln using focused solar radiation jointly with a plasma gun" by Marc Foëx; 1970: "The rotary kiln with two plasma guns and arc transfer" by Marc Foëx; 1984: "The plasma furnace" by Electricité de France (EDF) at Renardières; 1997: "The plasma furnace" by the Atomic Energy Center (CEA) at Cadarache, the VULCANO program. The first part of this contribution is devoted to Henri Moissan. Re-reading his early book on the electric furnace, especially the first chapter and the sections on silica, carbon vapor and experiments performed in casting molten metal--the conclusions are outstanding--provides modern readers with an amazing insight into future developments. The last two parts are devoted to Félix Trombe and Marc Foëx, tracing the evolution of high temperature cavity processus leading to the solar furnace and the present day plasma furnace at the CEA. Focus is placed on research conducted by the French National Center for Scientific Research (CNRS) with the solar and plasma furnaces at Odeillo. The relationships with Henri Moissan's early work are amazing, offering a well deserved homage to this pioneer researcher.

  9. Modified Holographic Ricci Dark Energy in Chameleon Brans-Dicke Cosmology and Its Thermodynamic Consequence

    Science.gov (United States)

    Jawad, A.; Chattopadhyay, S.; Bhattacharya, S.; Pasqua, A.

    2015-04-01

    The objective of this paper is to discuss the Chameleon Brans-Dicke gravity with non-minimally matter coupling of scalar field. We take modified Holographic Ricci dark energy model in this gravity with its energy density in interaction with energy density of cold dark matter. We assume power-law ansatz for scale factor and scalar field to discuss potential as well as coupling functions in the evolving universe. These reconstructed functions are plotted versus scalar field and time for different values of power component of scale factor n. We observe that potential and coupling functions represent increasing behavior, in particular, consistent results for a specific value of n. Finally, we have examined validity of the generalized second law of thermodynamics and we have observed its validity for all values of n. The financial Supported from Department of Science and Technology, Govt. of India under Project Grant No. SR/FTP/PS-167/2011 is thankfully acknowledged by SC

  10. Eternal extended inflation and graceful exit from old inflation without Jordan-Brans-Dicke

    Science.gov (United States)

    Linde, Andrei

    1990-10-01

    Recently a possible solution to the graceful exit problem of the old inflation was proposed in the context of the Jordan-Brans-Dicke theory (extended inflation). In this paper we will argue that inflation in this theory occurs in a most natural way if it starts near the Planck density, as in the standard version of chaotic inflation. With most natural initial conditions, the inflationary universe in the JBD theory enters the stage of permanent reproduction of new inflationary domains (eternal extended inflation). In order to realize the extended inflation scenario at least two classical scalar fields driving inflation are necessary, as distinct from the simplest versions of new and chaotic inflation. It is shown that in the theory of two scalar fields one can solve the graceful exit problem even without modifying the Einstein gravity theory, due to the possibility that the decay rate of the false rate vacuum in old inflation depends on the value of the second scalar field and hence on time. Address after 1 September 1990: Physics Department, Stanford University, Varian Building, Stanford, CA 94305, USA.

  11. The 'Overly-Broad' Selden Patent, Henry Ford and Development in the Early US Automobile Industry

    DEFF Research Database (Denmark)

    Howells, John; Katznelson, Ron D

    of the Selden patent claims. We use new primary sources to show how Henry Ford and others engaged in what today is called “Freedom to Operate” patent analysis when it most mattered commercially. We show that Ford correctly anticipated that a future court adjudication of the Selden patent claims would...

  12. Kuidas kommunikatsiooniga raha kaasata ehk sõna saab härra ühisrahastus / Henri Laupmaa ; intervjueerinud Dea Martinjonis

    Index Scriptorium Estoniae

    Laupmaa, Henri

    2015-01-01

    Intervjuu IT-ettevõtja, kodanikuühiskonna arendaja ning toetusplatvormi Hooandja ühe käivitaja Henri Laupmaaga Hooandja platvormi õnnestunud projektidest, uuest ühisrahastusplatvormist Fundwise, kommunikatsioonist ühisrahastusprojektide ellu viimisel

  13. A unified description of adsorption on real surfaces from the Henry Range to the formation of the liquid layer

    Energy Technology Data Exchange (ETDEWEB)

    Cerofolini, G F

    1977-01-01

    A unified description of adsorption on real surfaces from the Henry Range to the formation of the liquid layer was developed on the basis of the BET theory and the assumption that sites on real surfaces are not energetically homogeneous. The model describes the successive Henry, Dubinin-Radushkevich, Freundlich, and multilayer BET behavior of the adsorbed phase as the pressure increases. An analysis of isotherms over the whole coverage range showed that the heterogeneous surface character decreases with increasing number of adsorbed layers; that adsorption into the first and higher layers may be competitive, which produces a new isotherm resembling a mixed type II and III isotherm as proposed by Cerofolini and coworkers.

  14. Theoretical Insight of Physical Adsorption for a Single Component Adsorbent + Adsorbate System: II. The Henry Region

    KAUST Repository

    Chakraborty, Anutosh; Saha, Bidyut Baran; Ng, Kim Choon; Koyama, Shigeru; Srinivasan, Kandadai

    2009-01-01

    evaluated and compared with experimental data. It is found that the adsorbents with higher specific surface areas tend to possess lower heat of adsorption (ΔH°) at the Henry regime. In this paper, we have established the definitive relation between Ai and ΔH

  15. Henry Fayol’s 14 Principles of Management: Implications for Libraries and Information Centres

    OpenAIRE

    Uzuegbu, C. P.; Nnadozie, C. O.

    2015-01-01

    This paper focuses generally on the ‘fourteen principles of management’ by Henri Fayol. However, it specifically analyses their application to and implications for libraries and information centres. An extensive review of published works on management generally, and library management in particular, was conducted. This yielded vital insights on the original meaning and later modifications of these principles, as well as their application in the management of various organisation...

  16. «Ancient armour and arms recently received from Spain» Eusebio Zuloaga, Henry Lepage, and the Real Armería in Madrid

    Directory of Open Access Journals (Sweden)

    Pyhrr, Stuart W.

    1999-12-01

    Full Text Available In 1835 an important group of arms, some of them from Real Armeria, was sent by Eusebio Zuloaga to the gunmaker Henri Lepage in Paris. This paper documents the transaction and seeks to identify the present location of some items.

    En 1835 un importante conjunto de armas, algunas procedentes de la Real Armeria, fue enviado por Eusebio Zuloaga a1 arcabucero Henri Lepage de París. Este artículo documenta dicho envió y pretende señalar el paradero actual de alguno de los objetos

  17. The Heuristic Method, Precursor of Guided Inquiry: Henry Armstrong and British Girls' Schools, 1890-1920

    Science.gov (United States)

    Rayner-Canham, Geoff; Rayner-Canham, Marelene

    2015-01-01

    Though guided-inquiry learning, discovery learning, student-centered learning, and problem-based learning are commonly believed to be recent new approaches to the teaching of chemistry, in fact, the concept dates back to the late 19th century. Here, we will show that it was the British chemist, Henry Armstrong, who pioneered this technique,…

  18. Henri Lopès : d’Une Quête Incessante à une identité plurielle

    Directory of Open Access Journals (Sweden)

    Vincent Simédoh

    2006-04-01

    Full Text Available Dans plusieurs oeuvres d’Henri Lopès, les personnages sont constamment en quête d’une identité. Une quête qu’ils entament comme un parcours puisque désormais ils vivent au confluent de plusieurs cultures et ils se sentent comme en exil. Ce n’est pas forcément un exil extérieur parce qu’ils ont quitté leur pays d’origine mais c’est plutôt un exil intérieur. Ainsi les personnages se sentent incapables de se situer par rapport à eux-mêmes et à autrui. Dès lors surgit une tentation, celle de se réfugier dans le souvenir qui n’existe même plus. La mémoire s’estompe. L’histoire elle-même fuit et disparaît. Ce qui fait naître chez les personnages un vide qui conduit à un malaise identitaire, d’où déchirement. En face de cet écartèlement, surgit une multitude de pistes. Et c’est dans cette perspective qu’Henri Lopès propose une identité plurielle.

  19. Pigeon pea waste as a novel, inexpensive, substrate for production of a thermostable alkaline protease from thermoalkalophilic Bacillus sp. JB-99.

    Science.gov (United States)

    Johnvesly, B; Manjunath, B R; Naik, G R

    2002-03-01

    Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.

  20. Dynamics of coherent states in regular and chaotic regimes of the non-integrable Dicke model

    Science.gov (United States)

    Lerma-Hernández, S.; Chávez-Carlos, J.; Bastarrachea-Magnani, M. A.; López-del-Carpio, B.; Hirsch, J. G.

    2018-04-01

    The quantum dynamics of initial coherent states is studied in the Dicke model and correlated with the dynamics, regular or chaotic, of their classical limit. Analytical expressions for the survival probability, i.e. the probability of finding the system in its initial state at time t, are provided in the regular regions of the model. The results for regular regimes are compared with those of the chaotic ones. It is found that initial coherent states in regular regions have a much longer equilibration time than those located in chaotic regions. The properties of the distributions for the initial coherent states in the Hamiltonian eigenbasis are also studied. It is found that for regular states the components with no negligible contribution are organized in sequences of energy levels distributed according to Gaussian functions. In the case of chaotic coherent states, the energy components do not have a simple structure and the number of participating energy levels is larger than in the regular cases.

  1. The Snake Charmer(ess intermedia dialogue between Henri Rousseau's Painting and Sylvia Plath's poetry

    Directory of Open Access Journals (Sweden)

    Milovanov Dajana

    2017-01-01

    Full Text Available The paper examines possible interpretations of poetry and poetic image analysing the dialogue between the arts of literature and painting. The paper studies the poet Sylvia Plath's referencing Henri Rousseau's painting The Snake Charmer in her poem 'Snakecharmer'. What is analysed is the creative superstructure based upon nonliterary reference, as well as the visual elements attained through two diverse artistic media.

  2. Restauration de la statue de Henri IV

    Directory of Open Access Journals (Sweden)

    Stéphanie Celle

    2012-04-01

    Full Text Available Cette intervention de conservation du bronze de la statue de Henri IV était la première depuis sa création en 1818 : on héritait de la surface originale de l’œuvre altérée par les vicissitudes du temps et les événements historiques traversés. Le protocole de conservation se voulait respectueux de cette authenticité de la patine et a cherché à en laisser les marques tout en apportant une réponse pour contrer la corrosion active de l’alliage. C’est en conformité aux principes de conservation établis par Cesare Brandi, qu’ont été définis le nettoyage sélectif des surfaces et l’application de couches protectives sur le bronze. Par ailleurs, le moment du chantier est un moment privilégié pour observer un monument et mieux connaître son histoire particulière. Ce chantier nous a permis de redécouvrir deux ensembles de boîtes déposées dans l’antre du cheval dans des situations parfois surprenantes.This conservation treatment for the bronze statue of Henri IV is the first since its creation in 1818. While the original surface of the work remains, it has been altered by natural and human forces; including the weathering of the material from exposure to the elements and damage caused by historic events. The conservation protocol is respectful of this authenticity of the surface patina and the marks of damage due to historical events, while developing a treatment plan to counter the active corrosion of the alloy. In keeping with the principles of conservation established by Cesare Brandi, the treatment program defines the selective cleaning of the surface and the application of several layers of a protective coating on the bronze. In addition, the conservation project is an opportunity to carefully study a monument to better understand its unique history. This project allowed us to rediscover two sets of boxes placed inside the cavity of the horse; an unxpected discovery.

  3. Community Arts Programs: Cohesion and Difference Case Studies. Henry Street Settlement and El Museo del Barrio

    Science.gov (United States)

    Kiebert-Gruen, Cathleen

    2009-01-01

    A comparative case study of two cultural institutions, Henry Street Settlement and El Museo del Barrio, founded almost eighty years apart, were involved in social justice causes and community arts. Although both of these institutions participated in the political activism of their time, they also demonstrated an important adaptability. They were…

  4. Ensaios teóricos: os capitulos introdutórios de Henry Fielding Exploring theory: Fielding’s prefatory chapters

    Directory of Open Access Journals (Sweden)

    Sandra Guardini T. Vasconcelos

    2000-01-01

    Full Text Available Henry Fielding, um dos fundadores do romance inglês, deixou um material teórico bastante rico a respeito do gênero em ascensão, que ele discutiu em prefácios e nos célebres capítulos introdutórios a Tom Jones. Esse artigo tem como objetivo apresentar alguns dos impasses e dilemas enfrentados pelo romancista e as soluções formais que ele propôs para resolvê-los.Henry Fielding, one of the founders of the English novel, has left a wealth theoretical material about the rising genre, which he discussed in prefaces and in his famous introductory chapters to Tom Jones, this article aims to present some of the impasses and double binds faced by the novelist and the formal solutions he proposed to deal with them.

  5. "Audacity or Precision": The Paradoxes of Henri Villat's Fluid Mechanics in Interwar France

    OpenAIRE

    Aubin , David

    2010-01-01

    In Interwar France, Henri Villat became the true leader of theoretical researches on fluid mechanics. Most of his original work was done before the First World War; it was highly theoretical and its applicability was questioned. After having organized the first post-WWI International Congress of Mathematicians in 1920, Villat became the editor of the famous Journal de math\\'ematiques pure et appliqu\\'es and the director of the influential book series "M\\'emorial des sciences math\\'ematiques."...

  6. Henri Walon: por uma teoria dialética na educação

    Directory of Open Access Journals (Sweden)

    Maria Inês Naujorks

    2000-04-01

    Full Text Available O texto aborda as principais idéias desenvolvidas por Henri Wallon. Tendo como método o materialismo dialético, seu projeto foi o de formular uma "ciência do homem". Para o autor o desenvolvimento é a síntese dialética do biológico e do social e só pode ser entendido à luz das contradições de um processo que se estende por toda vida toda.

  7. Visualizing the Life and Legacy of Henry VIII: Guiding Students with Eight Types of Graphic Organizers

    Science.gov (United States)

    Gallavan, Nancy P.; Kottler, Ellen

    2010-01-01

    Delving into the life and legacy of Henry VIII is both complex and captivating. People seem compelled to learn more abut his critical contributions and controversial conduct that range from the significant to the scandalous. Reflecting on the history of the world would be incomplete without investigating the events and escapades associated with…

  8. Victor Henri: 111 years of his equation.

    Science.gov (United States)

    Cornish-Bowden, Athel; Mazat, Jean-Pierre; Nicolas, Serge

    2014-12-01

    Victor Henri's great contribution to the understanding of enzyme kinetics and mechanism is not always given the credit that it deserves. In addition, his earlier work in experimental psychology is totally unknown to biochemists, and his later work in spectroscopy and photobiology almost equally so. Applying great rigour to his analysis he succeeded in obtaining a model of enzyme action that explained all of the observations available to him, and he showed why the considerable amount of work done in the preceding decade had not led to understanding. His view was that only physical chemistry could explain the behaviour of enzymes, and that models should be judged in accordance with their capacity not only to explain previously known facts but also to predict new observations against which they could be tested. The kinetic equation usually attributed to Michaelis and Menten was in reality due to him. His thesis of 1903 is now available in English. Copyright © 2014 Elsevier B.V. and Société française de biochimie et biologie Moléculaire (SFBBM). All rights reserved.

  9. 76 FR 63906 - Henry Gordy International, Inc., Provisional Acceptance of a Settlement Agreement and Order

    Science.gov (United States)

    2011-10-14

    ... International, Inc., containing a civil penalty of $1,100,000.00. DATES: Any interested person may ask the... report of a death involving a Target Set on or about May 1, 2006, after an 8-year-old boy choked on a dart and died on March 9, 2006. 8. In response to the death reported on or about May 1, 2006, Henry...

  10. [Crusading and Chronicle Writing on the Medieval Baltic Frontier: A Companion to the Chronicle of Henry of Livonia] / Michael Amundsen

    Index Scriptorium Estoniae

    Amundsen, Michael

    2012-01-01

    Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the Chronicle of Henry of Livonia / edited by Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Farnham : Ashgate, 2011

  11. Thinking in time an introduction to Henri Bergson

    CERN Document Server

    Guerlac, Suzanne

    2006-01-01

    "In recent years, we have grown accustomed to philosophical language that is intensely self-conscious and rhetorically thick, often tragic in tone. It is enlivening to read Bergson, who exerts so little rhetorical pressure while exacting such a substantial effort of thought. . . . Bergson's texts teach the reader to let go of entrenched intellectual habits and to begin to think differently—to think in time. . . . Too much and too little have been said about Bergson. Too much, because of the various appropriations of his thought. Too little, because the work itself has not been carefully studied in recent decades."—from Thinking in TimeHenri Bergson (1859–1941), whose philosophical works emphasized motion, time, and change, won the Nobel Prize for Literature in 1927. His work remains influential, particularly in the realms of philosophy, cultural studies, and new media studies. In Thinking in Time, Suzanne Guerlac provides readers with the conceptual and contextual tools necessary for informed appreciati...

  12. Henri Mitterand – Critique génétique et sociocritique

    OpenAIRE

    Mitterand, Henri; Biasi, Pierre-Marc de; Herschberg Pierrot, Anne

    2013-01-01

    Henri Mitterand est l’un des fondateurs de la sociocritique en France, et de la génétique zolienne. Il est aussi linguiste, sémioticien et stylisticien. Nous l’avons interrogé sur les relations complexes de la génétique et de la sociocritique. Sociocritique et sociogenèse Pierre-Marc de Biasi – Après une trentaine d’années de recul et d’expérience, quelle place donneriez-vous à la sociocritique et à la sociogenèse dans la construction du nouveau rapport critique qui s’est institué avec les ma...

  13. VIDEO: Dr. Henry Rodriguez - Proteogenomics in Cancer Medicine | Office of Cancer Clinical Proteomics Research

    Science.gov (United States)

    Dr. Henry Rodriguez, director of the Office of Cancer Clinical Proteomics Research (OCCPR) at NCI, speaks with ecancer television at WIN 2017 about the translation of the proteins expressed in a patient's tumor into a map for druggable targets. By combining genomic and proteomic information (proteogenomics), leading scientists are gaining new insights into ways to detect and treat cancer due to a more complete and unified understanding of complex biological processes.

  14. Pelecitus helicinus Railliet & Henry, 1910 (Filarioidea, Dirofilariinae and Other Nematode Parasites of Brazilian Birds

    Directory of Open Access Journals (Sweden)

    Oniki Yoshika

    2002-01-01

    Full Text Available We report Pelecitus helicinus Railliet & Henry, 1910 from 13 species of birds of 2 orders and 7 families, collected from the states of São Paulo and Mato Grosso, Brazil. All 13 constitute new host records for this nematode. In addition, we report the first record of Aprocta golvani Diaz-Ungria, 1963 from Brazil and Monasa nigrifrons (Bucconidae, as well as a number of other nematode records from Neotropical birds.

  15. Ernest Henry Starling: the history of cardiovascular endocrinology and the continuous need for developing animal models

    DEFF Research Database (Denmark)

    Henriksen, Jens Henrik Sahl

    2014-01-01

    The English physiologist, Ernest Henry Starling (1866–1927) (Fig. 1) in 1896, provided a quantitative explanation of the transcapillary transport of fluid. Six years later, he discovered the first hormone and introduced the concept of hormones in 1905, and at the time of the First World War, he f......’s achievements in cardiovascular physiology and endocrinology....

  16. All Are Worthy to Know the Earth: Henry De la Beche and the Origin of Geological Literacy

    Science.gov (United States)

    Clary, Renee M.; Wandersee, James H.

    2009-01-01

    Henry T. De la Beche (1796-1855) began his geological career within an elite circle (Geological Society of London, 1817; FRS, 1819), collaborating with influential gentlemen geologists and publishing original research. When his independent income dwindled, De la Beche managed to secure governmental funding for his mapping projects. This led to…

  17. "Undoubtedly a Powerful Influence": Victor Henry's "Antinomies linguistiques" (1896) with an Annotated Translation of the First Chapter.

    Science.gov (United States)

    Joseph, John E.

    1996-01-01

    Discusses Victor Henry's innovative presentation of some underlying contradictions in the premises on which linguistics is founded, cast in the Kantian form of antinomies. The review argues that no science remains more strongly contested than linguistics, a science whose origins are paradoxical and that contains outdated concepts. (30 references)…

  18. Quantum phase transitions of light in a dissipative Dicke-Bose-Hubbard model

    Science.gov (United States)

    Wu, Ren-Cun; Tan, Lei; Zhang, Wen-Xuan; Liu, Wu-Ming

    2017-09-01

    The impact that the environment has on the quantum phase transition of light in the Dicke-Bose-Hubbard model is investigated. Based on the quasibosonic approach, mean-field theory, and perturbation theory, the formulation of the Hamiltonian, the eigenenergies, and the superfluid order parameter are obtained analytically. Compared with the ideal cases, the order parameter of the system evolves with time as the photons naturally decay in their environment. When the system starts with the superfluid state, the dissipation makes the photons more likely to localize, and a greater hopping energy of photons is required to restore the long-range phase coherence of the localized state of the system. Furthermore, the Mott lobes depend crucially on the numbers of atoms and photons (which disappear) of each site, and the system tends to be classical with the number of atoms increasing; however, the atomic number is far lower than that expected under ideal circumstances. As there is an inevitable interaction between the coupled-cavity array and its surrounding environment in the actual experiments, the system is intrinsically dissipative. The results obtained here provide a more realistic image for characterizing the dissipative nature of quantum phase transitions in lossy platforms, which will offer valuable insight into quantum simulation of a dissipative system and which are helpful in guiding experimentalists in open quantum systems.

  19. WWER440 few group data library preparation and its application in MOBY-DICK modular system

    International Nuclear Information System (INIS)

    Krysl, V.; Mikolas, P.; Svarny, J.

    2002-01-01

    Paper provides summary of methodology of few-group library preparation with emphasis on new features of assemblies, like fuel assemblies with Gd burnable poison or Control Fuel Assembly with Hf plates. Special attention is devoted to the transient part (coupler) of Control Fuel Assembly from the point of view of boundary conditions preparation. Based of this methodology prepared library is implemented into macro code for different number of axial meshes for both coarse and fine mesh diffusion calculations. Problems with local power peaking calculations in WWER-440 cores are closely connected with the correct modeling of the power perturbations in the neighbourhood of Control Fuel Assembly coupler. The new version of MOBY-DICK provided with the new few group data library can assess most of effects induced by insertion of Control Fuel Assembly in the core including effects of newly designed Hf plates in the coupler of Control Fuel Assembly. Compatibility of transport and diffusion calculation was taken into account in the analysis of Control Fuel Assembly movement without/with Hf plates (Authors)

  20. The discovery of uranic rays: a short step for Henri Becquerel but a giant step for science

    International Nuclear Information System (INIS)

    Genet, M.

    1995-01-01

    In March 1896, Antoine Henri Becquerel discovered radioactivity. This success is largely due to a tradition of high-level scientific research which prevailed over three generations in the Becquerel family. The circumstances of the discovery and the controversies which followed are reviewed within the framework of their scientific and historical context. (orig.)

  1. Literary Practice according to Michel Henry: A Philosophical Introduction to his Novels

    Directory of Open Access Journals (Sweden)

    Jean-Baptiste Dussert

    2012-12-01

    Full Text Available Although the author of four novels, Michel Henry never produced an aesthetics of literature. The purpose of this article is, after a presentation of his philosophy of immanence and his concept of life, to locate where the literary practice takes place in his system. In this study, we are not interested in the poetic quality of his works, but in the possibility to base his singular creativity on his philosophical reflection. This leads us to insert literature in the vast phenomenon of culture and ethics, and to grasp the function of poetics in the struggle against barbarism.

  2. Elementos de política de gestión en Henry Mintzberg

    OpenAIRE

    García-Álvarez, S. (Santiago); García-Martínez, A.N. (Alejandro Néstor); Múgica, F. (Fernando)

    2016-01-01

    El trabajo de investigación consistió en estudiar un buen número de los escritos de Henry Mintzberg y prácticamente todas sus obras relacionadas con los elementos de política de gestión: no únicamente los libros, sino numerosos artículos y textos relacionados. He leído también muchos libros y artículos de otros autores de management, como Drucker, Collins, Kotter, Pfeffer, Peters y varios más, para enriquecer el texto y contrastar posturas. He estudiado con particular interés y detenimiento l...

  3. Henry Agard Wallace, the Iowa Corn Yield Tests, and the Adoption of Hybrid Corn

    OpenAIRE

    Richard C. Sutch

    2008-01-01

    This research report makes the following claims: 1] There was not an unambiguous economic advantage of hybrid corn over the open-pollinated varieties in 1936. 2] The early adoption of hybrid corn before 1937 can be better explained by a sustained propaganda campaign conducted by the U.S. Department of Agriculture at the direction of the Secretary of Agriculture, Henry Agard Wallace. The Department's campaign echoed that of the commercial seed companies. The most prominent hybrid seed company,...

  4. Henry Head and the Theatre of Reverie

    Directory of Open Access Journals (Sweden)

    Tiffany Watt-Smith

    2011-04-01

    Full Text Available In 1903, the neurologist Henry Head (1861-1940 embarked on a painful self-experiment, in which he severed the radial nerve of his left arm, and then charted the gradual and faltering return of sensitivity to the limb over the next four and a half years. To directly experience his own sensations, Head entered into a trance-like state of distraction or reverie he called a ‘negative attitude of attention’. This article explores Head’s peculiar technique for looking within, and argues that while introspection was an established strategy in psychological laboratories, Head’s reverie also resonated with techniques associated with actors and theatrical audiences during this period. Viewing psychological self-experimentation through the lens of theatre, this article makes visible aspects of Head’s embodied, affective laboratory encounters, often obscured in accounts of his experiment. At the same time, it proposes that the broader historical and cultural significance of Head’s experiment lies in his attempt to observe himself by producing states of inattention and reverie at will, mental ‘attitudes’ that were themselves the subject of a rapidly evolving debate in scientific and aesthetic circles at the turn of the twentieth century.

  5. Development of low-energy X-ray spectrometry at the Laboratoire National Henri Becquerel

    International Nuclear Information System (INIS)

    Lepy, M.C.; Plagnard, J.

    2007-01-01

    In the frame of the French Metrology Institute, the Laboratoire National Henri Becquerel performs accurate characterization of semiconductor detectors that are in use in a number of applications. Their efficiency calibration, energy resolution and the detailed shape of their response function are parameters of interest for accurate processing of low-energy X-ray spectra to be applied to elements identification and fundamental research studies. The tools specifically developed for low-energy detectors calibration and characterization are described, from the use of radioactivity standard to the development of a tunable monochromatic X-ray source. (Author)

  6. The Allison V. Armour / William Henry Holmes 1895 Expedition to Mexico

    Directory of Open Access Journals (Sweden)

    Warren Haskin

    2001-11-01

    Full Text Available The foundation of the Field Museum's reputation as a place where serious science is practiced was laid by Allison V. Armour and William Henry Holmes in 1895, a little more than a year after the Museum was established. Looking back after a career of almost 60 years as an anthropologist, and having twice been honored as the outstanding practitioner in the field, Holmes described the trip to Mexico (the only expedition he led during his brief tenure as the Museum's first Curator of An­thropology as "one of the most gratifying and important events of my life." It was also one of the most important events in the history of anthropology at the Museum.

  7. Inverse modeling for seawater intrusion in coastal aquifers: Insights about parameter sensitivities, variances, correlations and estimation procedures derived from the Henry problem

    Science.gov (United States)

    Sanz, E.; Voss, C.I.

    2006-01-01

    Inverse modeling studies employing data collected from the classic Henry seawater intrusion problem give insight into several important aspects of inverse modeling of seawater intrusion problems and effective measurement strategies for estimation of parameters for seawater intrusion. Despite the simplicity of the Henry problem, it embodies the behavior of a typical seawater intrusion situation in a single aquifer. Data collected from the numerical problem solution are employed without added noise in order to focus on the aspects of inverse modeling strategies dictated by the physics of variable-density flow and solute transport during seawater intrusion. Covariances of model parameters that can be estimated are strongly dependent on the physics. The insights gained from this type of analysis may be directly applied to field problems in the presence of data errors, using standard inverse modeling approaches to deal with uncertainty in data. Covariance analysis of the Henry problem indicates that in order to generally reduce variance of parameter estimates, the ideal places to measure pressure are as far away from the coast as possible, at any depth, and the ideal places to measure concentration are near the bottom of the aquifer between the center of the transition zone and its inland fringe. These observations are located in and near high-sensitivity regions of system parameters, which may be identified in a sensitivity analysis with respect to several parameters. However, both the form of error distribution in the observations and the observation weights impact the spatial sensitivity distributions, and different choices for error distributions or weights can result in significantly different regions of high sensitivity. Thus, in order to design effective sampling networks, the error form and weights must be carefully considered. For the Henry problem, permeability and freshwater inflow can be estimated with low estimation variance from only pressure or only

  8. HB1204: Deep-Sea Corals and Benthic Habitats in Northeast Deepwater Canyons on NOAA Ship Henry Bigelow between 20120703 and 20120718

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A multi-disciplinary team of scientists on the Henry Bigelow HB1204 mission surveyed and ground-truthed known or suspected deep-sea coral habitats associated with...

  9. Style and non-style in anatomical illustration: From Renaissance Humanism to Henry Gray.

    Science.gov (United States)

    Kemp, Martin

    2010-02-01

    Style is a familiar category for the analysis of art. It is less so in the history of anatomical illustration. The great Renaissance and Baroque picture books of anatomy illustrated with stylish woodcuts and engravings, such as those by Charles Estienne, Andreas Vesalius and Govard Bidloo, showed figures in dramatic action in keeping with philosophical and theological ideas about human nature. Parallels can be found in paintings of the period, such as those by Titian, Michelangelo and Hans Baldung Grien. The anatomists also claimed to portray the body in an objective manner, and showed themselves as heroes of the discovery of human knowledge. Rembrandt's painting of Dr Nicholas Tulp is the best-known image of the anatomist as hero. The British empirical tradition in the 18th century saw William Cheselden and William Hunter working with techniques of representation that were intended to guarantee detailed realism. The ambition to portray forms life-size led to massive volumes, such as those by Antonio Mascagni. John Bell, the Scottish anatomist, criticized the size and pretensions of the earlier books and argued for a plain style adapted to the needs of teaching and surgery. Henry Gray's famous Anatomy of 1858, illustrated by Henry Vandyke Carter, aspired to a simple descriptive mode of functional representation that avoided stylishness, resulting in a style of its own. Successive editions of Gray progressively saw the replacement of Gray's method and of all his illustrations. The 150th anniversary edition, edited by Susan Standring, radically re-thinks the role of Gray's book within the teaching of medicine.

  10. Review: Henry E. Brady & David Collier (Hrsg.) (2004). Rethinking Social Inquiry: Diverse Tools, Shared Standards

    OpenAIRE

    Catón, Matthias

    2006-01-01

    Das Buch Rethinking Social Inquiry, herausgegeben von Henry E. BRADY und David COLLIER, ist eine Antwort auf den Band von KING, KEOHANE und VERBA (1994), in dem versucht wird, Standards der quantitativen Forschung in der qualitativen Forschung einzuführen. Die Autoren des hier rezensierten Buchs kritisieren viele der Vorschläge, da sie argumentieren, dass qualitative Forschung anderer Werkzeuge bedürfe. Trotzdem stimmen sie zu, dass die Grundlagen des Forschungsaufbaus ähnlich sind. Das Buch ...

  11. Review: Henry E. Brady & David Collier (Eds.) (2004). Rethinking Social Inquiry: Diverse Tools, Shared Standards

    OpenAIRE

    Matthias Catón

    2006-01-01

    Das Buch Rethinking Social Inquiry, herausgegeben von Henry E. BRADY und David COLLIER, ist eine Antwort auf den Band von KING, KEOHANE und VERBA (1994), in dem versucht wird, Standards der quantitativen Forschung in der qualitativen Forschung einzuführen. Die Autoren des hier rezensierten Buchs kritisieren viele der Vorschläge, da sie argumentieren, dass qualitative Forschung anderer Werkzeuge bedürfe. Trotzdem stimmen sie zu, dass die Grundlagen des Forschungsaufbaus ähnlich sind. Das Buch ...

  12. Revisiting the Classic Moby Dick: The Environmental Significance of the Narrative in the Light of International Environmental Law on the Preservation of the Whaling Marine Life

    Directory of Open Access Journals (Sweden)

    Ana Cristina Alves de Paula

    2016-12-01

    Full Text Available This article aims to analyze the environmental significance of Moby Dick, narrative that, in the mid-nineteenth century, warned, indirectly, on the need to preserve nature against the excesses of whaling. For this, we analyzed the main regulations that composes the environmental protection regime for whaling marine life, one of which allowed exceptions to the prohibition of hunting, based both on alleged scientific research needs as the claim of cultural practices, and the decision of the ICJ in the case brought by Australia in face of Japan.

  13. Publicações póstumas de Henri Fayol: revisitando sua teoria administrativa

    OpenAIRE

    Souza, Edson Miranda De; Aguiar, Afrânio Carvalho

    2011-01-01

    O engenheiro francês Henri Fayol (1841-1925) é usualmente apresentado aos estudantes de Administração como o Pai da Escola Clássica de Administração, o que demonstra uma representação limitada da amplitude de sua contribuição para a evolução do pensamento administrativo. Além disso, é frequentemente associado ao seu contemporâneo, o teórico norte-americano Frederick Taylor, sendo aos dois atribuída a defesa de um modelo autoritário de administração. Entretanto, recentemente, pesquisadores des...

  14. Publicações póstumas de Henri Fayol: revisitando sua teoria administrativa.

    OpenAIRE

    Edson Miranda de Souza; Afrânio Carvalho Aguiar

    2011-01-01

    O engenheiro francês Henri Fayol (1841-1925) é usualmente apresentado aos estudantes de Administração como o Pai da Escola Clássica de Administração, o que demonstra uma representação limitada da amplitude de sua contribuição para a evolução do pensamento administrativo. Além disso, é frequentemente associado ao seu contemporâneo, o teórico norte-americano Frederick Taylor, sendo aos dois atribuída a defesa de um modelo autoritário de administração. Entretanto, recentemente, pesquisadores des...

  15. [Crusading and chronicle writing on the medieval Baltic frontier: A companion to the chronicle of Henry of Livonia] / Radosław Biskup

    Index Scriptorium Estoniae

    Biskup, Radosław

    2014-01-01

    Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the chronicle of Henry of Livonia, eds. Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Farnham ; Burlington (Vt.) : Ashgate, c2011

  16. The study of patient henry Molaison and what it taught us over past 50 years: Contributions to neuroscience

    Directory of Open Access Journals (Sweden)

    Bigya Shah

    2014-01-01

    Full Text Available This section provides a historical perspective and contributions from one of the most studied patients in neuroscience, Henry Molaison (1926-2008, known as H.M during his life to protect his privacy. The peculiar memory deficits seen after an experimental operation for intractable epilepsy led to some critical discoveries pertaining to memory organization in human brain.

  17. Theoretical Insight of Physical Adsorption for a Single Component Adsorbent + Adsorbate System: II. The Henry Region

    KAUST Repository

    Chakraborty, Anutosh

    2009-07-07

    The Henry coefficients of a single component adsorbent + adsorbate system are calculated from experimentally measured adsorption isotherm data, from which the heat of adsorption at zero coverage is evaluated. The first part of the papers relates to the development of thermodynamic property surfaces for a single-component adsorbent + adsorbate system1 (Chakraborty, A.; Saha, B. B.; Ng, K. C.; Koyama, S.; Srinivasan, K. Langmuir 2009, 25, 2204). A thermodynamic framework is presented to capture the relationship between the specific surface area (Ai) and the energy factor, and the surface structural and the surface energy heterogeneity distribution factors are analyzed. Using the outlined approach, the maximum possible amount of adsorbate uptake has been evaluated and compared with experimental data. It is found that the adsorbents with higher specific surface areas tend to possess lower heat of adsorption (ΔH°) at the Henry regime. In this paper, we have established the definitive relation between Ai and ΔH° for (i) carbonaceous materials, metal organic frameworks (MOFs), carbon nanotubes, zeolites + hydrogen, and (ii) activated carbons + methane systems. The proposed theoretical framework of At and AH0 provides valuable guides for researchers in developing advanced porous adsorbents for methane and hydrogen uptake. © 2009 American Chemical Society.

  18. Contribuições de Henri Wallon à relação cognição e afetividade na educação Contributions from Henri Wallon to the relationship between cognition and affectivity in education

    Directory of Open Access Journals (Sweden)

    Aurino Lima Ferreira

    2010-01-01

    Full Text Available O presente artigo versa sobre as contribuições de Henri Wallon à relação cognição e afetividade na educação. Situa e define os complexos afetivos e cognitivos na teoria waloniana e destaca a noção de pessoa engajada como síntese fundamental para o entendimento da relação entre afetividade e cognição no campo educacional. Busca ainda apontar a importância da visão dialética e humanista da pessoa completa de Wallon para as práticas educacionais e retoma a ideia de "circularidade fundamental" de Francisco Varela para atualizar a visão de Wallon sobre a não separatividade entre homem e mundo.This paper focuses on the contributions from Henri Wallon about the relationship between cognition and affectivity in the education. It also defines the complex interdependency between affective and cognitive dimensions of such theory and emphasizes the notion of engaged person as a fundamental synthesis to understanding the relationship between affectivity and cognition in the educational field. This article also highlights the importance of dialectical and humanist view of integral person for educational practices and it incorporates the idea of "fundamental circularity" of Francisco Varela aiming to updating the view of Wallon about non-separateness between human beings and world.

  19. Performance of an alkalophilic and halotolerant laccase from gamma-proteobacterium JB in the presence of industrial pollutants.

    Science.gov (United States)

    Singh, Gursharan; Sharma, Prince; Capalash, Neena

    2009-08-01

    An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.

  20. Never say Never. About the Restoration of Henry van de Velde’s Booktower

    Directory of Open Access Journals (Sweden)

    Sylvia van Peteghem

    2006-08-01

    Full Text Available The role of the central library within the university of Ghent (27.000 students is fourfold: it is the centre of the library’s network and its reorganisation, trying to get the current number (> 300 of libraries down. It is the digital library in all its aspects, it is the repository library for cultural heritage and “passive” collections and it offers a working place in its wonderful book tower of Henry van de Velde. The story of the book tower starts in the 1930s when Henry van de Velde was asked to build a University Library and offices for the department of Art history. His tower-idea was not exactly what the chief librarian had in mind, so he had to (network hard to get the building he wanted. It was finished on the verge of the second world war. The concrete building has a height of 64 meter, has 24 floors and a “belvedere” and houses almost 3 million books in closed racks. The university did not neglect the tower during all these years, but was not always aware of the historical value and often choose the cheapest way for building matters. A couple of years ago a private person bought the Van de Velde archive of the book tower (which was in private hands, got fascinated with the building, got angry because of lack of care and networked (maybe as hard as Van de Velde once did to get it built to get it restored. The board of directors of the university said yes to the restoration (estimated on 41 million Euro in September 2005.

  1. Design of a gap tunable flux qubit with FastHenry

    Science.gov (United States)

    Akhtar, Naheed; Zheng, Yarui; Nazir, Mudassar; Wu, Yulin; Deng, Hui; Zheng, Dongning; Zhu, Xiaobo

    2016-12-01

    In the preparations of superconducting qubits, circuit design is a vital process because the parameters and layout of the circuit not only determine the way we address the qubits, but also strongly affect the qubit coherence properties. One of the most important circuit parameters, which needs to be carefully designed, is the mutual inductance among different parts of a superconducting circuit. In this paper we demonstrate how to design a gap-tunable flux qubit by layout design and inductance extraction using a fast field solver FastHenry. The energy spectrum of the gap-tunable flux qubit shows that the measured parameters are close to the design values. Project supported by the National Natural Science Foundation of China (Grant Nos. 11374344, 11404386, and 91321208), the National Basic Research Program of China (Grant No. 2014CB921401), and the Strategic Priority Research Program of the Chinese Academy of Sciences (Grant No. XDB07010300).

  2. On the "Critique of Everyday Life" to "Metaphilosophy": Henri Lefebvre's Philosophical-Political Legacy of the Cultural Revolution

    Science.gov (United States)

    Sünker, Heinz

    2014-01-01

    Henri Lefebvre (1901-91), philosopher and sociologist, is, together with Theodor W. Adorno, Max Horkheimer, Walter Benjamin and Ernst Bloch, one of the most relevant representatives of the first generation in Western Marxism. His engagement with Marxism led him to analyse everyday life in post-war France in order to decipher the possibilities of,…

  3. [Charles-Henri Fialon (1846-1933). Creator of the historical museum of the faculty of pharmacy of Paris].

    Science.gov (United States)

    Bzoura, Elie; Flahaut, Jean

    2004-01-01

    Charles-Henri Fialon stopped his pharmaceutical activities in 1892 and he devoted his time to artistic and historic works. He achieved an important collection of pharmaceutical pots and objects which he gave to the school of Pharmacy of Paris. These gifts were collected in a room named "Musée Fialon ". This museum was enlarged twice and presently is in the "Guillaume Valette" gallery. His content is described in this paper.

  4. Modernization of Henry Borden hydroelectric power plant: The ELETROPAULO`s, The Electric Power Company of Sao Paulo State, experience in no.1 generator power improvement; Modernizacao da Usina Henry Borden (a experiencia da ELETROPAULO na repotenciacao do gerador nr. 1)

    Energy Technology Data Exchange (ETDEWEB)

    Delbone, Edval; Matos, Jose Alberto da S.; Grassi, Marco A; Oliveira, Robinson C; Sertori, Sergio R [Eletricidade de Sao Paulo SA, SP (Brazil); Duarte, F I; Pires, Nilo Ramos; Yamagushi, Luiz Massao [Asea Brown Boveri (ABB) (Brazil)

    1996-12-31

    The need for the substitution of several the generating equipment of Henry Borden hydroelectric power plant due to the end of their service life, in addition to the difficult economic situation and specific characteristics of the unit, leaded ELETROPAULO company to decide for the power improvement of some equipment. This work presents this experience giving special emphasis to the procedure adopted and results obtained 2 tabs.

  5. Henry Beecher's Contributions to the Ethics of Clinical Research.

    Science.gov (United States)

    Veatch, Robert M

    2016-01-01

    In the 1950s and '60s, Henry Beecher pioneered the discussion of the ethics of clinical research, leading eventually to the publication of the famous New England Journal of Medicine article summarizing 22 research studies that Beecher suggests were unethical. Those studies generally showed a pattern of posing serious risks to subjects without anticipated proportional benefit. Beecher famously claimed that the problem was not that researchers were malicious or evil; rather, he claimed the problem was they manifested thoughtlessness or carelessness. He called for more rigorous self-scrutiny rather than public review.This article argues that Beecher's reliance on conscientious investigators is problematic. In particular, it focuses on benefits and harms to the exclusion of other moral criteria. However, both research subjects and public regulators are also concerned about autonomy and the consent requirement, confidentiality, and fairness in subject selection and research design. The movement in the 1970s toward more public scrutiny was critical, even though Beecher was right in holding that it was not "vicious disregard for subject welfare" that explained unethical protocols.

  6. Fordlândia e Belterra: as cidades de Henry Ford na Amazônia

    OpenAIRE

    Duarte Jr., Antonio Marcos; UERJ & Ibmec/RJ

    2015-01-01

    Ao final de 1945, a Ford Motor Company apresenta sérios problemas de gestão. Nesse contexto, Henry Ford II precisa decidir o que fazer com Fordlândia e Belterra, as duas problemáticas cidades construídas por seu avô na Amazônia brasileira.O caso foi elaborado para utilização em disciplinas na área de finanças corporativas, abordando temas relacionados a análise econômica e de riscos presentes em projetos de investimento.  Pode ser interessante também em diferentes disciplinas que tratem de te...

  7. The human and the inhuman: visual culture, political culture, and the images produced by George Rodger and Henri Cartier-Bresson in the Nazi concentration camps

    Directory of Open Access Journals (Sweden)

    Erika Cazzonatto Zerwes

    2016-08-01

    Full Text Available This article aims to grasp some aspects of the notion of humanism in photography and its closeness to the political culture and the visual culture in the period, through the specific experiences of George Rodger and Henri Cartier-Bresson, two photographers who were first-hand witnesses and provided accounts of horror in the Nazi concentration camps at the end of World War II. George Rodger photographed the Bergen-Belsen camp as soon as it was liberated by the British troops. Henri Cartier-Bresson was there with a film crew recording the deported masses newly freed from the Nazi concentration and extermination camps. These experiences came to have profound impact on the biography and work of both of them. In the two cases, there is a notion of humanism linked to World War II events, which is observed in photography and photographic representation, and it has a significant consequence for the contemporary visual culture.   Keywords: Visual Culture; Political Culture; War Photography; Photojournalism; Concentration Camps.   Original title: O humano e o desumano: cultura visual, cultura política e as imagens feitas por George Rodger e Henri Cartier-Bresson nos campos de concentração nazistas.

  8. The Paradox of Being a Wounded Healer: Henri J.M. Nouwen’s Contribution to Pastoral Theology

    Directory of Open Access Journals (Sweden)

    S. Philip Nolte

    2010-11-01

    Full Text Available This article is the first in a series of two dealing with Henri Nouwen’s contribution to pastoral care. The present article focuses on the impact of cognitive dissonance and the role it plays in pastors becoming constrained in their ministry. The point of departure is that during the past two decades, pastors have been subjected to profound changes. While pastors view their involvement with people in the social and faith communities in which they live and work as guiding people towards a life of wholeness and integrity, they themselves, because of their own inner woundedness, struggle to live a life of wholeness. This article investigates how pastors can act congruently and with integrity in a world that has been profoundly changed by a shift from a modern to a postmodern paradigm. This reflection explores the ancient Greek mythological origins of the concept ‘wounded healer’. It also shows that, in its utilisation by the Swiss psychiatrist Carl Jung, the concept became a metaphor. This insight leads to a discussion of how Henri Nouwen applied the significance of the metaphor to pastoral ministry. The discussion takes on the form of certain relevant biographical side notes on Nouwen’s contribution to pastoral theology. The article concludes with an exposition of Nouwens’s use of the metaphor in his book, The wounded healer: Ministry in contemporary society.

  9. Meet the HENRYs: A hybrid focus group study of conspicuous luxury consumption in the social media context

    OpenAIRE

    Kennedy, G.; Bolat, Elvira

    2017-01-01

    Social media has created different dimension of consumers for luxury products, specifically the aspirational consumer who wishes to own a product, but for economic reasons cannot. In other words aspirational consumers use luxury brands to create value for themselves using social media to conspicuously consume without purchase. Aspirational consumers are mostly found among HENRYs (high earners, not rich yet). Studies around conspicuous consumption of luxury products as a result of digital tech...

  10. Banque centrale, taux de l'escompte et politique monétaire chez Henry Thornton (1760-1815).

    OpenAIRE

    Mésonnier, J-S.

    2002-01-01

    Henry Thornton (1760-1815), whose major work - An Enquiry into the Nature and Effects of the Paper Credit of Great Britain - is celebrating its bicentennary in 2002, is considered today to be one of the most prominent classical monetary economist, in particular with regard to its seminal contribution to the theory of the lender of last resort. However, Thornton's original views about the rate of interest on bank credit have barely been commented so far. In this paper, we endeavour to link the...

  11. Extended phase space thermodynamics and P-V criticality: Brans-Dicke-Born-Infeld vs. Einstein-Born-Infeld-dilaton black holes

    Energy Technology Data Exchange (ETDEWEB)

    Hendi, S.H. [Shiraz University, Physics Department and Biruni Observatory, College of Sciences, Shiraz (Iran, Islamic Republic of); Research Institute for Astronomy and Astrophysics of Maragha (RIAAM), P. O. Box 55134-441, Maragha (Iran, Islamic Republic of); Tad, R.M.; Armanfard, Z.; Talezadeh, M.S. [Shiraz University, Physics Department and Biruni Observatory, College of Sciences, Shiraz (Iran, Islamic Republic of)

    2016-05-15

    Motivated by a thermodynamic analogy of black holes and Van der Waals liquid/gas systems, in this paper, we study P-V criticality of both dilatonic Born-Infeld black holes and their conformal solutions, Brans-Dicke-Born-Infeld solutions. Due to the conformal constraint, we have to neglect the old Lagrangian of dilatonic Born-Infeld theory and its black hole solutions, and introduce a new one. We obtain spherically symmetric nonlinearly charged black hole solutions in both Einstein and Jordan frames and then we calculate the related conserved and thermodynamic quantities. After that, we extend the phase space by considering the proportionality of the cosmological constant and thermodynamical pressure. We obtain critical values of the thermodynamic coordinates through numerical methods and plot the relevant P-V and G-T diagrams. Investigation of the mentioned diagrams helps us to study the thermodynamical phase transition. We also analyze the effects of varying different parameters on the phase transition of black holes. (orig.)

  12. Sterilization of health care products - Chemical indicators - Part 5: Class 2 indicators for Bowie and Dick-type air removal tests. 2. ed.

    International Nuclear Information System (INIS)

    2007-01-01

    The air removal test is used to evaluate the efficacy of air removal during the pre-vacuum phase of a prevacuum sterilization cycle or during the pulsing stage of positive pulsing cycles if non-condensable gases were present in the steam. Retention of air due to an inefficient air removal stage or the presence of an air leak or non-condensable gases during the air removal stage are circumstances which can lead to failure of the test. This part of ISO 11140 describes the requirements for Class 2 indicators for Bowie and Dick-type air removal test sheets and packs. For a description of the classes of chemical indicators, see ISO 11140-1. The difference between the steam penetration test (ISO 11140-3 and ISO 11140-4) and the air removal test (ISO 11140-5) is described in the chemical indicator guidance document (ISO 15882). This part of ISO 11140 specifies the requirements for Class 2 indicators for Bowie and Dick-type air removal tests used to evaluate the effectiveness of air removal during the pre-vacuum phase of pre-vacuum steam sterilization cycles. Additionally, this part of ISO 11140 includes test methods and equipment used to meet these performance requirements. The paper provides information on scope, normative references, terms and definitions, general requirements, indicator system, its format and performance, indicator, its format and performance, packaging and labelling, quality assurance and sampling conditioning. 7 annexes report on the determination of the degree of contrast between the colour of the substrate and the indicator agent, the method of determining uniform colour change on exposure to saturated steam, the method of determining indicator colour change on exposure to dry heat, the method of determining transfer of indicator agent to standard test pack, standard test pack, the method of determining non-uniform colour change on exposure to a standard fault condition, and the steam exposure apparatus. Finally a bibliography is provided

  13. HENRY CHARLES LEA Y SU RED DE COLABORADORES LATINOAMERICANOS: RAZONES PARA ESTUDIAR EL SANTO OFICIO EN LA SEGUNDA MITAD DEL SIGLO XIX

    Directory of Open Access Journals (Sweden)

    Doris Moreno

    2013-12-01

    Full Text Available Se aborda en este artículo la vida y pensamiento de Henry Charles Lea en relación a sus estudios sobre la historia de la Inquisición española. Se esboza brevemente la red de colaboradores que Lea estableció en toda Latinoamérica así como su perfil político e intelectual, subrayando su importancia para la escritura de la obra The Inquisition in the Spanish Dependencies (1908. Finalmente, se plantean los motivos que llevaron a estos intelectuales a colaborar intensamente con el historiador norteamericano en el marco de los procesos de construcción de identidades sociales y políticas en Latinoamérica en la segunda mitad del siglo XIX. Se toma como eje conductor de este planteamiento la correspondencia de Juan María Gutiérrez con Henry Charles Lea.

  14. Henri Cartier-Bresson / Walker Evans : Photographier l’Amérique (1929-1947

    Directory of Open Access Journals (Sweden)

    François Brunet

    2009-08-01

    Full Text Available Dans un mot adressé en 2001 à Peter Galassi, conservateur de la photographie au MOMA, Henri Cartier-Bresson, alors âgé de quatre-vingt-treize ans, écrivait plaisamment — mais non pas complaisamment : « If it had not been for the challenge of the work of Walker Evans, I don’t think I would have remained a fotographer » (« sans le défi constitué par le travail de Walker Evans, je ne crois pas que je serais resté fotographe ». Pour fêter le centenaire de Cartier-Bresson, c’est ce défi — plutôt ...

  15. Samuel Hartlib on the death of Descartes: a rediscovered letter to Henry More

    Science.gov (United States)

    Penman, Leigh T. I.

    2015-01-01

    This paper discloses the content of a previously overlooked epistle by the Anglo-Prussian intelligencer Samuel Hartlib to Henry More concerning the death of René Descartes. After a discussion situating the letter within the sequence of the More–Hartlib correspondence, an analysis of the rhetorical structure of the epistle is offered, followed by a brief assessment of Hartlib's attitude towards Descartes, and the identification of his source concerning the news of the philosopher's death. An account of the transmission of the letter via a nineteenth-century periodical is also provided. The text of Hartlib's letter and an overlooked passage of Hartlib's diary concerning Descartes's death, which draws on the content of the More letter, are presented as appendixes.

  16. Measurement of Henry's Law Constants Using Internal Standards: A Quantitative GC Experiment for the Instrumental Analysis or Environmental Chemistry Laboratory

    Science.gov (United States)

    Ji, Chang; Boisvert, Susanne M.; Arida, Ann-Marie C.; Day, Shannon E.

    2008-01-01

    An internal standard method applicable to undergraduate instrumental analysis or environmental chemistry laboratory has been designed and tested to determine the Henry's law constants for a series of alkyl nitriles. In this method, a mixture of the analytes and an internal standard is prepared and used to make a standard solution (organic solvent)…

  17. Anarchism and homosexuality in Wilhelmine Germany: Senna Hoy, Erich Mühsam, John Henry Mackay.

    Science.gov (United States)

    Fähnders, W

    1995-01-01

    Homosexuality and its social and legal suppression were heatedly discussed in early twentieth-century Germany, including on the left. Among the anarchists, positions with markedly diverse forms of argument were espoused by such prominent advocates of individualist anarchism as John Henry Mackay and by others coming from the Bakuninist tradition, such as Senna Hoy and Erich Mühsam. Their writings evidence that prior to World War I and into the 1920s, German anarchists--especially when compared with the Social Democrats--intervened consistently on behalf of individual self-determination extending into the sexual sphere, even though an undercurrent of hostility toward homosexuals persisted within the leftist movement as a whole.

  18. Genealogía de la conciencia en la filosofía de Henri Bergson

    OpenAIRE

    Urquijo Reguera, Mariana

    2016-01-01

    Esta investigación se propone mostrar la concepción de la conciencia de Henri Bergson (1859-1941) a través de una lectura crítica de su filosofía. El análisis recorre los textos del autor exponiendo su filosofía de la duración, frente a la filosofía que piensa en el espacio. El objetivo de este estudio ha sido demostrar la vigencia de su filosofía de cara a un diálogo con la ciencia contemporánea, su actualidad para pensar lso problemas filosóficos y los problemas contemporáneos. Partiendo d...

  19. Enhanced production of alkaline thermostable keratinolytic protease from calcium alginate immobilized cells of thermoalkalophilic Bacillus halodurans JB 99 exhibiting dehairing activity.

    Science.gov (United States)

    Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R

    2012-01-01

    The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.

  20. Polystyrene copolymer supported by substituted (1R,2R)-1,2-diphenylethane-1,2-diamine-copper(II) complexes: a recyclable catalyst for asymmetric Henry reactions

    Czech Academy of Sciences Publication Activity Database

    Androvič, L.; Drabina, P.; Panov, I.; Frumarová, Božena; Kalendová, A.; Sedlák, M.

    2014-01-01

    Roč. 25, č. 9 (2014), s. 775-780 ISSN 0957-4166 Institutional support: RVO:61389013 Keywords : cooper complexes * copolymers * asymmetric Henry reaction Subject RIV: CC - Organic Chemistry Impact factor: 2.155, year: 2014

  1. O humano e o desumano: cultura visual, cultura política e as imagens feitas por George Rodger e Henri Cartier-Bresson nos campos de concentração nazistas

    OpenAIRE

    Erika Cazzonatto Zerwes

    2016-01-01

    Este artigo busca compreender alguns aspectos da noção de humanismo na fotografia e sua proximidade com a cultura política e a cultura visual do período, a partir das experiências específicas de George Rodger e Henri Cartier-Bresson, dois fotógrafos que viveram em primeira mão e que deram testemunho do horror dos campos de concentração nazistas ao final da Segunda Guerra Mundial. George Rodger fotografou o campo de Bergen-Belsen assim que foi libertado pelas tropas britânicas. Henri Cartier-B...

  2. The National Shipbuilding Research Program. Proceedings of the REAPS Technical Symposium. Paper No. 21: Development of Effective Computer Capabilities by the J. J. Henry Company

    National Research Council Canada - National Science Library

    Fritz, W. B

    1980-01-01

    On April 2, 1980, the J. J. Henry Company, Inc signed an agreement with Cali & Associates to use the SPADES system of computer programs to enhance its preliminary contract and detail design service for its clients...

  3. How the Other Half Lives: Under the Arch with Lady Henry Somerset

    Directory of Open Access Journals (Sweden)

    Paisana Joanne

    2017-10-01

    Full Text Available The reforming work of Isabella Caroline Somerset (Lady Henry Somerset 1851-1921 is largely overlooked today. Dedicated to women’s causes at home and abroad and to temperance in particular, having first-hand knowledge of the privileged and the underprivileged, this determined, multi-talented and opinionated woman uncharacteristically wrote a fictional novel, Under the Arch (1906. In the novel, London aristocrats are portrayed rubbing shoulders with slum dwellers, but there is little real connection. The problems that the social policies introduced by the Liberals from 1906-1914 would address are nevertheless highlighted. It can be no coincidence that Somerset was well acquainted with many of these politicians. The themes of relieving the poor, Christian doctrine, marriage, women’s suffrage and imperialism are addressed, although Somerset’s focus is simply on “doing good” and loving one’s neighbour

  4. Política, Ciencia, Ética y Sociedad: su conjunción dialéctica en la experiencia del “Contingente Henry Reeve” Politics, Science, Ethics and Society: their dialectical conjunction in the experience of the "CONTINGENT HENRY REEVE"

    Directory of Open Access Journals (Sweden)

    Nereyda Martínez Suárez

    2006-12-01

    Full Text Available La investigación se centra en la caracterización de la actividad profesional del Contingente Médico Internacional “Henry Reeve”, especializado en situaciones de desastre y graves epidemias, tomando en cuenta el condicionamiento histórico social de la génesis del mismo, su desempeño profesional como parte de la sociedad revolucionaria cubana, así como su repercusión internacional; para lo mismo se realizó un estudio teórico, basado en la aplicación de los métodos históricos, de análisis y síntesis de fuentes documentales. El estudio permitió observar que, los servicios médicos no son únicamente un asunto de formación científica, es un asunto de política y de formación humanista. La posibilidad de su realización está condicionada histórica y socialmente de un modo concreto. La ciencia, ética y sociedad constituyen una unidad histórica que se asienta en un tipo cualitativo de política, por lo que la formación actual y futura de médicos y profesionales de la salud en nuestro país, deberá basarse en las necesidades de los campos, aldeas, barrios marginales y pobres de las ciudades del Tercer Mundo, consolidando los valores humanos necesarios en estos profesionales. Los miembros del Contingente Henry Reeve son portadores de profundos conocimientos científicos, de una fortaleza política, altos valores humanos y principios éticos inconfundibles, demostrados a través de estos años de revolución mediante la atención a nuestro pueblo, el cumplimiento de misiones internacionalistas y la colaboración médica en más de 100 países.This investigation is centred in the characterization of the professional activity of the International Medical Contingent ‘‘Henry Reeves'', specialized in disaster situations and serius epidemics, taking into account, its own social and historical nature, its professional acting as a part of the Cuban Revolutionary Society, as well as its international repercussion. For this reason a

  5. Preliminary assessment report for Fort William Henry Harrison, Montana Army National Guard, Helena, Montana

    International Nuclear Information System (INIS)

    DuWaldt, J.; Meyer, T.

    1993-07-01

    This report presents the results of the preliminary assessment (PA) conducted by Argonne National Laboratory at a Montana Army National Guard (MTARNG) property near Helena, Montana. Preliminary assessments of federal facilities are being conducted to compile the information necessary for completing preremedial activities and to provide a basis for establishing corrective actions in response to releases of hazardous substances. The principal objective of the PA is to characterize the site accurately and determine the need for further action by examining site activities, quantities of hazardous substances present, and potential pathways by which contamination could affect public health and the environment. This PA satisfies, for the Fort William Henry Harrison property, requirements of the Department of Defense Installation Restoration Program

  6. Une autre ville pour une autre vie. Henri Lefebvre et les situationnistes

    Directory of Open Access Journals (Sweden)

    Philippe Simay

    2008-12-01

    Full Text Available L’un des traits distinctifs du mouvement situationniste est de s’être constamment préoccupé de la question urbaine. Conçue comme l’espace de production de la société du spectacle mais aussi comme un terrain de lutte et d’expérimentation, la ville a représenté pour ce mouvement estudiantin, proche d’Henri Lefebvre, le lieu d’une réinvention radicale de la vie quotidienne. Cet article revient sur la critique situationniste de l’urbanisme de l’après-guerre ainsi que sur les pratiques auxquelles elle a donné lieu (détournement, dérive, cartes psychogéographiques, construction de situations éphémères. Celles-ci peuvent être regardées comme la première expression d’un « droit à la ville », tel que l’entendait Lefebvre. Reste à savoir si le groupe de Guy Debord souhaitait véritablement « changer la ville pour changer la vie » ou si la ville n’était que le théâtre d’une révolution à venir.One of the distinctive traits of the situationist movement is its constant preoccupation with the urban issue. For this student movement close to Henri Lefebvre, the city has been thought of as a choice generic location for the production of the Society of the Spectacle, but also as a test ground for struggle and experimentation – the place where a radical reinvention of daily life can occur. This paper goes back to the situationist critique of post-war urbanism, as well as the behaviors and practices it has given birth to (misappropriation, drifts in meaning, psychogeographic maps, the construct of short-lived situations. These can be seen as the first expression of a « right to the city », in the sense Lefebvre originally meant it have. However, it is still unknown whether Guy Debord's group really wished to « change city-life to change life itself », or if to them the city was merely a theater for the enactment of a revolution to come.

  7. The enigmatic figure of Dr Henry Maudsley (1835-1918).

    Science.gov (United States)

    Pantelidou, Maria; Demetriades, Andreas K

    2014-08-01

    In spite of his contribution to psychiatry in 19th century Britain, Henry Maudsley remains a mysterious figure, a man mostly known for his donation to the London County Council for the building of the Maudsley Hospital and for The Maudsley Annual Lecture created in honour of his benevolence. Besides Sir Aubrey Lewis' article in 1951 and Michael Collie's attempt in 1988 to construct a biographical study on Maudsley, there does not seem to be any current endeavour to tell the story of his life, whereas Trevor Turner's contribution to the 2004 Oxford Dictionary of National Biography gives a somewhat scathing but unattributed account of Maudsley's personality. This essay attempts to explore his contributions to the Medico-Psychological Association (MPA), the current Royal College of Psychiatrists, his editorship of the Journal of Mental Health (currently named the British Journal of Psychiatry), his literary contributions and his vision for a psychiatric hospital. This essay is an attempt to demystify his figure and to explore some of the rumours and criticisms surrounding his name and the reasons why so little has been written about him. It is also a venture to unravel his complex personality and his intricate philosophy. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  8. HENRY H. CHEEK AND TRANSFORMISM: NEW LIGHT ON CHARLES DARWIN'S EDINBURGH BACKGROUND.

    Science.gov (United States)

    Jenkins, Bill

    2015-06-20

    Evidence for the transformist ideas espoused by Henry H. Cheek (1807-33), a contemporary of Charles Darwin's at the University of Edinburgh, sheds new light on the intellectual environment of Edinburgh in the late 1820s and early 1830s. Cheek was the author of several papers dealing with the transmutation of species influenced by the theories of Etienne Geoffroy Saint-Hilaire (1772-1844), Jean-Baptiste Lamarck (1744-1829) and the Comte de Buffon (1707-88). Some of these were read to student societies, others appeared in the Edinburgh Journal of Natural and Geographical Science, which Cheek edited between 1829 and 1831. His writings give us a valuable window onto some of the transformist theories that were circulating among Darwin's fellow medical students in the late 1820s, to which Darwin would have been exposed during his time in Edinburgh, and for which little other concrete evidence survives.

  9. Role of postoperative radiotherapy in the treatment of Merkel tumours: experience at the Henri Mondor Hospital on 21 cases

    International Nuclear Information System (INIS)

    Calitchi, E.; Pan, Q.; Diana, C.; Belkacemi, Y.; Lagrange, J.L.

    2010-01-01

    As Merkel tumour treatment modalities are still a matter of discussion, the authors report the experience gained on 21 patients in the radiotherapy department of the Henri Mondor Hospital between 1990 and 2005. The treatment always comprised a surgical exeresis followed by radiotherapy. The authors analyse the obtained results which confirm the interest of postoperative radiotherapy. The detailed analysis of modalities (radiation type, total dose, irradiation volume) allows an optimal irradiation scheme to be proposed. Short communication

  10. Henry Solomon Wellcome: A philanthropist and a pioneer sponsor of medical research in the Sudan.

    Science.gov (United States)

    Adeel, Ahmed Awad A

    2013-01-01

    Henry Solomon Wellcome, the famous drug manufacturer had a fascinating association with the Sudan. Besides supporting tropical medicine research in this country, he established an extensive project in the Sudan that aimed at combining archeological excavations, philanthropy and social reform. This article is an archives-based account on this side of Wellcome's association with the Sudan. The article starts with Wellcome's early years in the American Midwest and the evolution of his career and his rise as a world-renowned drug manufacturer. After the battle of Omdurman, Wellcome visited Sudan in 1900 - 1901 where he offered to support the establishment of the research laboratories which later came to be known as the Wellcome Tropical Research Laboratories in Khartoum. He then became directly involved in the planning and running of extensive archeological excavations in the central Sudan. This project served as a field in which Wellcome found an outlet for his philanthropy. More than 4000 labourers were employed in Jebel Moya. Professional archeologists and anatomists were recruited by Wellcome to supervise the work, and all the requirements in terms of equipment were catered for. Wellcome devised a Savings Bank System whereby part of the earnings of each labourer were saved to him till the end of the season. He also introduced one of his innovations: aerial photography using box kite which was used for the first time in archeology. Wellcome made it a rule that no applicant should be turned away. The Camp Commandant had to find suitable work for each applicant, including the handicapped who were assigned to appropriate jobs like mending baskets or cutting grass for building huts. Wellcome's welfare work had a significant impact on the local inhabitants of Jebel Moya. Henry Solomon Wellcome, 1906. Oil painting by Hugh Goldwin Riviere. Credit: Wellcome Library.

  11. About Time. Physics, Philosophy and the Battle Between Albert Einstein and Henri Bergson

    Science.gov (United States)

    Frank, Adam

    The historical relationship between physics and philosophy has had many famous high and low points. The two function best when both can challenge and support each other. In this talk I explore the famous debate between Albert Einstein and Henri Bergson over the nature of time. While history rightly judged Einstein to have won the debate in terms of relativity, there were deeper aspects of Bergsons critique that remain unappreciated. We will explore the different ways philosophy approaches the issue of time. In particular, we will look at the Continental Schools\\x9D, such as Phenomenology, which brings a unique perspective to the debate lying outside the traditional approach of physicists. From this perspective questions related to the act of being an observer, its essential subjective nature and the proper context of physics can be explored.

  12. Mapping Henry: Synchrotron-sourced X-ray fluorescence mapping and ultra-high-definition scanning of an early Tudor portrait of Henry VIII

    Energy Technology Data Exchange (ETDEWEB)

    Dredge, Paula; Ives, Simon [Art Gallery of New South Wales (AGNSW), Sydney, NSW (Australia); Howard, Daryl L.; Spiers, Kathryn M. [Australian Synchrotron, Clayton, VIC (Australia); Yip, Andrew [Art Gallery of New South Wales (AGNSW), Sydney, NSW (Australia); University of New South Wales, Laboratory for Innovation in Galleries, Libraries, Archives and Museums (iGLAM), National Institute for Experimental Arts, Sydney, NSW (Australia); Kenderdine, Sarah [University of New South Wales, Laboratory for Innovation in Galleries, Libraries, Archives and Museums (iGLAM), National Institute for Experimental Arts, Sydney, NSW (Australia)

    2015-11-15

    A portrait of Henry VIII on oak panel c. 1535 has recently undergone technical examination to inform questions regarding authorship and the painting's relationship to a group of similar works in the collections of the National Portrait Gallery, London, and the Society of Antiquaries. Due to previous conservation treatments of the painting, the conventional transmission X-radiograph image was difficult to interpret. As a result, the painting underwent high-definition X-ray fluorescence (XRF) elemental mapping on the X-ray fluorescence microscopy beamline of the Australian Synchrotron. Scans were conducted at 12.6 and 18.5 keV, below and above the lead (Pb) L edges, respectively. Typical scan parameters were 120 μm pixel size at 7 ms dwell time, with the largest scan covering an area 545 x 287 mm{sup 2} collected in 23 h (10.8 MP). XRF mapping of the panel has guided the conservation treatment of the painting and the revelation of previously obscured features. It has also provided insight into the process of making of the painting. The informative and detailed elemental maps, alongside ultra-high-definition scans of the painting undertaken before and after varnish and over-paint removal, have assisted in comparison of the finely painted details with the London paintings. The resolution offered by the combination of imaging techniques identifies pigment distribution at an extremely fine scale, enabling a new understanding of the artist's paint application. (orig.)

  13. Mapping Henry: Synchrotron-sourced X-ray fluorescence mapping and ultra-high-definition scanning of an early Tudor portrait of Henry VIII

    International Nuclear Information System (INIS)

    Dredge, Paula; Ives, Simon; Howard, Daryl L.; Spiers, Kathryn M.; Yip, Andrew; Kenderdine, Sarah

    2015-01-01

    A portrait of Henry VIII on oak panel c. 1535 has recently undergone technical examination to inform questions regarding authorship and the painting's relationship to a group of similar works in the collections of the National Portrait Gallery, London, and the Society of Antiquaries. Due to previous conservation treatments of the painting, the conventional transmission X-radiograph image was difficult to interpret. As a result, the painting underwent high-definition X-ray fluorescence (XRF) elemental mapping on the X-ray fluorescence microscopy beamline of the Australian Synchrotron. Scans were conducted at 12.6 and 18.5 keV, below and above the lead (Pb) L edges, respectively. Typical scan parameters were 120 μm pixel size at 7 ms dwell time, with the largest scan covering an area 545 x 287 mm 2 collected in 23 h (10.8 MP). XRF mapping of the panel has guided the conservation treatment of the painting and the revelation of previously obscured features. It has also provided insight into the process of making of the painting. The informative and detailed elemental maps, alongside ultra-high-definition scans of the painting undertaken before and after varnish and over-paint removal, have assisted in comparison of the finely painted details with the London paintings. The resolution offered by the combination of imaging techniques identifies pigment distribution at an extremely fine scale, enabling a new understanding of the artist's paint application. (orig.)

  14. A Note on Child Neglect in American Victorianism: Henry James’ "The Pupil"

    Directory of Open Access Journals (Sweden)

    F. Gül KOÇSOY

    2016-12-01

    Full Text Available In this study, the theme of “neglected child” in Henry James’ “The Pupil” (1891 is explored. Morgan is a neglected child with unscrupulous parents who hold strictly on the Victorian values which reflect American cultural consciousness in the last decades of 19th century. Although he is a brilliant boy, the family does not love him; because he reminds them of their vulgarity. They neglect him physically and emotionally, seeing him as a burden. Although his tutor tries to keep the boy from the family’s corruption, he contributes to his death; he neglects his illness and deserts him when he is most needy. As an interpreter, James draws attention to the situation of children that are not working but being tutored at home. He criticizes this culture’s general attitude towards children. It is a disturbing social reality and he shows how that materialistic culture victimizes children in terms of neglectful parenting

  15. Etteheited räsivad pidu / Henri Reeder, Ly Rääsk, Heli Jürgenson ... [jt.] ; intervjueerinud Anneli Aasmäe

    Index Scriptorium Estoniae

    2009-01-01

    Küsimustele tänavusele üldlaulu- ja üldtantsupeole minekust ja peo repertuaari raskusest vastavad Aruküla noortekoori laulja Henri Reeder, Äksi segakoori dirigent Ly Rääsk, üldlaulupeo segakooride liigijuht Heli Jürgenson, Laulu- ja Tantsupeo SA muusikatoimetaja Ave Sopp, Laulu- ja Tantsupeo SA tantsutoimetaja Kadri Tiis , Lüganuse segakoori dirigent Priit-Andres Pärtna ja kolme tantsurühma juhendaja Vändrast Kädi Pärnoja

  16. Confronting empty spaces: between interpretation and experience in "The Turn of the Screw" by Henry James

    Directory of Open Access Journals (Sweden)

    Antonia Spinelli

    2015-01-01

    Full Text Available The Turn of the Screw by Henry James has inspired the most various critical debates for over a century. What is hidden in the folds of the story? What kind of impact does it have on the reader? Like a borderless nebula who attracts and reflects light from other stars, this novella is permeated by a vide fascinant, by a chaotic and disturbing matter “such stuff as dreams are made”. This feeling of absence and uncertainty, that characterizes the story, developed trough the contribution of readers and critics and it found a further still precious echo in The Innocents, a film directed by Jack Clayton in 1961.

  17. En camino hacia el Moby Dick de Herman Melville, encontré… Algunas notas preliminares de un libro sin escribir On My Way to Herman Melville’s Moby Dick, I Found … Some Preliminary Remarks from an Unwritten Book

    Directory of Open Access Journals (Sweden)

    Burkard Sievers

    2009-06-01

    Full Text Available Propósito: El autor está revisitando el cuerpo de sus manuscritos sobre el Moby Dick de Herman Melville, que comenzó a escribir hace unos 15 años. Aunque estos escritos siguen constituyendo un “libro sin escribir”, las obras de Melville tuvieron un impacto duradero sobre su pensamiento - abrieron nuevo caminos de inspiración- y escritura hasta el presente. El objetivo del documento es revelar algunas experiencias, estímulos, dificultades y emociones concomitantes con la escritura académica que siguen estando en su mayoría, escondidas del lector. Diseño/ metodología/acercamiento: Este artículo es una reminiscencia personal sobre la experiencia de la escritura académica de unas cuatro décadas. Es una historia de cómo un académico se familiariza con, y luego es influenciado/inspirado por una obra literaria, y descubre cuántos tópicos organizacionales pueden ser iluminados por trabajos literarios. Descubrimientos: Ni siquiera un libro sin escribir lleva necesariamente a descuidar completamente lo que había sido escrito. Esto podría ser un alivio y un estímulo para otros, quienes se dan cuenta de que no están solos en este sentido. Originalidad/valor: el artículo aporta un poco más de entendimiento sobre la experiencia no-tan-obvia y generalmente escondida, del “proceso de producción” de la escritura académica, e ilustra la relevancia e importancia de la literatura para pensar más allá, tópicos tales como la Administración y la organización.Purpose: The author is revisiting the body of his manuscripts on Herman Melville’s Moby Dick, which he began writing some 15 years ago. Though these writings have remained an ‘unwritten book’, Melville’s works had a lasting impact on his thinking and writing up to the present. He reveals some of the experiences and emotions concomitant with academic writing that remain more often than not hidden from the reader. Design/methodology/approach: This paper is a personal

  18. Henri Boyer, De l’autre côté du discours. Recherche sur les représentations communautaires

    OpenAIRE

    Gafitescu, Mihaela

    2008-01-01

    Largement répandue en sciences humaines et sociales, la notion de représentation est riche de tous les apports des domaines qui la revendiquent : sociologie, psychologie sociale, philosophie, sciences du langage, sciences de la communication, etc. C’est justement cette disponibilité qui la rend complexe et difficile à décrire en termes mesurables. Henri Boyer ne se contente pourtant pas de décrire et d’ordonner sa transversalité. Il propose des éclairages théoriques et méthodologiques permett...

  19. [Crusading and chronicle writing on the medieval Baltic frontier : a companion to the Chronicle of Henry of Livonia. Hrsg. von Marek Tamm, Linda Kaljundi, Carsten Selch Jensen] / Volker Honemann

    Index Scriptorium Estoniae

    Honemann, Volker, 1943-

    2013-01-01

    Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the Chronicle of Henry of Livonia. Hrsg. von Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Verlag Ashgate. Farnham, 2011

  20. The Former Miss Barstow with every Tom, Dick and Harry in a doll's house

    Directory of Open Access Journals (Sweden)

    Richard Newton

    2015-02-01

    Full Text Available Julie Holledge, panel chairperson and member of the International Ibsen Committee, invited myself along with 3 others to participate in the Inaugural Artists’ Keynote Panel: Applied Ibsen on Four Continents: The Artists’ Intentions. My presentation focused on “The Former Miss Barstow with every Tom, Dick and Harry in a doll’s house.” This was an adaptation of Ibsen’s “A Doll’s House” produced and staged in Los Angeles, California, 1987.  For the XIIIth International Ibsen Conference at the University of Tromsø, Norway, I projected images; a few found on the internet, and many from the production itself, as well as a video clip shown streaming live from YouTube. The article describes the social context of the 80s, analyzes the reinterpretation of Ibsen’s characters, and sets out to explain the symbology of the sets and costumes. I also touch on the differences between this production and Ibsen’s original in four important aspects. These would be the macaroons, the Tarantella, the silk stockings and the end of the play. Finally, I explain my decision to upload this version of “A Doll’s House,’ scene by scene, to my page on YouTube. Having shown films and videos for many years at festivals around the globe, I was looking for a way to step outside that box and reach an international audience just beyond my keyboard. In all of these ways, the goal has been to illuminate the ways in which an artist takes Ibsen’s text and applies it to the specific social context of their time and culture.

  1. Ressenya a Henry Ettinghausen, How the Press Began. The Pre-Periodical Printed News in Early Modern Europe, A Coruña, SIELAE – Facultad de Filología, Universidade da Coruña, 2015,

    Directory of Open Access Journals (Sweden)

    Ricard Expósito i Amagat

    2017-06-01

    Full Text Available Ressenya a Henry Ettinghausen, How the Press Began. The Pre-Periodical Printed News in Early Modern Europe, A Coruña, SIELAE – Facultad de Filología, Universidade da Coruña, 2015, 302 pp., 80 il·ls., ISBN: 978-84-608-3423-6 Review to  Henry Ettinghausen, How the Press Began. The Pre-Periodical Printed News in Early Modern Europe, A Coruña, SIELAE – Facultad de Filología, Universidade da Coruña, 2015, 302 pp., 80 il·ls., ISBN: 978-84-608-3423-6

  2. The Works of Henry Moseley, 1887-1915

    Science.gov (United States)

    Scerri, Eric

    2013-04-01

    In 1913 Henry Moseley, an unknown young English physicist published an article in the Philosophical Magazine under the title of ``The High Frequency Spectra of the Elements.'' The 10-page article was to have far reaching implications in both chemistry and physics and helped to resolve a major conundrum in the periodic table of the elements. The talk will briefly examine the life and work of Moseley who died tragically while fighting in the trenches of World War I in 1915. The build-up to the discovery of atomic number took several different avenues including contributions from Rutherford and Barkla. However the more direct motivation for Moseley's work, as he readily acknowledged, were the articles of an unknown Dutch econometrician Anton Van den Broek who attempted to improve on Mendeleev's periodic table. Moseley began as a student of Rutherford at Manchester and took a keen interest in the development of research using X-rays following the work of Roentgen, von Laue and Bragg. Although Rutherford was at first reluctant to enter this new field he soon yielded to young Moseley's request and sent him to Leeds for brief training with Bragg. On returning to Manchester, Moseley devised an ingenious apparatus in which a set of metal samples could be rotated so as to become the target for a beam of electrons in order to measure the frequencies of the emitted K X-rays. The first set of such experiments used nine successive elements in the periodic table, from titanium to zinc. Moseley's now immense fame rests with the results of this study as well as a subsequent one which extended the study into a further 30 elements, in addition to the use that his method was put to by himself as well as subsequent chemists and physicists.

  3. On the history of cultural psychiatry: Georges Devereux, Henri Ellenberger, and the psychological treatment of Native Americans in the 1950s.

    Science.gov (United States)

    Delille, Emmanuel

    2016-06-01

    Henri Ellenberger (1905-1993) wrote the first French-language synthesis of transcultural psychiatry ("Ethno-psychiatrie") for the French Encyclopédie Médico-Chirurgicale in 1965. His work casts new light on the early development of transcultural psychiatry in relation to scientific communities and networks, particularly on the role of Georges Devereux (1908-1985). The Ellenberger archives offer the possibility of comparing published texts with archival ones to create a more nuanced account of the history of transcultural psychiatry, and notably of the psychological treatment of Native Americans. This paper examines some key moments in the intellectual trajectories of Devereux and Ellenberger, including Devereux's dispute with Ackerknecht, the careers of Devereux and Ellenberger as therapists at the Menninger Foundation (Topeka, Kansas) in the 1950s, and their respective positions in the research network developed by McGill University (Montreal, Quebec) with the newsletter Transcultural Research in Mental Health Problems Finally, I consider their ties to other important figures in this field as it transitioned from colonial medicine to academic medicine, including Roger Bastide (France), Henri Collomb and the Ortigues (France and Africa), as well as Eric Wittkower and Brian Murphy (Canada) and Alexander Leighton (United States and Canada). © The Author(s) 2016.

  4. Review: Henry E. Brady & David Collier (Eds. (2004. Rethinking Social Inquiry: Diverse Tools, Shared Standards

    Directory of Open Access Journals (Sweden)

    Matthias Catón

    2006-03-01

    Full Text Available The book Rethinking Social Inquiry, edited by Henry E. BRADY and David COLLIER, is a response to a book by KING, KEOHANE and VERBA (1994 that aimed to introduce quantitative standards to qualitative research. The authors of the book reviewed here criticize many of the suggestions made there because they argue that qualitative research requires other tools. Nevertheless, they agree that the foundations of research design are similar. The book comprises a comprehensive critique of mainstream quantitative techniques, describes a set of qualitative tools for research, and addresses issues of how to combine qualitative and quantitative approaches to maximize analytical leverage. It is an excellent contribution to the methodological debate in the social sciences. URN: urn:nbn:de:0114-fqs0602309

  5. Dragging effect on the inertial frame and the contribution of matter to the gravitational ''constant'' in a closed cosmological model of the Brans-Dicke theory

    International Nuclear Information System (INIS)

    Miyazaki, A.

    1979-01-01

    The perturbation by a spherical rotating shell is investigated in a closed homogeneous and isotropic cosmological model of the Brans-Dicke theory to first order in an angular velocity of the shell. This model has a negative coupling parameter of the scalar field and satisfies the relation G (t) M/c 2 a (t) = π. The inertial frame at the origin is dragged completely with the same angular velocity when the rotating shell covers the whole universe. By a similar perturbation method, the distance dependence of the contribution from matter to the scalar field at the origin is obtained in this model. The contribution from nearby matter is negative because of the negative coupling constant, but the contribution from the whole universe is positive. The gravitational ''constant'' is almost determined by matter in the distant region

  6. The Right to the City: From Henri Lefebvre to the Analysis about the Contemporary Capitalist City

    Directory of Open Access Journals (Sweden)

    Frank Molano Camargo

    2016-06-01

    Full Text Available The right to the city, defined by Henri Lefebvre in 1967 as the right of urban inhabitants to build, decide and create the city, and make of it a privileged space of anti-capitalist struggle, is again at the center of political debate. Social scientists, social movements, international aid agencies and States take it as a benchmark for policy analysis and to discuss the urban changes in contemporary capitalist cities. This article discusses the assumptions made by Lefebvre in 1967 and the transformation that the concept of right to the city has had from authors such as David Harvey, Edward Soja and Ana Fani Alessandri Carlos.

  7. Henry Currey FRIBA (1820-1900): leading Victorian hospital architect, and early exponent of the "pavilion principle".

    Science.gov (United States)

    Cook, G C

    2002-06-01

    The "pavilion plan" for hospital design originated in France in the 18th century and was popularised in England by John Roberton and George Godwin in the mid-19th century; the underlying rationale was that with improved ventilation the mortality rate (at that time exceedingly high) was significantly reduced. Among the enthusiasts for this new style was Florence Nightingale (herself a miasmatist)--who had experienced astronomically high death rates in the hospital at Scutari during the Crimean War (1854-6). One of the leading exponents of this style of hospital architecture was Henry Currey (1820-1900) whose greatest achievement was undoubtedly the design for the new St Thomas's Hospital on the Lambeth Palace Road.

  8. A pioneer of Australian paediatrics: Dr Henry Edward Brown (1858-1931).

    Science.gov (United States)

    Isles, Alan F; Roper, Peter; Pearn, John H

    2014-11-13

    The emergence of paediatrics as a specialty in Australian medicine dates from the last two decades of the 19th century. Among the pioneers of pre-Federation paediatrics, we include Dr Henry Edward Brown (1858-1931), an Irish-born physician and surgeon who became the first paediatrician to practise in the northern half of the Australian continent. In 1885, he was appointed as the medical superintendent of the Rockhampton Children's Hospital, itself a pioneer institution in the care of sick and injured children. Dr H.E. Brown also served as medical officer of health concurrently in three Queensland shires. He was a leader in the literary and sporting life of the busy port town of Rockhampton and a scholar and significant philanthropist in the domain of French literature. His life was and remains an exemplar of a class of pre-Federation paediatricians who established the ethos of clinical and societal service, which remains as a core feature of the speciality discipline of paediatrics in the 21st century. © 2014 The Authors. Journal of Paediatrics and Child Health © 2014 Paediatrics and Child Health Division (Royal Australasian College of Physicians).

  9. Of benches and Wenches : Subversion de l’espace et topologie de la tyrannie dans I Henry IV

    OpenAIRE

    Lecercle, Ann

    2018-01-01

    Comme l’on sait, le système spatial dominant au Moyen Age et pendant la Renaissance est un système d’isomorphismes à échelle mais non à géométrie variable, que nous connaissons sous les termes de “macrocosme et microcosme”. Dans le contexte de Henry IV, il faut infléchir ce paradigme en fonction de la conception élisabéthaine de l’espace spécifiquement national. Cette conception est exposée, à l’échelle européenne, par Perry Anderson dans son livre Lineages of the Absolutist State : évoquant ...

  10. A contribuição de Henri Lefebvre para reflexão do espaço urbano da Amazônia

    Directory of Open Access Journals (Sweden)

    Charles Benedito Gemaque Souza

    2009-03-01

    Full Text Available L'espace considéré comme historiquement produit par l'homme dans le fait d'organiser tant politique qu'économiquement sa société; c'est l'afirmation qui distingue les oeuvres de Henri Lefebvre. Il s'occupe d'un essai concret de retourner à dialetique de Marx, mais sans le dogmatisme et les oppressions qui sont caractéristique d'autres interprétations de matérialiste. Pourtant, le présent de la réflexion de cet auteur inhérente à l' urbanisation de l'espace amazonique et dans l'attribution avec son espace social présent dans le quotidien de Belém permet l'exercice de la reconnaissance de validité d'une telle pensée avec l’appehension de la complexité de la ville dans l’Amazonie.The space considered as historically produced by man in organizing both political and economical his society; this is the affirmation that distinguishes Henri Lefebvre masterpieces. It deals with a concrete attempt in returning to the Marx dialectic, but without the dogmatism the characteristic oppressions concerning other materialist interpretations. However, the present time of the actor reflection inherent to the Amazon urban space and in assignment with its socio-spatial presented in Belém day-to-day allows the exercise of the validity acknowledgment of such thought along with apprehension of the Amazon city complexity.O espaço considerado como historicamente produzido pelo homem à medida que organiza política e economicamente a sua sociedade, esta é a afirmação que distingue o conjunto das obras de Henri Lefebvre. Trata-se de uma tentativa concreta de retornar à dialética de Marx, contudo sem os dogmatismos e as opressões características de outras interpretações marxistas. Nessa acepção, a atualidade das reflexões do autor em relação à realidade do contexto urbano na Amazônia e, designadamente, com as contradições espaciais presentes no cotidiano de Belém permite um exercício de reconhecimento da validade deste pensamento

  11. Reformation or Revolution? Herman Bavinck and Henri de Lubac on Nature and Grace

    Directory of Open Access Journals (Sweden)

    Parker Gregory W.

    2017-10-01

    Full Text Available Henri de Lubac’s treatment of the relationship between nature and grace will be critiqued by Herman Bavinck’s ‘grace restores nature’ theme. In two significant addresses, Bavinck critiqued a Roman Catholic approach to nature and grace. De Lubac’s influence upon Roman Catholic thinking addressing nature and grace occurred post-Bavinck and has altered Catholic thinking on the subject. Neo-Calvinist scholar, Wolter Huttinga admits that Bavinck and de Lubac offer similar critiques of Roman Catholicism (Huttinga 2014. The question remains then, do Bavinck’s critiques still hold? I propose that Bavinck’s account of grace restores nature still makes valid critiques of a post-Vatican II construction of nature and grace. The paper is broken into three sections: (1 an exploration of de Lubac’s nature and grace theme, (2 the framework of Bavinck’s ‘grace restores nature’ theme, and (3 a Bavinckian critique of de Lubac’s nature and grace theme.

  12. Two-relaxation-time lattice Boltzmann method for the anisotropic dispersive Henry problem

    Science.gov (United States)

    Servan-Camas, Borja; Tsai, Frank T.-C.

    2010-02-01

    This study develops a lattice Boltzmann method (LBM) with a two-relaxation-time collision operator (TRT) to cope with anisotropic heterogeneous hydraulic conductivity and anisotropic velocity-dependent hydrodynamic dispersion in the saltwater intrusion problem. The directional-speed-of-sound technique is further developed to address anisotropic hydraulic conductivity and dispersion tensors. Forcing terms are introduced in the LBM to correct numerical errors that arise during the recovery procedure and to describe the sink/source terms in the flow and transport equations. In order to facilitate the LBM implementation, the forcing terms are combined with the equilibrium distribution functions (EDFs) to create pseudo-EDFs. This study performs linear stability analysis and derives LBM stability domains to solve the anisotropic advection-dispersion equation. The stability domains are used to select the time step at which the lattice Boltzmann method provides stable solutions to the numerical examples. The LBM was implemented for the anisotropic dispersive Henry problem with high ratios of longitudinal to transverse dispersivities, and the results compared well to the solutions in the work of Abarca et al. (2007).

  13. [Charles-Henri Fialon (1846-1933), creator of the Museum of the Faculty of Pharmacy of Paris. His family and professional life].

    Science.gov (United States)

    Flahaut, Jean

    2004-01-01

    Henri Fialon was pharmacist in 1871, and worked in the family apothecary, at Rueil near Paris. At 46 years, he stopped his pharmaceutical activity, and livre quietly, being specially interested by the ancient pharmaceutical pots. He realized a very important collection, which he gave to the French Society of Pharmaceutical History. A museum was installed at the Faculty of Pharmacy of Paris which is presently in the Guillaume Valette Gallery and contains more than 500 pieces.

  14. Anisotropic Bianchi-V dark energy model under the new perspective of accelerated expansion of the universe in Brans-Dicke theory of gravitation

    Science.gov (United States)

    Jaiswal, Rekha; Zia, Rashid

    2018-04-01

    In this paper, we have proposed a cosmological model, which is consistent with the new findings of `The Supernova Cosmology project' headed by Saul Perlmutter, and the `High-Z Supernova Search team', headed by Brian Schimdt. According to these new findings, the universe is undergoing an expansion with an increasing rate, in contrast to the earlier belief that the rate of expansion is constant or the expansion is slowing down. We have considered spatially homogeneous and anisotropic Bianchi-V dark energy model in Brans-Dicke theory of gravitation. We have taken the scale factor a(t)=k t^α e^{β t} , which results into variable deceleration parameter (DP). The graph of DP shows a transition from positive to negative, which shows that universe has passed through the past decelerated expansion to the current accelerated expansion phase. In this context, we have also calculated and plotted various parameters and observed that these are in good agreement with physical and kinematic properties of the universe and are also consistent with recent observations.

  15. A Laboratory Experiment To Measure Henry's Law Constants of Volatile Organic Compounds with a Bubble Column and a Gas Chromatography Flame Ionization Detector (GC-FID)

    Science.gov (United States)

    Lee, Shan-Hu; Mukherjee, Souptik; Brewer, Brittany; Ryan, Raphael; Yu, Huan; Gangoda, Mahinda

    2013-01-01

    An undergraduate laboratory experiment is described to measure Henry's law constants of organic compounds using a bubble column and gas chromatography flame ionization detector (GC-FID). This experiment is designed for upper-division undergraduate laboratory courses and can be implemented in conjunction with physical chemistry, analytical…

  16. « Là est ma Grèce. » Le Quartier de Sagesse d’Henri Bosco Here is my Greece Allí está mi Grecia

    Directory of Open Access Journals (Sweden)

    Michèle Gorenc

    1997-05-01

    Full Text Available En juin 1927, sur la route de Naples à Lourmarin, Henri Bosco séjourne chez son ami, le peintre Pierre Deval, à La Valette-du-Var. Il n’a écrit jusque-là qu’un seul roman et souhaite maintenant trouver un style plus personnel. Sa sensibilité entre en résonance avec le beau domaine d’Orvès, propriété de son hôte. A ce contact s’élabore une écriture que l’écrivain déclinera dans ses romans ultérieurs.In June 1927, as be was travelling from Naples to Lourmarin, Henry Bosco stayed with his friend, Pierre Duval the painter, in La-Valette-du-Var. He had written only one novel so far and was now in search of a more personal style of writing. His sensitivity was struck by the beautiful Orvès property owned by his host. On the basis of this encounter, he started to elaborate a new medium which he was to exploit in his later novels.En junio de 1927, en el camino entre Nápoles y Lourmarin, Henri Bosco se hospeda en casa de su amigo, el pintor Pierre Deval, en La Valette-du-Var. Hasta entonces sólo ha escrito una novela, y desea ahora dar con un estilo más personal. Su sensibilidad se armoniza con la belle finca de Orvès, propiedad de su anfitrión. En ese contado se elabora una escritura que el escritor rechazará en sus novelas posteriores.

  17. Polyphony and counterpoint: Mechanisms of seduction in the diaries of Helen Hessel and Henri Pierre Roché

    Directory of Open Access Journals (Sweden)

    Catherine du Toit

    2015-06-01

    Polifonie en kontrapunt: Meganismes van verleiding in die dagboeke van Helen Hessel en Henri Pierre Roché. Henri Pierre Roché (1879–1959, outeur van Jules et Jim, word beskryf as ‘n sosiale koppelaar, ‘n model-liefhebber van alles en nog wat, ‘n versamelaar van vroue en kuns en een van die mees produktiewe dagboekskrywers en aktiewe minnaars in die opgetekende geskiedenis. Roché het ‘n reeks sketse oor Don Juan gepubliseer en was geboei deur die figuur van die verleier. In sy twintigs beplan hy om sy lewe te wy aan die skepping van ‘n œuvre wat die morele, intellektuele, sosiale en seksuele verhoudings tussen mans en vrouens sou ondersoek. Ter bereiking van hierdie doel, rig hy sy lewe in as laboratorium waarin werklike ondervindinge dien as hoofbron van inligting. Sy dagboek strek oor sestig jaar en is ryk aan verhale van verleiding. Desnieteenstaande bly die mees intense en boeiende intrige van verleiding en verraad steeds sy verhouding met Helen Hessel. Aan die begin van hulle verhouding, stel Roché voor dat sy ook ‘n dagboek hou van hulle hartstogtelike liefde. Helen Hessel se dagboek, geskryf in Frans, Duits en Engels, reflekteer die drama van verleiding en funksioneer op verskillende vlakke: realisties, visionêr, ten volle geabsorbeer in haar eie gedagtes en emosies en tóg krities jeens haarself en ander. ‘n Vergelyking van die twee dagboeke skep ‘n fassinerende, digte tekstuur wat die binnewerkings blootlê van verleiding in aksie. Die kontrapunt geskep deur hierdie twee interafhanklike stemme word nóg meer kompleks namate ‘n mens bewus word van die intertekstuele verwysings wat bydra tot die ontluikende polifonie van geskrewe liefde en lewe.

  18. 圣徒与国王之间——《亨利六世》的宗教伦理%Between Saint and King: The Religious Ethics in Henry VI

    Institute of Scientific and Technical Information of China (English)

    邹广胜; 穆宝清

    2012-01-01

    上、中、下三部的《亨利六世》是莎士比亚戏剧中最长的,也是最优秀的剧作之一,然而这部剧作却常常被莎学家们忽略,特别是亨利六世这位被描写成以宗教原则来处理政事的国王也同样受到误解。但《亨利六世》对历史深邃的理解、对民族强烈的热爱、对人性深刻的洞察,特别是以宗教伦理原则对王位的反思更是让今日的读者产生无限的沉思与遐想。%Henry VI, a history play by William Shakespeare which firmly establishes his reputa- tion as a playwright, is often neglected by modern critics. Henry VI as the king who governs the realm of England not by law but by religious ethics is also misinterpreted by some Shakespeareans. However, with the profound understanding of history, the devotion to the coun- try, the insight into humanity, and especially the untimely King Henry VI' s reflections on his reign, this history play provides present-day readers with unlimited contemplation and imagina- tion.

  19. Le Visage de la Victoire di Henry De Groux: la riscoperta di un’opera antimilitarista del tempo della Prima guerra mondiale

    Directory of Open Access Journals (Sweden)

    Carol Morganti

    2014-03-01

    Full Text Available Il presente intervento è dedicato a un’importante raccolta di incisioni, oggi riscoperta: Le Visage de la Victoire, eseguita dall’artista belga Henry De Groux. Costituita da oltre 40 incisioni (acqueforti e vernici molli, è stata realizzata nel corso della Prima Guerra Mondiale al fine di denunciare l’inutile massacro in corso. Si tratta di opere di ispirazione visionaria, che rivelano significati universali, mettendo il maestro belga in rapporto di affinità con artisti quali Goya e Otto Dix.

  20. William Henry Bragg, man and scientist, Nobel Laureate and First Professor of Physics, University of Adelaide 1886-1909.

    Science.gov (United States)

    Patterson, John; George, Robert

    2018-03-01

    In London, November 1915, a telegram was received at the home of William Henry Bragg from the secretary of the Academy of Science in Stockholm announcing the award of the Nobel Prize in Physics for "the analysis of crystal structures by means of X-rays". A second similar telegram was addressed to his 25 year old son William Lawrence Bragg (Jenkin, 2008). This article commemorates the centenary of that event and the unveiling of a bust of Sir William Bragg alongside that of his son, Sir Lawrence Bragg, on North Terrace in Adelaide where he spent 23 years of his early career. Copyright © 2018. Published by Elsevier Ltd.

  1. Parallel editing, multi-positionality and maximalism – cosmopolitan effects as explored in some art works by Melanie Jackson and Vivienne Dick

    Directory of Open Access Journals (Sweden)

    Rachel Garfield

    2013-08-01

    Full Text Available Garfield produces a critique of minimalist art practice by demonstrating how the artist Melanie Jackson’s Some things you are not allowed to send around the world (2003 and 2006 and the experimental film-maker Vivienne Dick’s Liberty’s booty (1980 – neither of which can be said to be about feeling ‘at home’ in the world, be it as a resident or as a nomad – examine global humanity through multi-positionality, excess and contingency, and thereby begin to articulate a new cosmopolitan relationship with the local – or, rather, with many different localities – in one and the same maximalist sweep of the work. ‘Maximalism’ in Garfield’s coinage signifies an excessive overloading (through editing, collage, and the sheer density of the range of the material that enables the viewer to insert themselves into the narrative of the work. In the art of both Jackson and Dick Garfield detects a refusal to know or to judge the world; instead, there is an attempt to incorporate the complexities of its full range into the singular vision of the work, challenging the viewer to identify what is at stake.

  2. Seeing Water in Early Twentieth-Century Mexico City: Henry Wellge's Perspective Plan of the City and Valley of Mexico, D.F. 1906

    OpenAIRE

    Widdifield, Stacie G.; Banister, Jeffrey M.

    2015-01-01

    We examine Henry Wellge's 1906 chromolithograph, Perspective Plan of the City and Valley of Mexico, D.F., a panoramic view that organizes the capital and its lacustrine environs through close up and distant perspectives. The Plan depicts a landscape integrated by canals, rivers, and lakes, recording a pivotal moment before modern hydraulic infrastructure would remove surface water from view. We thus interrogate this image as a visual register of hydraulic-control ideals in vogue around 1900, ...

  3. Human radiation studies: Remembering the early years: Oral history of radiologist Henry I. Kohn, M.D., Ph.D., conducted September 13, 1994

    International Nuclear Information System (INIS)

    1995-06-01

    This report is a transcript of an interview of Dr. Henry I. Kohn by representatives of the US DOE Office of Human Radiation Experiments. Dr. Kohn was selected for this interview because of the positions he held at Oak Ridge National Laboratory, University of California at San Francisco, and Harvard Medical School. Dr. Kohn discussed his remembrances of his experiences in blood chemistry of animals and patients exposed to radiation, and his remembrances of several radiobiologists

  4. Œdipe ou le crépuscule des dieux d’Henri Ghéon à la lumière du Dieu (inconnu de saint Paul

    Directory of Open Access Journals (Sweden)

    James Dauphiné

    2012-12-01

    Full Text Available Henri Ghéon a composé un Œdipe chrétien renvoyant largement à la Bible et particulièrement aux œuvres de saint Paul. La découverte du dieu inconnu, dieu d’amour, par Œdipe s’accompagne d’une mise en scène christique – et astrologique – de son destin.

  5. New Hypersonic Shock Tunnel at the Laboratory of Aerothermodynamics and Hypersonics Prof. Henry T. Nagamatsu

    International Nuclear Information System (INIS)

    Toro, P. G. P.; Minucci, M. A. S.; Chanes, J. B. Jr; Oliveira, A. C.; Gomes, F. A. A.; Myrabo, L. N.; Nagamatsu, Henry T.

    2008-01-01

    The new 0.60-m. nozzle exit diameter hypersonic shock tunnel was designed to study advanced air-breathing propulsion system such as supersonic combustion and/or laser technologies. In addition, it may be used for hypersonic flow studies and investigations of the electromagnetic (laser) energy addition for flow control. This new hypersonic shock tunnel was designed and installed at the Laboratory for of Aerothermodynamics and Hypersonics Prof. Henry T. Nagamatsu, IEAv-CTA, Brazil. The design of the tunnel enables relatively long test times, 2-10 milliseconds, suitable for the experiments performed at the laboratory. Free stream Mach numbers ranging from 6 to 25 can be produced and stagnation pressures and temperatures up to 360 atm. and up to 9,000 K, respectively, can be generated. Shadowgraph and schlieren optical techniques will be used for flow visualization

  6. Henry S. Turner, The English Renaissance Stage. Geometry, Poetics, and the Practical Spatial Arts 1580-1630 - Tim Fitzpatrick, Playwright, Space and Place in Early Modern Performance

    Directory of Open Access Journals (Sweden)

    Luigi Giuliani

    2013-05-01

    Full Text Available Review of Henry S. Turner, The English Renaissance Stage. Geometry, Poetics, and the Practical Spatial Arts 1580-1630, Oxford University Press, Oxford, 2006, reimpr. 2010, 326 pp. ISBN: 978-0-19-959545-7 y Tim Fitzpatrick, Playwright, Space and Place in Early Modern Performance, Ashgate, Franham, 2011, 314 pp. ISBN: 978-1-4094-2827-5.

  7. Henri Bergson y George Bernard Shaw: hábito, vida, muerte

    Directory of Open Access Journals (Sweden)

    Álvaro Cortina Urdampilleta

    2015-01-01

    Full Text Available Este artículo indaga en algunos aspectos de la antropología filosófica expuesta en la obra del francés Henri Bergson. Para ello, nos serviremos de la confrontación de su doctrina original con la de un bergsoniano sui generis, el intelectual y dramaturgo irlandés George Bernard Shaw. El Prefacio. A medio siglo infiel, de Shaw, incluido en su obra más ambiciosa, Vuelta a Matusalén. Un Pentateuco Metabiológico, de 1921, será el texto base con el que haremos dialogar a Bergson con este periférico bergsonismo. Tomaremos como hilo conductor la teoría sobre el hábito, en el contexto de la metafísica de la evolución de los seres orgánicos, y lo llevaremos hasta el concepto límite, que parece conciliar ambas posturas: la idea de muerte superable. Ni en Bergson ni en Shaw los hábitos (la Cultura forman parte integral de la esencia del hombre, y la muerte (cuestión en la que Bergson es mucho más elusivo juega en ellos un rol anfibio, entre Cultura y Naturaleza.

  8. Government science in postwar America: Henry A. Wallace, Edward U. Condon, and the transformation of the National Bureau of Standards, 1945-1951.

    Science.gov (United States)

    Lassman, Thomas C

    2005-03-01

    In the fall of 1945, Secretary of Commerce Henry Wallace handpicked Edward Condon, a respected theoretical physicist, to become director of the National Bureau of Standards. Already regarded by many academic and industrial scientists as a second-rate research institution, the Bureau had deteriorated further during the Great Depression. An ardent New Dealer who favored government action to prevent anticompetitive behavior in the marketplace, Wallace claimed that giant corporations leveraged their extensive patent holdings and research capabilities to manipulate markets and restrict competition at the expense of smaller firms without similar resources. Through a revitalized Bureau of Standards, Wallace intended to mitigate monopolistic behavior among large companies by transforming the Department of Commerce into an effective clearinghouse for scientific research that would stimulate technological innovation in small businesses. The Bureau's postwar expansion, however, foundered on congressional efforts to dismantle the legacies of the New Deal, Condon's lack of commitment to the technical requirements of the small business community, and the intense competition for resources within an institutionally pluralist federal research establishment dominated by the exigencies of the Cold War. Without sufficient financial support from congressional appropriations committees, Condon turned to the military to fund new research programs at the Bureau of Standards. These programs, however, owed their institutional growth to the demands of the national security state, not to the fading influence of Henry Wallace's New Deal liberalism.

  9. Henry Moore’s Public Sculpture in the US: The Collaborations with I. M. Pei

    Directory of Open Access Journals (Sweden)

    Alex Potts

    2016-07-01

    Full Text Available The many commissions Henry Moore received for public sculpture in the United States provided the occasion for several quite distinctive works. While not site specific, these were unique, and their final form, scale, and disposition was elaborated with a particular setting in mind. This aspect of Moore’s work in the US, which began with the monumental piece he designed for the Lincoln Center in New York in 1963–65, is examined here by focusing on the productive relationship he forged with the architect I. M. Pei in the 1970s. The sculptures Moore produced in collaboration with Pei respond in suggestive ways to the spatial environments created in American cities by late modern architectural developments. They also realize an oddly effective combination of the biomorphic and abstract that differs both from the bodily conception of Moore’s earlier work and the non-figurative character of much public sculpture of the time.

  10. Henry Fayol’s 14 Principles of Management: Implications for Libraries and Information Centres

    Directory of Open Access Journals (Sweden)

    Uzuegbu, C. P.

    2015-06-01

    Full Text Available This paper focuses generally on the ‘fourteen principles of management’ by Henri Fayol. However, it specifically analyses their application to and implications for libraries and information centres. An extensive review of published works on management generally, and library management in particular, was conducted. This yielded vital insights on the original meaning and later modifications of these principles, as well as their application in the management of various organisations. Consequently, the strengths and weaknesses of these principles were examined to determine their suitability in libraries and information centres. Inferences, illustrations, and examples were drawn from both developed and developing countries which gives the paper a global perspective. Based on available literature, it was concluded that Fayol’s principles of management are as relevant to libraries as they are in other organisations. The paper, therefore, recommends that in addition to modifying some aspects to make these principles more responsive to the peculiar needs of libraries, further research should be undertaken to expand the breadth of these principles and ascertain their impacts on the management of information organisations.

  11. Determination of Henry's constant, the dissociation constant, and the buffer capacity of the bicarbonate system in ruminal fluid.

    Science.gov (United States)

    Hille, Katharina T; Hetz, Stefan K; Rosendahl, Julia; Braun, Hannah-Sophie; Pieper, Robert; Stumpff, Friederike

    2016-01-01

    Despite the clinical importance of ruminal acidosis, ruminal buffering continues to be poorly understood. In particular, the constants for the dissociation of H2CO3 and the solubility of CO2 (Henry's constant) have never been stringently determined for ruminal fluid. The pH was measured in parallel directly in the rumen and the reticulum in vivo, and in samples obtained via aspiration from 10 fistulated cows on hay- or concentrate-based diets. The equilibrium constants of the bicarbonate system were measured at 38°C both using the Astrup technique and a newly developed method with titration at 2 levels of partial pressure of CO2 (pCO2; 4.75 and 94.98 kPa), yielding mean values of 0.234 ± 0.005 mmol ∙ L(-1) ∙ kPa(-1) and 6.11 ± 0.02 for Henry's constant and the dissociation constant, respectively (n/n = 31/10). Both reticular pH and the pH of samples measured after removal were more alkalic than those measured in vivo in the rumen (by ΔpH = 0.87 ± 0.04 and 0.26 ± 0.04). The amount of acid or base required to shift the pH of ruminal samples to 6.4 or 5.8 (base excess) differed between the 2 feeding groups. Experimental results are compared with the mathematical predictions of an open 2-buffer Henderson-Hasselbalch equilibrium model. Because pCO2 has pronounced effects on ruminal pH and can decrease rapidly in samples removed from the rumen, introduction of a generally accepted protocol for determining the acid-base status of ruminal fluid with standard levels of pCO2 and measurement of base excess in addition to pH should be considered. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  12. O BOM FILHO À CASA TORNA: FORMAÇÃO HUMANISTA EUROPEIA E SENTIMENTO PÁTRIO EM JOAQUIM NABUCO E HENRY JAMES

    OpenAIRE

    Mello, Luiza Larangeira da Silva

    2013-01-01

    Resumo Este artigo propõe uma análise comparativa entre textos de caráter autobiográfico do intelectual e político brasileiro Joaquim Nabuco e do escritor norte-americano Henry James, nos quais eles modelam suas subjetividades e confrontam-se com alguns dos problemas que mobilizaram boa parte dos intelectuais, na virada do século XIX para o XX. Tanto Minha formação (1900), de Nabuco, quanto The American scene (1907), de James, representam o sentimento a que Evaldo Cabral de Mello chama "o dil...

  13. AR42J-B-13 cell: An expandable progenitor to generate an unlimited supply of functional hepatocytes

    International Nuclear Information System (INIS)

    Wallace, Karen; Fairhall, Emma A.; Charlton, Keith A.; Wright, Matthew C.

    2010-01-01

    Hepatocytes are the preparation of choice for Toxicological research in vitro. However, despite the fact that hepatocytes proliferate in vivo during liver regeneration, they are resistant to proliferation in vitro, do not tolerate sub-culture and tend to enter a de-differentiation program that results in a loss of hepatic function. These limitations have resulted in the search for expandable rodent and human cells capable of being directed to differentiate into functional hepatocytes. Research with stem cells suggests that it may be possible to provide the research community with hepatocytes in vitro although to date, significant challenges remain, notably generating a sufficiently pure population of hepatocytes with a quantitative functionality comparable with hepatocytes. This paper reviews work with the AR42J-B-13 (B-13) cell line. The B-13 cell was cloned from the rodent AR42J pancreatic cell line, express genes associated with pancreatic acinar cells and readily proliferates in simple culture media. When exposed to glucocorticoid, 75-85% of the cells trans-differentiate into hepatocyte-like (B-13/H) cells functioning at a level quantitatively similar to freshly isolated rat hepatocytes (with the remaining cells retaining the B-13 phenotype). Trans-differentiation of pancreatic acinar cells also appears to occur in vivo in rats treated with glucocorticoid; in mice with elevated circulating glucocorticoid and in humans treated for long periods with glucocorticoid. The B-13 response to glucocorticoid therefore appears to be related to a real pathophysiological response of a pancreatic cell to glucocorticoid. An understanding of how this process occurs and if it can be generated or engineered in human cells would result in a cell line with the ability to generate an unlimited supply of functional human hepatocytes in a cost effective manner.

  14. A Guide to the Data Resources of the Henry A. Murray Research Center of Radcliffe College: A Center for the Study of Lives [and] Index to [the] Guide.

    Science.gov (United States)

    Radcliffe Coll., Cambridge, MA. Henry A. Murray Research Center.

    The first of two volumes provides information about data resources available at the Henry A. Murray Research Center of Radcliffe College, a multidisciplinary research center that is a national repository for social and behavioral science data on human development and social change; topics of special concern to women are collection priorities. The…

  15. Dreamers in dialogue: evolution, sex and gender in the utopian visions of William Morris and William Henry Hudson

    Directory of Open Access Journals (Sweden)

    Caterina Novák

    2013-12-01

    Full Text Available The aim of this article is to explore the parallels between two late-nineteenth-century utopias,William Henry Hudsons A Crystal Age (1882 and William Morriss News from Nowhere (1891. Itaims to explore how these two works respond to the transition from a kinetic to a static conception ofutopia that under pressure from evolutionary and feminist discourses took place during the period.Particular focus lies on the way in which this is negotiated through the depiction of evolution, sexuality,and gender roles in the respective novels, and how the depiction of these disruptive elements may workas a means of ensuring the readers active engagement in political, intellectual and emotional terms.

  16. Henri FAYOL, 100 ans et pas une ride L’apport de l’œuvre de Fayol dans le monde moderne

    OpenAIRE

    Brodhag, Christian

    2016-01-01

    International audience; Demain se tiendra à l'Ecole un colloque scientifique sur Henri FAYOL, il permettra à des chercheurs d'horizons variés de porter des regards croisés sur l'oeuvre de notre glorieux ancien. Certains sont déjà présents ce soir, et je les salue. En posant la question de la pertinence de l'actualité de l'oeuvre de FAYOL, je ne me départirai pas de la rigueur qui sied au scientifique, mais je ne m'accorderai une licence plus politique. En effet cette dimension de l'oeuvre de ...

  17. Biobleaching of wheat straw-rich soda pulp with alkalophilic laccase from gamma-proteobacterium JB: optimization of process parameters using response surface methodology.

    Science.gov (United States)

    Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince

    2008-11-01

    An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.

  18. Putting Media Literacy Education in Perspective of Theory of "Participatory Culture" : The case of Henry Jenkins (2009) Confronting the Challenges of Participatory Culture

    OpenAIRE

    Sunagawa, Seiji

    2010-01-01

    In this report, I took a viewpoint of the "participatory culture" of Henry Jenkins (2009) into account and argued what the literacy of the digital media. I clarified what kind of culture "participatory culture" is and what one participated with how. The support system between peers in the "participatory culture", have the community which can feel relieved where the system letting each other take an equal viewpoint. I made clear that it was a problem of the media literacy education how to buil...

  19. “It’s Always the Same, and It’s Always Different” Mythologisation and the Serial Killer in Henry: Portrait of a Serial Killer.

    OpenAIRE

    Smyth, David A.

    2015-01-01

    Serial killers are important in American horror because of their ability to exist between ‘myth’ and ‘reality’. The serial killer is one of the most important American myths, but it is one firmly rooted in real life: unlike Paul Bunyan or Superman, serial killers do exist. This essay examines the relationship between the ‘myth’ and the ‘reality’ of serial killers, and the complex relationship between the American public and the serial killer, using Henry: Portrait of a Serial K...

  20. Le cavalier du Pont-Neuf : histoire, restauration et secrets de la statue équestre de Henri IV

    Directory of Open Access Journals (Sweden)

    Pascal Liévaux

    2012-04-01

    Full Text Available Figure 1État des surfaces de la statue après la restaurationPhot. C. Usaï, 2004Henri IV, roi aimé des français entre tous, est cette année célébré à l’occasion du quatrième centenaire de son assassinat. Aussi la revue In Situ a-t-elle souhaité marquer l’anniversaire de cet événement majeur de l’histoire de France en mettant à la disposition du public les résultats inédits de travaux réalisés à l’occasion de la restauration du monument le plus emblématique du mémorial henricien : la statue équ...

  1. The Usage of E-Learning Model To Optimize Learning System In Higher Education by Using Dick and Carey Design Approach

    Directory of Open Access Journals (Sweden)

    Anak Agung Gde Satia Utama

    2016-04-01

    Full Text Available Nowadays many universities in the world apply technology enhanced learning in order to help learning activities. Due to the potentials technology enhanced learning offers, recent education using it and universities in particular are trying to apply it. One of the subjects of this research is The Accounting Department of Airlangga University in Surabaya. The idea of this research is to investigate the students about how they know deeply about e-learning system and learning objectives as a first step to conduct e-learning model. After the model completed, the next step is to prepare database learning. Entity Relationship Diagram (ERD can help to explain the model. The purpose of this research was done by using Dick and Carey Design Model. There are nine steps to conduct e-learning model. All steps can be categorized into three steps research: first is the introduction or empirical study, the next step is the design and the last is the feedback after the implementation. The methodology used in this research is using Qualitative Exploratory, by using questionnaire and interviews as data collection techniques. The analysis of the data shows organization requires information about e-learning content, user as a learning subject and information technology infrastructures. E-learning model as one of the alternative learning can help users to optimized learning.

  2. El urbanismo contra lo urbano. La ciudad y la vida urbana en Henri Lefebvre

    Directory of Open Access Journals (Sweden)

    Manuel Delgado Ruiz

    2018-01-01

    Full Text Available Henri Lefebvre coloca en el eje de su teoría sobre la vida urbana la oposición entre el espacio vivido por quienes lo usan o sueñan y el espacio abstracto que creen organizar los tecnócratas de la ciudad, que raramente reconocen hasta qué punto su “creatividad” está sometida a intereses privados o institucionales. Tras ese espacio hipotético sobre el que urbanistas y arquitectos trabajan no hay otra cosa que mera ideología, es decir, fantasma que recubre y disfraza las relaciones sociales reales de producción. Frente -o de espaldas- a ese orden espacial meramente teórico de los “especialistas”, lo que las ciudades conocen es la actividad constante o inminente de lo urbano, entendido como apoteosis y exacerbación de lo social, dinamismo siempre activado de acontecimientos y quehaceres sobre el que los “expertos” aplican planes y proyectos, pero del que no saben en realidad nada, acaso por lo cual pugnan por anularlo.

  3. MgAl-Layered Double Hydroxide Solid Base Catalysts for Henry Reaction: A Green Protocol

    Directory of Open Access Journals (Sweden)

    Magda H. Abdellattif

    2018-03-01

    Full Text Available A series of MgAl-layered double hydroxide (MgAl-HT, the calcined form at 500 °C (MgAlOx, and the rehydrated one at 25 °C (MgAl-HT-RH were synthesized. Physicochemical properties of the catalysts were characterized by X-ray diffraction (XRD and scanning electron microscopy (SEM. Surface area of the as-synthesized, calcined, and rehydrated catalysts was determined by N2 physisorption at −196 °C. CO2 temperature-programmed desorption (CO2-TPD was applied to determine the basic sites of catalysts. The catalytic test reaction was carried out using benzaldehyde and their derivatives with nitromethane and their derivatives. The Henry products (1–15 were obtained in a very good yield using MgAl-HT-RH catalyst either by conventional method at 90 °C in liquid phase or under microwave irradiation method. The mesoporous structure and basic nature of the rehydrated solid catalyst were responsible for its superior catalytic efficiency. The robust nature was determined by using the same catalyst five times, where the product % yield was almost unchanged significantly.

  4. Derivation of the MMPI-2-RF Henry-Heilbronner Index-r (HHI-r) scale.

    Science.gov (United States)

    Henry, George K; Heilbronner, Robert L; Algina, James; Kaya, Yasemin

    2013-01-01

    The 15-item Henry-Heilbronner Index (HHI) was published in 2006 as an MMPI-2 embedded measure of psychological response validity. When the MMPI-2 was revised in 2008 only 11 of the 15 original HHI items were retained on the MMPI-2-RF, prohibiting use of the HHI as an embedded validity indicator on the MMPI-2-RF. Using the original HHI sample an 11-item version of the HHI, the HHI-r, was evaluated for use as an embedded measure of psychological response validity for the MMPI-2-RF. The 11-item HHI-r was very similar to the HHI in classification accuracy. An HHI-r cutoff score of ≥7 was associated with a classification accuracy rate of 84.0%, good sensitivity (68.9%), and high specificity (93.2%) in identifying symptom exaggeration in personal injury and disability litigants versus non-litigating head-injured patients. These preliminary results suggest the HHI-r functions in a manner similar to the original HHI as a measure of psychological response validity, and may be used by psychologists and neuropsychologists as an MMPI-2-RF embedded validity indicator.

  5. La France au Tsar : chanson patriotique créée par Marius Richard à la Scala, Henri Helme à Ba-ta-clan [illustration couleurs Donjean

    OpenAIRE

    François Bigot Éditeur , .; Daphy , Éliane

    2010-01-01

    La France au Tsar : chanson patriotique créée par Marius Richard à la Scala, Henri Helme à Ba-ta-clan ; paroles de Lucien Colonge, Musique de J. Claudel. [Illustration couleurs signée] Donjean. A la chanson populaire, Maison Bigot éditeur (sans cotage, sans ©, datation recherche en cours). Titre inconnu du catalogue BNF. Datation provisoire par année de dépôt médihal (2010)

  6. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2011-09-01

    Full Text Available Jan J. Boersema, Beelden van Paaseiland: Over de duurzaamheid van een cultuur (H.J.M. Claessen Henri Chambert-Loir (ed., Sadur: Sejarah terjemahan di Indonesia dan Malaysia (E.P. Wieringa Andrée Feillard and Rémy Madinier, The end of innocence? Indonesian Islam and the temptations of radicalism (Andy Fuller Andrew Goss, The floracrats: State-sponsored science and the failure of Enlightenment in Indonesia (Andreas Weber Rachel V. Harrison and Peter A. Jackson (eds, The ambiguous allure of the West: Traces of the colonial in Thailand (Luuk Knippenberg Brigitta Hauser-Schäublin and I Wayan Ardika (eds, Burials, texts and rituals: Ethnoarchaeological investigations in North Bali, Indonesia (Thomas Reuter Carolyn Hughes, Dependent communities: Aid and politics in Cambodia and East Timor (Helene Van Klinken J.A. de Moor, Generaal Spoor: Triomf en tragiek van een legercommandant (Harry A. Poeze Peter J. Rimmer and Howard Dick, The city in Southeast Asia: Patterns, processes and policy (Sheri Lynn Gibbings Knut M. Rio and Olaf H. Smedal (eds, Hierarchy: Persistence and transformation in social formations (Toon van Meijl Henry Spiller, Erotic triangles: Sundanese dance and masculinity in West Java (Paul H. Mason Rupert Stasch, Society of others: Kinship and mourning in a West Papuan place (Anton Ploeg Susanto Zuhdi, Sejarah Buton yang terabaikan: Labu rope labu wana (Muhammad Fuad Terutomo Ozawa, The rise of Asia: The ‘flying geese’ theory of tandem growth and regional agglomeration (Mark Beeson Uka Tjandrasasmita, Arkeologi Islam Nusantara (Hélène Njoto

  7. Temperature profile and water depth data collected from USS HENRY B. WILSON using BT and XBT casts in the Indian Ocean and other seas from 22 October 1986 to 26 November 1986 (NODC Accession 8800183)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile and water depth data were collected using BT and XBT casts from the USS HENRY B. WILSON in the Indian Ocean, Gulf of Oman, Gulf of Iran, and...

  8. Charged black holes in string-inspired gravity II. Mass inflation and dependence on parameters and potentials

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Jakob [KISTI,Daejeon 305-806 (Korea, Republic of); Yeom, Dong-han [Leung Center for Cosmology and Particle Astrophysics, National Taiwan University,Taipei 10617, Taiwan (China)

    2015-09-07

    We investigate the relation between the existence of mass inflation and model parameters of string-inspired gravity models. In order to cover various models, we investigate a Brans-Dicke theory that is coupled to a U(1) gauge field. By tuning a model parameter that decides the coupling between the Brans-Dicke field and the electromagnetic field, we can make both of models such that the Brans-Dicke field is biased toward strong or weak coupling directions after gravitational collapses. We observe that as long as the Brans-Dicke field is biased toward any (strong or weak) directions, there is no Cauchy horizon and no mass inflation. Therefore, we conclude that to induce a Cauchy horizon and mass inflation inside a charged black hole, either there is no bias of the Brans-Dicke field as well as no Brans-Dicke hair outside the horizon or such a biased Brans-Dicke field should be well trapped and controlled by a potential.

  9. 'A Speculative Idea': The Parallel Trajectories of Financial Speculation, Obstetrical Science, and Fiscal Management of Female Bodies in Henry James's Washington Square.

    Science.gov (United States)

    Nixon, Kari

    2017-09-01

    This essay teases out the intimate connections between the scientific and fiscal realms in the context of American germ theory and obstetrics. By uncovering the economic and medical contexts of Henry James's Washington Square-set during the infancy of germ theory and the heyday of American obstetrics-this essay exposes a previously unexplored subtextual history of contagion in the text. Although this scientific history seems relegated to the novel's margins, understanding the changing scientific cosmologies and professional organizations in the context of the novel's setting and composition reveals that these tiny infectious particles and their vectors fundamentally shape the plot of the novel.

  10. Promoting good health in the age of reform: the medical publications of Henry H. Porter of Philadelphia, 1829-32.

    Science.gov (United States)

    Horrocks, T A

    1995-01-01

    In the early 1830s, the Philadelphia publisher Henry H. Porter rapidly published five journals, six books, and an almanac, works having a particular emphasis on health and personal hygiene. Porter's health publications linked the traditional message about the importance of personal hygiene to health to the messages conveyed by the flourishing American reform movements at the time, and his Journal of Health was among the first American medically oriented periodicals published for the layperson. Yet Porter did not survive in the intensely competitive and financially unstable book trade. This study examines Porter's health publications, attempting to explain why he chose to publish what he did, the message(s) his works contained, the audience(s) he tried to reach, and the failure of his business.

  11. Generation of sub-part-per-billion gaseous volatile organic compounds at ambient temperature by headspace diffusion of aqueous standards through decoupling between ideal and nonideal Henry's law behavior.

    Science.gov (United States)

    Kim, Yong-Hyun; Kim, Ki-Hyun

    2013-05-21

    In the analysis of volatile organic compounds in air, the preparation of their gaseous standards at low (sub-ppb) concentration levels with high reliability is quite difficult. In this study, a simple dynamic headspace-based approach was evaluated as a means of generating vapor-phase volatile organic compounds from a liquid standard in an impinger at ambient temperature (25 °C). For a given sampling time, volatile organic compound vapor formed in the headspace was swept by bypassing the sweep gas through the impinger and collected four times in quick succession in separate sorbent tubes. In each experiment, a fresh liquid sample was used for each of the four sampling times (5, 10, 20, and 30 min) at a steady flow rate of 50 mL min(-1). The air-water partitioning at the most dynamic (earliest) sweeping stage was established initially in accord with ideal Henry's law, which was then followed by considerably reduced partitioning in a steady-state equilibrium (non-ideal Henry's law). The concentrations of gaseous volatile organic compounds, collected after the steady-state equilibrium, reached fairly constant values: for instance, the mole fraction of toluene measured at a sweeping interval of 10 and 30 min averaged 1.10 and 0.99 nmol mol(-1), respectively (after the initial 10 min sampling). In the second stage of our experiment, the effect of increasing the concentrations of liquid spiking standard was also examined by collecting sweep gas samples from two consecutive 10 min runs. The volatile organic compounds, collected in the first and second 10 min sweep gas samples, exhibited ideal and nonideal Henry's law behavior, respectively. From this observation, we established numerical relationships to predict the mole fraction (or mixing ratio) of each volatile organic compound in steady-state equilibrium in relation to the concentration of standard spiked into the system. This experimental approach can thus be used to produce sub-ppb levels of gaseous volatile organic

  12. Henry's law constants and infinite dilution activity coefficients of cis-2-butene, dimethylether, chloroethane, and 1,1-difluoroethane in methanol, 1-propanol, 2-propanol, 1-butanol, 2-butanol, isobutanol, tert-butanol, 1-pentanol, 2-pentanol, 3-pentanol, 2-methyl-1-butanol, 3-methyl-1-butanol, and 2-methyl-2-butanol

    International Nuclear Information System (INIS)

    Miyano, Yoshimori; Kobashi, Takahiro; Shinjo, Hiroshi; Kumada, Shinya; Watanabe, Yusuke; Niya, Wataru; Tateishi, Yoko

    2006-01-01

    Henry's law constants and infinite dilution activity coefficients of cis-2-butene, dimethylether, chloroethane, and 1,1-difluoroethane in methanol, 1-propanol, 2-propanol, 1-butanol, 2-butanol, isobutanol, tert-butanol, 1-pentanol, 2-pentanol, 3-pentanol, 2-methyl-1-butanol, 3-methyl-1-butanol, and 2-methyl-2-butanol in the temperature range of 250 K to 330 K were measured by a gas stripping method and partial molar excess enthalpies were calculated from the activity coefficients. A rigorous formula for evaluating the Henry's law constants from the gas stripping measurements was used for the data reduction of these highly volatile mixtures. The uncertainty is about 2% for the Henry's law constants and 3% for the estimated infinite dilution activity coefficients. In the evaluation of the infinite dilution activity coefficients, the nonideality of the solute such as the fugacity coefficient and Poynting correction factor cannot be neglected, especially at higher temperatures. The estimated uncertainty of the infinite dilution activity coefficients includes 1% for nonideality

  13. Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium

    International Nuclear Information System (INIS)

    Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.

    1984-01-01

    The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal

  14. [Henri-Léonard Bertin and the development of agriculture in the Age of Enlightenment].

    Science.gov (United States)

    Pédro, Georges

    2012-05-01

    This meeting of the Committee on the History of Science and Epistemology takes place as we celebrate the 250th anniversary of the creation of the world's first veterinary schools, a major event among all those that, in the wake of the Physiocrat movement initiated by Quesnay and DuPont de Nemours, shaped the modernisation of agriculture in France during the 18th century. Henri-Léonard Bertin (1720-1792) was the impetus to the restructuring process. He was well aware that farming should not remain an activity that solely provides a livelihood for the population, but that it needed to be modernised, i.e. it should produce more, and better. His view was that agriculture could become a great source of riches for France and therefore, a true economic and even political force. He used the various official positions he occupied during that period (Intendant of Lyon (1754-1757), Controller General of Finances (1759-1763), Minister-Secretary of State for Agriculture (1763-1780) to initiate a number of reforms that brought about the modernisation of the kingdom's agricultural world. Copyright © 2012 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  15. NRDA-processed CTD data from NOAA Ship HENRY B. BIGELOW in the Gulf of Mexico, Cruise 2 Leg 1, collected from 2010-08-14 to 2010-08-20, associated with the Deepwater Horizon Oil Spill event (NCEI Accession 0128115)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conductivity Temperature and Depth (CTD) measurements were collected aboard the R/V Henry Bigelow to determine physical oceanographic parameters of the water column,...

  16. The Paradox of a Gesture, Enlarged by the Distension of Time: Merleau-Ponty and Lacan on a Slow-Motion Picture of Henri Matisse Painting

    OpenAIRE

    Astrid Deuber-Mankowsky

    2017-01-01

    In his lecture series The Four Fundamental Concepts of Psychoanalysis (1964), Lacan refers to a “delightful example” that Merleau-Ponty gives in his Book Signes (1960). Lacan describes it as a “strange slow-motion film in which one sees Matisse painting.” This is a scene from the documentary entitled A Great French Painter, Henri Matisse, by director François Campaux, a 16mm black and white film shot in 1946. Merleau-Ponty points, as Lacan puts it, to “the paradox of that gesture which, enlar...

  17. Radiation therapy of epidemic kaposi sarcoma: the Henri-Mondor hospital experience (643 patients); Radiotherapie du sarcome de kaposi epidemique: l`experience de l`hopital Henri-Mondor (643 patients)

    Energy Technology Data Exchange (ETDEWEB)

    Belembaogo, E; Kirova, Y; Frikha, H; Yu, S; Piedbois, P; Le Bourgeois, J P [Hopital Henri-Mondor, 94 - Creteil (France). Dept. de cancerologie

    1998-01-01

    From June 1986 to December 1996, 643 patients presenting with acquired immunodeficiency syndrome (AIDS)-related epidemic Kaposi`s sarcoma were treated with irradiation at the Oncology Department of Henri Mondor University Hospital. Three-hundred eighty-seven patients (60 %) had previously received a treatment with interferon (259 patients, 40.2 %), vinblastine (225 patients, 34.5 %), doxorubicin (22 patients, 3.4 %), bleomycin (19 patients, 2.9 %), and/or antiviral treatment (216, 33.5 %). The radiotherapy was delivered by 4 MeV OR 8 MeV electron beam for extended cutaneous fields and 45-100 kV x-ray for localized fields. The delivered dose was 20 Gy in 2 weeks (2.5 Gy/fraction, 4 fractions/week) followed by 2 weeks rest and second series of 10 Gy in 1 week. For oral cavity lesions, we used a series of 15.2 Gy was delivered (1.9 Gy/fraction, 4 fractions/week), followed for three patients by a 3 week rest and by a similar second series of 15.2 Gy.Six-hundred and twenty-one patients were evaluable and the objective response rate was 92 %, with e complete regression of clinical and functional symptoms for all patients. The skin tolerance was good, with 7.3 % grade I reactions, 69.3 % of grade II reactions, and 23.4 % grade III reactions. There was a correlation between recurrence rate and the occurrence of opportunistic infections. This analysis shows the efficacy of dose radiotherapy for treatment of epidemic Kaposi sarcoma. (author)

  18. The Soundscapes of Henry Mayhew Urban Ethnography and Technologies of Transcription

    Directory of Open Access Journals (Sweden)

    Helen Groth

    2012-11-01

    Full Text Available Contemporary reviewers of London Labour and the London Poor were quick to label as inauthentic both the engraved re-mediations of John Beard’s daguerreotype portraits and Henry Mayhew’s transcription of the voices of London’s street habitués. Mayhew’s literal mediations of patter, slang and speech rhythms were the subject of particular scrutiny.  As one critic acerbically observed: ‘The photographs no doubt are accurate enough, but those dialogues smell of the footlights.’  Such criticisms strike at the core of Mayhew’s commitment to the technologies of faithful mimesis and the mediation of an authentic experience of the everyday lives of London’s wandering tribes.  Sound bites of characteristic speech serve as titles for many of the engraved reproductions of John Beard’s daguerreotypes reinforcing the analogy between visual and textual modes of transcription.  Likewise Mayhew insists that his various re-enactments of the multi-sensorial experience of elbowing through London’s crowded marketplaces and streets are ‘unvarnished’ transparent mediations of its various sounds and voices.  Central to Mayhew’s enterprise is the commitment to recording and capturing a dying way of life.  Now silenced voices are captured and remediated to ‘shock’ and teach through the ‘heart’ to use Mayhew’s terminology.  This paper will reconsider Mayhew’s investment in the power of sympathetic communication in the context of broader transformations in mid-nineteenth century conceptions of the media as a conduit for information rather than as a mechanism of persuasion.

  19. Oceanographic data collected during the HB1204 (Deep-Sea Corals and Benthic Habitats in Northeast Deepwater Canyons) expedition on NOAA Ship Henry Bigelow in the North Atlantic Ocean between 2012-07-03 to 2012-07-18 (NCEI Accession 0097966)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A multi-disciplinary team of scientists on the Henry Bigelow HB1204 mission surveyed and ground-truthed known or suspected deep-sea coral habitats associated with...

  20. Easements, MDTA Right of Way Easement, Right of Way Easement, Right of Way Easement on I 95, Fort McHenry Tunnel, Baltimore Harbor tunnel, Francis Scott Key Bridge, Published in 2010, 1:1200 (1in=100ft) scale, Maryland Transportation Authority.

    Data.gov (United States)

    NSGIC State | GIS Inventory — Easements dataset current as of 2010. MDTA Right of Way Easement, Right of Way Easement, Right of Way Easement on I 95, Fort McHenry Tunnel, Baltimore Harbor tunnel,...

  1. Chemical, physical and profile oceanographic data collected aboard NOAA Ship HENRY B. BIGELOW in the Gulf of Mexico from 2010-07-28 to 2010-08-10 in response to the Deepwater Horizon Oil Spill event (NODC Accession 0069091)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical and profile oceanographic data were collected aboard NOAA Ship HENRY B. BIGELOW in the Gulf of Mexico from 2010-07-28 to 2010-08-10 in response to...

  2. Chemical, physical and profile oceanographic data collected aboard NOAA Ship HENRY B. BIGELOW in the Gulf of Mexico from 2010-08-13 to 2010-08-22 in response to the Deepwater Horizon Oil Spill event (NODC Accession 0068954)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical and profile oceanographic data were collected aboard NOAA Ship HENRY B. BIGELOW in the Gulf of Mexico from 2010-08-13 to 2010-08-22 in response to...

  3. MEDIAÇÃO CIENTÍFICA EM MUSEUS DE CIÊNCIA E TECNOLOGIA: abordagem acerca da coleção de instrumentos científicos de Claude Henri Gorceix

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Ribeiro Jotta

    2015-12-01

    Full Text Available Trata-se de um estudo de caso sobre a coleção de instrumentos científicos de Claude Henri Gorceix, fundador da Escola de Minas de Ouro Preto, onde se localiza o Museu de Ciência e Técnica da Escola de Minas da UFOP. Esse trabalho objetiva desenvolver um estudo e análise do papel da Gestão da Informação acerca da coleção elencada para identificar as estratégias de mediação científica no Museu e sua relação com a comunicação museológica. Por meio da análise de três categorias função,significado e contexto museológico sobre os objetos da coleção serão reunidas as informações e sistematizadas, com o objetivo de contribuir para as estratégias de mediação cientifica empregada na exposição dessa coleção. A análise das informações mapeadas aponta que a mediação científica a ser empregada na coleção de Claude Henri Gorceix poderá abarcar outros aspectos sobre os instrumentos científicos.

  4. The Figure of Henry Swinburne and the Characteristics of his “Travels through Spain” La figura de Enrys Winburne y las características de su “Viaje por España”

    Directory of Open Access Journals (Sweden)

    José Francisco PÉREZ BERENGUEL

    2010-06-01

    Full Text Available  This paper includes two differentiated parts with a common linking nexus which is the travels of Henry Swinburne through Spain in the years 1775 and 1776. The first part tries to offer a detailed biography of the life and intellectual development of Swinburne. The second one, however, makes a description of the itinerary followed together with the arrangements and people involved in the journey, and also includes a thorough account of the different events comprising this experience, in particular those related to customs, roads and inns. El artículo consta de dos partes bien diferenciadas, con un nexo de unión que es el viaje de Henry Swinburne por España en 1775 y 1776. La primera parte trata de ofrecer una biografía detallada de la trayectoria vital e intelectual del personaje. La segunda, en cambio, opta por incluir una descripción del itinerario realizado, los preparativos del viaje y sus acompañantes, así como un análisis pormenorizado de las diferentes incidencias ocurridas a lo largo del camino, en especial las referentes a las aduanas, carreteras y posadas.

  5. Bayard Holmes (1852-1924) and Henry Cotton (1869-1933): Surgeon-psychiatrists and their tragic quest to cure schizophrenia.

    Science.gov (United States)

    Davidson, Jonathan

    2016-11-01

    Early 20th-century medicine was dominated by the infectious theory of disease. Some leading physicians believed that infection or the accumulation of toxic substances from bacterial stasis caused a wide range of diseases, including schizophrenia. In the case of schizophrenia, one theory held that intestinal stasis lead to the bacterial production of toxins that affected brain function, resulting in psychotic illness. This theory predicted that clearing the stasis by drainage or by removal of the offending organ would be curative. Bayard Holmes and Henry Cotton, surgeon-psychiatrists, achieved notoriety for their efforts to cure schizophrenia surgically. Their endeavours were not only a failure but resulted in tragedy to their families and to a wider population. Treatment of their own sons also represented a violation of the ethics of their time. This account describes the life and career of Holmes and Cotton and reappraises their work in the light of recent developments. © IMechE 2014.

  6. Vêtir les souverains français à la Renaissance : les garde-robes d’Henri II et de Catherine de Médicis en 1556 et 1557

    OpenAIRE

    Paresys, Isabelle

    2015-01-01

    Vêtir les souverains français à la Renaissance : les garde-robes d’Henri II et de Catherine de Médicis en 1556 et 1557 - Bien que fort lacunaires dans leur conservation, les séries documentaires comptables de l’Argenterie royale du xvie siècle fournissent des milliers d’informations sur les dépenses de la garde-robe des souverains français. Ce domaine de recherche reste pourtant bien peu exploré pour la France, par comparaison avec les études médiévales ou avec les travaux menés en Angleterre...

  7. La collaboration entre Maurice Denis et Henri Carot à la lumière de la restauration des verrières du Vésinet (Yvelines

    Directory of Open Access Journals (Sweden)

    Laurence de Finance

    2009-11-01

    Full Text Available La réalisation d’une verrière nécessite la réunion de plusieurs compétences dont celles d’un cartonnier et d’un peintre verrier. La restauration des verrières des chapelles et du déambulatoire de l’église Sainte-Marguerite du Vésinet (Yvelines a permis d’étudier le travail réalisé en étroite collaboration entre le peintre Maurice Denis et le peintre verrier Henri Carot. De nombreux documents préparatoires, découverts à l’occasion de cette restauration, ont été étudiés et comparés : projets, dessins, esquisses, et deux séries de cartons à échelle d’exécution. Leur analyse comparative permet de suivre pas à pas l’évolution de la création, du projet initial à la réalisation de l’ensemble vitré.The realisation of a stained-glass window requires the association of several skills including those of the designer (the ‘cartonnier’ or cartoon painter and the painter on glass. The restoration of the stained-glass windows of the chapels and ambulatory of the Sainte-Marguerite church at Le Vesinet (Yvelines allowed for a study of the close collaboration between the painter Maurice Denis and the glass painter Henri Carot. Many documents were brought to light during the restoration project and have been studied: projects, drawings, sketches and two series of full-scale design cartoons. The comparative analysis of these documents allows the creation of the stained-glass to be followed step by step, from the initial project to the final realisation.

  8. Maja "Moby Dick" = House Moby Dick / Jyrki Tasa

    Index Scriptorium Estoniae

    Tasa, Jyrki

    2004-01-01

    2003. a. valminud eramu projekteeris arhitekt Jyrki Tasa. Kivist trepp ja terasest sild viivad teisel korrusel valges seinas asuva peasissekäigu juurde. Talveaed ulatub läbi kahe korruse. Ruume liidavad ka kolm läbipaistvast klaasist ja terasest silda. Fassaadid on kaetud peamiselt vineeriga ning männilattide ja -laudadega. I, II, III korruse plaan, lõige, 3 välis- ja 7 sisevaadet

  9. Deviation Management: Key Management Subsystem Driver of Knowledge-Based Continuous Improvement in the Henry Ford Production System.

    Science.gov (United States)

    Zarbo, Richard J; Copeland, Jacqueline R; Varney, Ruan C

    2017-10-01

    To develop a business subsystem fulfilling International Organization for Standardization 15189 nonconformance management regulatory standard, facilitating employee engagement in problem identification and resolution to effect quality improvement and risk mitigation. From 2012 to 2016, the integrated laboratories of the Henry Ford Health System used a quality technical team to develop and improve a management subsystem designed to identify, track, trend, and summarize nonconformances based on frequency, risk, and root cause for elimination at the level of the work. Programmatic improvements and training resulted in markedly increased documentation culminating in 71,641 deviations in 2016 classified by a taxonomy of 281 defect types into preanalytic (74.8%), analytic (23.6%), and postanalytic (1.6%) testing phases. The top 10 deviations accounted for 55,843 (78%) of the total. Deviation management is a key subsystem of managers' standard work whereby knowledge of nonconformities assists in directing corrective actions and continuous improvements that promote consistent execution and higher levels of performance. © American Society for Clinical Pathology, 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

  10. L’individu comme problème phénoménologique chez Hannah Arendt et Michel Henry

    Directory of Open Access Journals (Sweden)

    Jan Cerny

    2012-12-01

    Full Text Available Cette étude, dans un premier temps, apporte des preuves à la possibilité d’interpréter la pensée politique de Hannah Arendt comme un projet phénoménologique original dont le but est d’élever l’apparence de la personne au rang de mode unique de l’apparaître. Puis elle présente brièvement la phénoménologie matérielle de Michel Henry dans laquelle le Soi individuel joue un rôle tout aussi central, puisqu’il est la condition de l’apparence de la vie et le fondement de tout apparaître. En conclusion, l’étude esquisse les conséquences d’une telle position privilégiée du sujet individuel pour la conception théorique de la réalité effective de l’apparaître, de même que pour les problèmes pratiques de l’action de l’homme dans le monde.

  11. Impact of economic fluctuations on suicide mortality in Canada (1926-2008): Testing the Durkheim, Ginsberg, and Henry and Short theories.

    Science.gov (United States)

    Thibodeau, Lise; Lachaud, James

    2016-01-01

    Three theories have been proposed to explain the relationship between suicide and economic fluctuations, including the Durkheim (nonlinear), Ginsberg (procyclical), and Henry and Short (countercyclical) theories. This study tested the effect of economic fluctuations, measured by unemployment rate, on suicide rates in Canada from 1926 to 2008. Autoregressive integrated moving average time-series models were used. The results showed a significant relationship between suicide and economic fluctuation; this association was positive during the contraction period (1926-1950) and negative in the period of economic expansion (1951-1973). Males and females showed differential effects in the period of moderate unemployment (1974-2008). In addition, the suicide rate of mid-adults (45-64) was most impacted by economic fluctuations. Our study tends to support Durkheim's theory and suggests the need for public health responses in times of economic contraction and expansion.

  12. Do gesto ao símbolo: a teoria de Henri Wallon sobre a formação simbólica From gesture to symbol: the theory of Henri Wallon about symbolic formation

    Directory of Open Access Journals (Sweden)

    Dener Luiz da Silva

    2007-01-01

    Full Text Available Henri Wallon, filósofo, médico e psicólogo francês, contribuiu para a psicologia não apenas com uma teoria da emoção ou ainda com suas discussões e divergências com Jean Piaget. Dentre suas contribuições pouco discutidas estão sua teoria sobre a inteligência, suas discussões sobre a origem e o desenvolvimento do pensamento discursivo nas crianças e, talvez menos conhecidas, suas reflexões e proposições sobre a transição entre uma inteligência sensório-motora (caracterizada pela capacidade de resolver problemas práticos, mas sem o auxílio da reflexão e uma outra, inteligência discursiva (caracterizada pela utilização e intermediação dos símbolos e representações. Sabe-se que sua proposição para essa transição, diversamente de Piaget, que ressalta a continuidade e a preparação do simbólico pelo esquematismo sensório-motor, é marcada justamente pela não continuidade entre uma inteligência e outra, pela intromissão de fatores externos tais como a cultura, o social e a linguagem, e pela complexa interação entre todos esses fatores. Para melhor compreender a proposta walloniana sobre a formação do símbolo é necessário, pois, que ingressemos na sua teoria como um todo, buscando decifrar seus conceitos de emoção, comportamento simbólico, inteligência, fatores de desenvolvimento e outros. Em uma sociedade como a nossa, baseada no comportamento simbólico, entender como se dá, qual a origem e o desenvolvimento do pensamento simbólico podem ser conhecimentos de grande valia.Henri Wallon, French philosopher, physician, and psychologist, has given psychology contribution not only with his emotion theory and with his arguments and disagreements with Jean Piaget. Among his less discussed contributions are the theory about intelligence, the discussions about the origin and development in children's discoursing thought, and, maybe less known, the reflections and propositions about the transition between

  13. Jolkinolide B induces apoptosis of colorectal carcinoma through ROS-ER stress-Ca2+-mitochondria dependent pathway.

    Science.gov (United States)

    Zhang, Jing; Wang, Yang; Zhou, Ye; He, Qing-Yu

    2017-10-31

    Colorectal carcinoma (CRC) remains one of the leading causes of death in cancer-related diseases. In this study, we aimed to investigate the anticancer effect of Jolkinolide B (JB), a bioactive diterpenoid component isolated from the dried roots of Euphorbia fischeriana Steud, on CRC cells and its underlying mechanisms. We found that JB suppressed the cell viability and colony formation of CRC cells, HT29 and SW620. Annexin V/PI assay revealed that JB induced apoptosis in CRC cells, which was further confirmed by the increased expression of cleaved-caspase3 and cleaved-PARP. iTRAQ-based quantitative proteomics was performed to identify JB-regulated proteins in CRC cells. Gene Ontology (GO) analysis revealed that these JB-regulated proteins were mainly involved in ER stress response, which was evidenced by the expression of ER stress marker proteins, HSP90, Bip and PDI. Moreover, we found that JB provoked the generation of reactive oxygen species (ROS), and that inhibition of the ROS generation with N-acetyl L-cysteine could reverse the JB-induced apoptosis. Confocal microscopy and flow cytometry showed that JB treatment enhanced intracellular and mitochondrial Ca 2+ level and JC-1 assay revealed a loss of mitochondrial membrane potential in CRC after JB treatment. The mitochondrial Ca 2+ uptake and depolarization can be blocked by Ruthenium Red (RuRed), an inhibitor of mitochondrial Ca 2+ uniporter. Taken together, we demonstrated that JB exerts its anticancer effect by ER stress-Ca 2+ -mitochondria signaling, suggesting the promising chemotherapeutic potential of JB for the treatment of CRC.

  14. Henry Hollingsworth Smith and His Bibliographical Index and Historical Record: The Beginning of American Surgical Historiography.

    Science.gov (United States)

    Rutkow, Ira

    2016-04-01

    To explore the details of Henry Hollingsworth Smith's (1815-1890) achievement as the first physician to organize in a systematic and chronologic manner the details of the history of surgery in America and prepare a register of men who performed surgical operations. The life of Smith, the earliest of the nation's surgeons to elucidate the history of American surgery, is little known. His boosting the image of the scalpel wielder helped shape the future of the craft, in particular, surgery's rise as a specialty and profession. An analysis of the published medical literature and unpublished documents relating to Smith and his work to document the history of American surgery. During the 1850 s, a time when surgery was not considered a separate branch of medicine but a mere technical mode of treatment, Smith's efforts in surgical history provided much needed encouragement to surgeons in their pursuit of professional recognition. Although Smith's accomplishment as the nation's first compiler of the history of American surgery has long been forgotten, his effort afforded the men who performed surgical operations their earliest measure of self-respect. As such, Smith belongs in America's pantheon of surgical heroes.

  15. Cr(VI) induces mitochondrial-mediated and caspase-dependent apoptosis through reactive oxygen species-mediated p53 activation in JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Son, Young-Ok; Hitron, J. Andrew; Wang Xin; Chang Qingshan; Pan Jingju; Zhang Zhuo; Liu Jiankang; Wang Shuxia; Lee, Jeong-Chae; Shi Xianglin

    2010-01-01

    Cr(VI) compounds are known to cause serious toxic and carcinogenic effects. Cr(VI) exposure can lead to a severe damage to the skin, but the mechanisms involved in the Cr(VI)-mediated toxicity in the skin are unclear. The present study examined whether Cr(VI) induces cell death by apoptosis or necrosis using mouse skin epidermal cell line, JB6 Cl41 cells. We also investigated the cellular mechanisms of Cr(VI)-induced cell death. This study showed that Cr(VI) induced apoptotic cell death in a dose-dependent manner, as demonstrated by the appearance of cell shrinkage, the migration of cells into the sub-G1 phase, the increase of Annexin V positively stained cells, and the formation of nuclear DNA ladders. Cr(VI) treatment resulted in the increases of mitochondrial membrane depolarization and caspases activation. Electron spin resonance (ESR) and fluorescence analysis revealed that Cr(VI) increased intracellular levels of reactive oxygen species (ROS) such as hydrogen peroxide and superoxide anion radical in dose-dependent manner. Blockage of p53 by si-RNA transfection suppressed mitochondrial changes of Bcl-2 family composition, mitochondrial membrane depolarization, caspase activation and PARP cleavage, leading to the inhibition of Cr(VI)-induced apoptosis. Further, catalase treatment prevented p53 phosphorylation stimulated by Cr(VI) with the concomitant inhibition of caspase activation. These results suggest that Cr(VI) induced a mitochondrial-mediated and caspase-dependent apoptosis in skin epidermal cells through activation of p53, which are mainly mediated by reactive oxidants generated by the chemical.

  16. Multilayer, Stacked Spiral Copper Inductors on Silicon with Micro-Henry Inductance Using Single-Level Lithography

    Directory of Open Access Journals (Sweden)

    Timothy Reissman

    2012-01-01

    Full Text Available We present copper structures composed of multilayer, stacked inductors (MLSIs with tens of micro-Henry inductance for use in low frequency (sub 100 MHz, power converter technology. Unique to this work is the introduction of single-level lithography over the traditional two-level approach to create each inductor layer. The result is a simplified fabrication process which results in a reduction in the number of lithography steps per inductor (metal layer and a reduction in the necessary alignment precision. Additionally, we show that this fabrication process yields strong adhesion amongst the layers, since even after a postprocess abrasion technique at the inner diameter of the inductors, no shearing occurs and connectivity is preserved. In total, three separate structures were fabricated using the single-level lithography approach, each with a three-layered, stacked inductor design but with varied geometries. Measured values for each of the structures were extracted, and the following results were obtained: inductance values of 24.74, 17.25, and 24.74 μH, self-resonances of 9.87, 5.72, and 10.58 MHz, and peak quality factors of 2.26, 2.05, and 4.6, respectively. These values are in good agreement with the lumped parameter model presented.

  17. Jolkinolide B inhibits glycolysis by downregulating hexokinase 2 expression through inactivating the Akt/mTOR pathway in non-small cell lung cancer cells.

    Science.gov (United States)

    Gao, Xiang; Han, Han

    2018-06-01

    Jolkinolide B (JB), a bioactive compound isolated from herbal medicine, has been found to inhibit tumor growth by altering glycolysis. However, whether glycolysis is influenced by JB in non-small cell lung cancer (NSCLC) cells and the mechanism remain unknown. The aim of the present study was to evaluate the effect of JB on the glycolysis in NSCLC cells and the underlying molecular mechanism. The results showed that JB treatment inhibited cell viability of A549 and H1299 cells in a concentration-dependent manner. JB reduced the glucose consumption, lactate production, and HK2 expression. The expressions of p-Akt and p-mTOR were also decreased by JB treatment. Knockdown of HK2 reduced glucose consumption and lactate production. Inhibition of the Akt/mTOR pathway decreased HK2 expression and inhibited glycolysis. In conclusion, the results indicated that JB inhibits glycolysis by down-regulating HK2 expression through inactivating the Akt/mTOR pathway in NSCLC cells, suggesting that JB might be a potential therapeutic agent for the treatment of NSCLC. © 2018 Wiley Periodicals, Inc.

  18. “Littérature d’aveu” et prise en charge des valeurs dans Ennemis publics de Michel Houellebecq et Bernard-Henri Lévy Assuming Values in “Confession Literature”: Ennemis publics by Michel Houellebecq and Bernard-Henri Lévy

    Directory of Open Access Journals (Sweden)

    Roselyne Koren

    2010-10-01

    Full Text Available L’échange épistolaire n’est pas le seul cadre discursif où l’on peut observer la façon dont des croyances axiologiques se trouvent justifiées. Quels avantages a-t-il pu présenter aux yeux des deux auteurs d’Ennemis publics, le philosophe Bernard-Henri Lévy et le romancier Michel Houellebecq ? La prise en charge de vérités autobiographiques et la notion de « littérature d’aveu » occupent une place centrale parmi ces avantages : elles nous permettront de problématiser la question de la lettre, « laboratoire de valeurs ». Le questionnement éthique auquel ils se livrent les incite ainsi à s’interroger sur leurs conceptions de la nature du sujet, de la responsabilité, de l’engagement et de l’action. On analysera, chemin faisant, quelques tropes spécifiques de leurs « visions du monde » antithétiques et on tentera de rendre compte du fait que leurs débats permettent de partager une aventure heuristique qui défige leurs images publiques respectives, objets de critiques virulentes de la part de nombreux journalistes et de commentateurs. L’évocation polémique de ces critiques joue certes un rôle important dans Ennemis publics, mais elle ne fera pas l’objet de cette contribution. On tentera ici de démontrer que cette correspondance met en œuvre et concrétise quelques-uns des concepts et des questionnements majeurs inhérents à la réflexion philosophique sur l’éthique.The epistolary genre is not the only discursive framework in which the justification of axiological beliefs can be observed and analyzed. Asking why it was selected by the authors of Ennemis publics, philosopher Bernard-Henri Lévy and novelist Michel Houellebecq, will enable us to present different aspects of their respective attitude towards the accountability for autobiographical truths. The ethical issues in which they indulge allow them to confront their own conception of the nature of the subject, of responsibility, of

  19. Le corps dans l’espace architectural. Le Corbusier, Claude Parent et Henri Gaudin

    Directory of Open Access Journals (Sweden)

    Julie Cattant

    2016-12-01

    Full Text Available Le premier geste de l’espace architectural est d’accueillir nos corps humains. En leur offrant un espacement à habiter, il leur permet de s’abriter, de se mouvoir et de se rencontrer. L’homme et l’architecture s’affectent l’un l’autre. Nombreux sont les architectes qui interrogent cette coexistence car, renouveler la pensée de l’espace nécessite de reconsidérer le corps humain. L’étude des relations entre le corps et l’espace chez trois architectes français sera l’occasion d’évoquer les écarts et les convergences entre l’homme et l’architecture. L’œuvre de Le Corbusier, protagoniste du mouvement moderne, maintient ainsi une distance entre un corps machinisé et un espace idéal. Marquée par un mode de pensée dualiste, l’architecture de Le Corbusier annonce toutefois son propre dépassement, dépassement que Claude Parent et Henri Gaudin opèreront par la suite à leur manière, le premier en introduisant l’oblique et la déstabilisation du corps, le second en transgressant la limite de l’espace et du corps pour envisager leur porosité réciproque. Finalement, c’est la manière dont l’homme appréhende l’espace avec son corps qui est questionnée par ces trois architectes, de la prégnance du visuel à son évincement.

  20. Oestrogen and progesterone receptor assays in breast tumours. The Prince Henry's Hospital experience, 1983-1990.

    Science.gov (United States)

    Pearce, P T; Myles, K M; Funder, J W

    1993-08-16

    To present and analyse the results of eight years of experience (1983-1990) in breast tumour receptor analysis. All female primary breast tumour samples received (4683) were analysed for seasonal variation, patient age, relative risk index, oestrogen receptor (ER) and progesterone receptor (PR) status, ER and PR status as a function of age, ER and PR levels as a function of age, and ER and PR levels as a function of month of analysis. The assays were done at the Medical Research Centre, Prince Henry's Hospital, Melbourne, as a non-profit service to surgeons, oncologists and pathologists. The numbers of samples referred for assay increased progressively each year, from 473 in 1983 to 1097 in 1990, but the receptor status (ER +/-, PR +/-) appeared not to vary from year to year. ER+PR+ tumours were the most common in all age groups, steadily increasing from between 50% and 60% in premenopausal women to 70% or more in those aged over 80. In postmenopausal women, levels of ER in ER+ tumours were three times those in premenopausal women; PR levels in PR+ tumours, however, were bimodal, with higher levels in the age groups 35-49 and 70-89 years than in women aged 50-69 years. No significant seasonal variation was seen, and the overall patterns of receptor status are similar to those seen in Northern hemisphere studies.

  1. Daily Management System of the Henry Ford Production System: QTIPS to Focus Continuous Improvements at the Level of the Work.

    Science.gov (United States)

    Zarbo, Richard J; Varney, Ruan C; Copeland, Jacqueline R; D'Angelo, Rita; Sharma, Gaurav

    2015-07-01

    To support our Lean culture of continuous improvement, we implemented a daily management system designed so critical metrics of operational success were the focus of local teams to drive improvements. We innovated a standardized visual daily management board composed of metric categories of Quality, Time, Inventory, Productivity, and Safety (QTIPS); frequency trending; root cause analysis; corrective/preventive actions; and resulting process improvements. In 1 year (June 2013 to July 2014), eight laboratory sections at Henry Ford Hospital employed 64 unique daily metrics. Most assessed long-term (>6 months), monitored process stability, while short-term metrics (1-6 months) were retired after successful targeted problem resolution. Daily monitoring resulted in 42 process improvements. Daily management is the key business accountability subsystem that enabled our culture of continuous improvement to function more efficiently at the managerial level in a visible manner by reviewing and acting based on data and root cause analysis. Copyright© by the American Society for Clinical Pathology.

  2. Heinrich Dieter Holland (1927-2012)

    Science.gov (United States)

    Turekian, Karl K.

    2012-08-01

    Heinrich Dieter "Dick" Holland, who died on 21 May 2012, was responsible for major advances across several fields of geochemistry. He was born on 27 May 1927 and died just short of his 85th birthday. How Dick became a geochemist is an interesting story in itself. I first met Dick when we shared an office as graduate students at Columbia University in New York. He had attended Princeton University in New Jersey and graduated in 1946 with a chemistry major. He had arrived in the United States with his family from Germany in 1940. The family was of Jewish origin, and although Dick and his relatives were not strict practitioners, their fate in Hitler's Germany, dictated by the family's ancestry, would have been undesirable. Dick and his brother first went to England in 1939 to escape the future horrors that were sure to await them if they had remained in Germany. After their parents escaped to the Dominican Republic, Dick and his brother joined them there. With the help of friends, the family came to the United States from the Dominican Republic in 1940 (it was not unusual for immigrants to first come to a landing spot in the western hemisphere prior to admission to the United States).

  3. JB_518_ESM.doc

    Indian Academy of Sciences (India)

    Jian Zeng and Shunv Cai. J. Biosci. 42(1), March 2017 © Indian Academy of Sciences. Supplementary material. Supplementary figure 1. Overexpression of miR-7 enhanced A549 cell apoptosis in response to BVP (100 µM). A TUNEL assay was performed according to the manufacturer's instructions (Promega Corporation, ...

  4. JB_224_ESM.docx

    Indian Academy of Sciences (India)

    121

    (A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...

  5. JB_378_ESM.docx

    Indian Academy of Sciences (India)

    Sushila

    Paraffin sections hybridized with antisense probe are shown. Purple staining indicates a positive reaction only in the corpus luteum but not in the corpus (B) and cauda (C). Supplementary figure 2. Determining specificity of amplicons of Ovgp1 (A) and Gapdh (B) by melt curve analysis. Melt peak for Ovgp1 PCR fragment is ...

  6. [The materialistic strategy of Henry Howard, a Québec alienist (1815-1887).].

    Science.gov (United States)

    Fugère, A

    1978-01-01

    At the end of the 19th century, Henry Howard appeared as the first Quebec "aliéniste" to attempt to develop an inclusive theoretical treatise on the question of madness. Why this sudden upheaval ? There existed numerous european theories ; that might have sufficed. The author attempts to show the multiple connections of this theoretical pro-lect to the socio-political problems of québécois society. Howard tries, from the perspective of the theory which he elaborates, to intervene in the major discussions affecting Quebec: ultra montanism, the problem of universal compusory education, public morality. At a more professional level he attempts to intervene in the legal dispute opposing judicial and medical competence in the cases of insanity pleas, as well as in the question of the scientific and social status of the "aliéniste". The involvement in these struggles manifests itself in Howard's treatise as much at the level of the concepts themselves, and their architecture, as at the thematic level and in the applications which he naturally draws. It is not onty external and contingent but works on the text from the inside as well. The article attempts to suggest that at the very moment that the treatise on the alienated-which would become the "science" that we know today- seeks to structure itself into a theory, it cannot break its attachment to its determining social context and that, ignoring its ideological role it, in truth, succeeds only in creating illusion and the impression of a progressive process, all the while being circumstantial and having a verted interest.

  7. Lost in translation? The potential psychobiotic Lactobacillus rhamnosus (JB-1) fails to modulate stress or cognitive performance in healthy male subjects.

    Science.gov (United States)

    Kelly, John R; Allen, Andrew P; Temko, Andriy; Hutch, William; Kennedy, Paul J; Farid, Niloufar; Murphy, Eileen; Boylan, Geraldine; Bienenstock, John; Cryan, John F; Clarke, Gerard; Dinan, Timothy G

    2017-03-01

    Preclinical studies have identified certain probiotics as psychobiotics - live microorganisms with a potential mental health benefit. Lactobacillus rhamnosus (JB-1) has been shown to reduce stress-related behaviour, corticosterone release and alter central expression of GABA receptors in an anxious mouse strain. However, it is unclear if this single putative psychobiotic strain has psychotropic activity in humans. Consequently, we aimed to examine if these promising preclinical findings could be translated to healthy human volunteers. To determine the impact of L. rhamnosus on stress-related behaviours, physiology, inflammatory response, cognitive performance and brain activity patterns in healthy male participants. An 8week, randomized, placebo-controlled, cross-over design was employed. Twenty-nine healthy male volunteers participated. Participants completed self-report stress measures, cognitive assessments and resting electroencephalography (EEG). Plasma IL10, IL1β, IL6, IL8 and TNFα levels and whole blood Toll-like 4 (TLR-4) agonist-induced cytokine release were determined by multiplex ELISA. Salivary cortisol was determined by ELISA and subjective stress measures were assessed before, during and after a socially evaluated cold pressor test (SECPT). There was no overall effect of probiotic treatment on measures of mood, anxiety, stress or sleep quality and no significant effect of probiotic over placebo on subjective stress measures, or the HPA response to the SECPT. Visuospatial memory performance, attention switching, rapid visual information processing, emotion recognition and associated EEG measures did not show improvement over placebo. No significant anti-inflammatory effects were seen as assessed by basal and stimulated cytokine levels. L. rhamnosus was not superior to placebo in modifying stress-related measures, HPA response, inflammation or cognitive performance in healthy male participants. These findings highlight the challenges associated with

  8. Jaspine B induces nonapoptotic cell death in gastric cancer cells independently of its inhibition of ceramide synthase.

    Science.gov (United States)

    Cingolani, Francesca; Simbari, Fabio; Abad, Jose Luis; Casasampere, Mireia; Fabrias, Gemma; Futerman, Anthony H; Casas, Josefina

    2017-08-01

    Sphingolipids (SLs) have been extensively investigated in biomedical research due to their role as bioactive molecules in cells. Here, we describe the effect of a SL analog, jaspine B (JB), a cyclic anhydrophytosphingosine found in marine sponges, on the gastric cancer cell line, HGC-27. JB induced alterations in the sphingolipidome, mainly the accumulation of dihydrosphingosine, sphingosine, and their phosphorylated forms due to inhibition of ceramide synthases. Moreover, JB provoked atypical cell death in HGC-27 cells, characterized by the formation of cytoplasmic vacuoles in a time and dose-dependent manner. Vacuoles appeared to originate from macropinocytosis and triggered cytoplasmic disruption. The pan-caspase inhibitor, z-VAD, did not alter either cytotoxicity or vacuole formation, suggesting that JB activates a caspase-independent cell death mechanism. The autophagy inhibitor, wortmannin, did not decrease JB-stimulated LC3-II accumulation. In addition, cell vacuolation induced by JB was characterized by single-membrane vacuoles, which are different from double-membrane autophagosomes. These findings suggest that JB-induced cell vacuolation is not related to autophagy and it is also independent of its action on SL metabolism. Copyright © 2017 by the American Society for Biochemistry and Molecular Biology, Inc.

  9. Advanced Oxygen Systems for Aircraft (Systemes d’Oxygene Avances)

    Science.gov (United States)

    1996-04-01

    Oxygen Generating System (NAOGS), SAM-TR-80-12, Brooks AFB TX 78235, 1980. 11. Horch TC, Miller RL, Bomar JB, Tedor JB, Holden RD, Ikels KG, and...sieve oxygen generation sys- tem. Data from Horch et al (15). cabin altitude. The minimum and maximum oxygen concen- tration lines depict the...an AV-8A Aircraft; Naval Air Test Center Report No. SY-136R-81, 1981. 15. Horch TC, Miller RL, Bomar JB Jr, Tedor JB, Holden RD, Ikels KG, and

  10. OS EFEITOS DE SENTIDO TEXTUALIZADOS NA CAPA DO LIVRO “THE TRIPLE HELIX – UNIVERSITY, INDUSTRY, GOVERNMENT – INNOVATION IN ACTION” DE HENRY ETZKOWITZ

    Directory of Open Access Journals (Sweden)

    Luciana Flôr Correa

    2016-12-01

    Full Text Available O objetivo do presente artigo é apresentar, à luz da Análise do Discurso da linha francesa (AD e do enfoque Ciência, Tecnologia e Sociedade (CTS, os efeitos de sentido textualizados na capa do livro “The Triple Helix - University, Industry, Government – Innovation in Action”, de Henry Etzkowitz. Para subsidiar a análise, inicialmente faremos uma breve apresentação das abordagens teórico-metodológicas utilizadas no estudo. Ainda para alcançar o objetivo central, enfocaremos na sequência, o contexto da teoria da Hélice Tríplice como parte das condições de produção dos efeitos de sentido. E, na seção posterior, apresentaremos a apreciação dos resultados obtidos.

  11. Brane dynamics in the Randall-Sundrum model, inflation and graceful exit

    International Nuclear Information System (INIS)

    Bhattacharya, Somdatta; Choudhury, Debajyoti; Jatkar, Dileep P; Sen, Anjan Ananda

    2002-01-01

    We study the averaged action of the Randall-Sundrum model with a time-dependent metric ansatz. It can be reformulated in terms of a Brans-Dicke action with time-dependent Newton's constant. We show that the physics of the early universe, particularly inflation, is governed by the Brans-Dicke theory. The Brans-Dicke scalar, however, quickly settles to its equilibrium value and decouples from the post-inflationary cosmology. The deceleration parameter is negative to start with but changes sign before the Brans-Dicke scalar settles to its equilibrium value. Consequently, the brane metric smoothly exits inflation. We have also studied the slow-roll inflation in our model and investigated the spectra of the density perturbation generated by the radion field and find them consistent with the current observations

  12. Impacts of NOx reducing antioxidant additive on performance and emissions of a multi-cylinder diesel engine fueled with Jatropha biodiesel blends

    International Nuclear Information System (INIS)

    Palash, S.M.; Kalam, M.A.; Masjuki, H.H.; Arbab, M.I.; Masum, B.M.; Sanjid, A.

    2014-01-01

    Highlights: • Environmental benefits of JB blends were found but adverse impact on NO x . • Addition of 0.15% (m) DPPD in JB20, average reduction in NO up to 16.54%. • In some cases, engine power is reduced with DPPD additive. • Emissions of HC and CO for JB blends with DPPD were lower compared to diesel. • Addition of DPPD in JB blends reduction of EGT was found. - Abstract: Energy requirements are increasing rapidly due to fast industrialization and the increased number of vehicles on the road. The use of biodiesel in diesel engines instead of diesel results in the proven reduction of harmful exhaust emissions. However, most researchers have reported that they produce higher NO x emissions compared to diesel, which is a deterrent to the expansion of the market for these fuels. Several proposed pathways try to account for NO x formation during the combustion process. Among them, the Fenimore mechanism explains that fuel radicals formed during the combustion process react with nitrogen from the air to form NO x . It could be proposed that if these radical reactions could be terminated, the NO x formation rate for biodiesel combustion would decrease. An experimental study was conducted on a four-cylinder diesel engine to evaluate the performance and emission characteristics of Jatropha biodiesel blends (JB5, JB10, JB15 and JB20) with and without the addition of N,N′-diphenyl-1,4-phenylenediamine (DPPD) antioxidant. For each tested fuel, the engine performance and emissions were measured at engine speeds 1000–4000 rpm at an interval of 500 rpm under the full throttle condition. The results showed that this antioxidant additive could reduce NO x emissions significantly with a slight penalty in terms of engine power and Brake Specific Fuel Consumption (BSFC) as well as CO and HC emissions. However, when compared to diesel combustion, the emissions of HC and CO with the addition of the DPPD additive were found to be nearly the same or lower. By the

  13. « Effets-tableaux » et parergon dans Macbeth Meeting the Three Witches par Francesco Zuccarelli et par Henry Füssli d’après Macbeth Pictorialism and “ergon” in the paintings of Macbeth Meeting the Three Witches by Francesco Zuccarelli (1760 and Henry Fuseli (1793-1794 after Macbeth

    Directory of Open Access Journals (Sweden)

    Nathalie Padilla

    2006-01-01

    Full Text Available During the 18th century, Shakespeare’s Macbeth was a source of inspiration for many painters who tried to underscore the pictorial quality of the play, especially that of Act 1, scene 3. The paper compares the interpretations offered by Henry Fuseli and Francesco Zuccarelli who were both foreign artists belonging to the Royal Academy of London. Their paintings after Act 1, scene 3, of Macbeth offer a visual representation articulated around contrast and convergence: if Fuseli remains faithful to the pivotal emotional intent, seen as the “ergon” here, Zuccarelli almost ignores it, finding a greater interest in the landscape of the scene that fills most of his pictorial space. However, the two works fuse together within the etymology of the term “ergon”, that equates with “work” or “action”. They illustrate the idea of active witchcraft through natural phenomena controlled by the three witches.

  14. Reinvestigation of the Henry's law constant for hydrogen peroxide with temperature and acidity variation.

    Science.gov (United States)

    Huang, Daoming; Chen, Zhongming

    2010-01-01

    Hydrogen peroxide is not only an important oxidant in itself; it also serves as both sink and temporary reservoir for other important oxidants including HOx (OH and HO2) radicals and O3 in the atmosphere. Its partitioning between gas and aqueous phases in the atmosphere, usually described by its Henry's law constant (K(H)), significantly influences its role in atmospheric processes. Large discrepancies between the K(H) values reported in previous work, however, have created uncertainty for atmospheric modelers. Based on our newly developed online instrumentation, we have re-determined the temperature and acidity dependence of K(H) for hydrogen peroxide at an air pressure of (0.960 +/- 0.013) atm (1 atm = 1.01325 x 10(5) Pa). The results indicated that the temperature dependence of K(H) for hydrogen peroxide fits to the Van't Hoff equation form, expressed as lnK(H) = a/T - b, and a = -deltaH/R, where K(H) is in M/atm (M is mol/L), T is in degrees Kelvin, R is the ideal gas constant, and deltaH is the standard heat of solution. For acidity dependence, results demonstrated that the K(H) value of hydrogen peroxide appeared to have no obvious dependence on decreasing pH level (from pH 7 to pH 1). Combining the dependence of both temperature and acidity, the obtained a and b were 7024 +/- 138 and 11.97 +/- 0.48, respectively, deltaH was (58.40 +/- 1.15) kJ/(K x mol), and the uncertainties represent sigma. Our determined K(H) values for hydrogen peroxide will therefore be of great use in atmospheric models.

  15. Electrophysiological markers predicting impeding AV-block during ablation of atrioventricular nodal reentry tachycardia.

    Science.gov (United States)

    Fragakis, Nikolaos; Krexi, Lydia; Kyriakou, Panagiota; Sotiriadou, Melani; Lazaridis, Charalambos; Karamanolis, Athanasios; Dalampyras, Panagiotis; Tsakiroglou, Stelios; Skeberis, Vassilios; Tsalikakis, Dimitrios; Vassilikos, Vassilios

    2018-01-01

    Radiofrequency (RF) ablation of the slow pathway (SP) in atrioventricular nodal reentry tachycardia (AVNRT) is occasionally complicated with atrioventricular block (AVB) often predicted by junctional beats (JB) with loss of ventriculo-atrial (VA) conduction. We analyzed retrospectively 153 patients undergoing ablation of SP for typical AVNRT. Patients were divided into two age groups: 127 ≤ 70 years and 26 > 70 years. We analyzed the interval between the atrial electrogram in the His-bundle position and the distal ablation catheter [A(H)-A(RFd)] and between the distal ablation catheter and the proximal coronary sinus catheter [A(RFd)-A(CS)] before RF applications with and without JB. We evaluated if these intervals can be used as predictors of JB incidence and also of JB with loss of VA conduction. We also assessed if age influences the risk of loss of VA conduction. The A(H)-A(RFd) and A(RFd)-A(CS) intervals were significantly shorter in RF applications causing JB than those without JB (33 ± 11 ms vs 39 ± 9 ms, P JB with VA block than those with VA conduction (29 ± 11 ms vs 35 ± 11 ms, P  70 years had shorter intervals (36 ± 11 ms vs 29 ± 8 ms, P  =  0.012, 17 ± 8 ms vs 13 ± 7 ms, P  =  0.027, respectively), while VA block was more common in this age group. The A(H)-A(RFd) and A(RFd)-A(CS) intervals can be used as markers for predicting JB occurrence as well as impending AVB. JB with loss of VA conduction occur more often in older patients possibly due to a higher position of SP. © 2017 Wiley Periodicals, Inc.

  16. On the article by Henri Poincare' open-quotes on the dynamics of the electronclose quotes

    International Nuclear Information System (INIS)

    Logunov, A.A.

    1996-01-01

    The first complete translations into English are presented of two articles written by the outstanding French scientist Henri Poincare and submitted by him in 1905 under the common title of open-quotes Sur la dynamique de l'electronclose quotes to different journals. In the present edition of these articles by H. Poincare, modern notation is used, and the articles are accompanied by comments written by A.A. Logunov. The author of the comments explains the profound physical meaning and essential novelty of the particular points and relationships established by Poincare. Such explanations are often interspersed with quotations from earlier articles by Poincare, thus clearly indicating that the main initial points of the new theory were put forward by the French scientist much before 1905, while certain concepts like 'local' time and the arbitrariness of simultaneity were given a clear explanation from the point of view of physical meaning. A.A. Logunov's book, presenting the works of Poincare on the development of relativity theory, has had quite a high success among specialists interested in the history of physics, and since 1984 it has been published in Russian three times. The present English-language edition is identical to the last 1988 Russian edition, and is dedicated to the 90th anniversary of Poincare's articles 'On the Dynamics of the Electron'. In preparing the English text, fragments were used of the translation of the long article by H.Poincare published in the book by Professor C.W. Kilmister from King's College in London/Special Theory of Relativity, Pergamon Press, New York, 1970/

  17. La construcción de un héroe victoriano. Henry Morton Stanley en sus dos primeros viajes de exploración a África, 1871-1877. Fuentes para su estudio

    Directory of Open Access Journals (Sweden)

    Alía Mondragón Moreno

    2015-12-01

    Full Text Available In this article I make an inspection of Henry Morton Stanley’s persona through its representation on the American press and the memoirs of his second expedition to Central Africa, Through the Dark Continent. The objective is to make a reflection on the massive means of communication as a tool in the process of construction of a “Victorian hero” and as an historical source. I seek to inquire the persona that was built out of Stanley, made for the popular thorough examination that, in a single lifetime, changed from considered him infamous to exemplary and vice versa.

  18. Huellas de luz. El arte y los experimentos de William Henry Fox Talbot (cat. exp.), Madrid, Museo Nacional Centro de Arte Reina Sofia/Aldeasa, 2001, 391 p., ill. coul., chronol., 41,75 E.

    OpenAIRE

    Roubert, Paul-Louis

    2008-01-01

    Cet ouvrage est le catalogue de la version espagnole de l'exposition marquant le bicentenaire de la naissance de W. H. Fox Talbot qui s'était tenue à Bradford au printemps 2001 puis au Museo Nacional Reina Sofia de Madrid à l'été suivant. Quelque peu éclipsé par la sortie contemporaine de l'imposant ouvrage de Larry J. Schaaf, The Photographic Art of William Henry Fox Talbot, ce catalogue constitue pourtant une excellente introduction à l'oeuvre photographique complexe et multiple de T...

  19. Obituary: Richard B. Dunn, 1927-2005

    Science.gov (United States)

    Keil, Stephen L.; Dooling, David

    2007-12-01

    Dr. Richard B. Dunn, astronomer emeritus at the National Solar Observatory, died of a heart attack on September 29, 2005. He was recognized as one of the foremost experimental solar physicists. His innovative designs for telescopes and instruments led to many important discoveries in solar physics. Born in Baltimore, Maryland, in 1927 and raised in Minneapolis, Minnesota, Dick's parents were Dr. Halbert L. Dunn and Katherine Brandner. Halbert (MD, Ph.D., F.A.P.H.A.) was an physician who became Chief of the National Office of Vital Statistics, Public Health Service. He published a paper "High Level Wellness for Man and Society" that became the founding paper of the field of wellness health care. After their divorce in 1942, Katherine moved to New York and became a social worker. Dick had two older brothers who died before him, Halbert (born in 1921, who became a civil engineer) and Robert (born in 1924, who became an architect). Dick earned a BS in mechanical engineering and an MS in astronomy at the University of Minnesota. At the end of World War II he served in the United States Army in Japan. For his master's degree, Dick undertook the design and construction of a Lyot-type birefringent filter for observations of solar prominences. This early work led to his acceptance at Harvard, where Professor Donald Menzel encouraged him to continue his work with the 15-inch Cambridge telescope. In 1951 he conducted part of his doctoral thesis work at the fledgling Sacramento Peak Observatory in southern New Mexico. The observatory director, Dr. John Evans, was impressed with Dick's outstanding instrumental talents and invited him to join as one of the first scientific staff members. During his first few years at Sac Peak, Dick developed two more birefringent filter systems including one with an integrated coronagraph. With this system, he produced the best prominence and spicule observations ever obtained. Dick's career was dedicated to obtaining solar observations of the

  20. History of Fuel Cell R&D at Fort Belvoir, Virginia

    Science.gov (United States)

    2008-04-01

    J. Armstrong, Dick Belt, Walt Taschek, Milt Jakola, Bob Chapman, Bill Carlton and Don Fetterman . The primary effort was fuel cells but Stirling...Kezer, Ed Gillis, Don Fetterman , Dick Belt, John Orth (Chief), Oscar Cleaver (Technical Director), Walter Taschek, Bob Trader, & Marshall (Jack

  1. Development of a Henry's constant correlation and solubility measurements of n-pentane, i-pentane, cyclopentane, n-hexane, and toluene in water

    International Nuclear Information System (INIS)

    Chapoy, Antonin; Haghighi, Hooman; Tohidi, Bahman

    2008-01-01

    In this communication, we report new experimental data on n-pentane, i-pentane, cyclopentane, n-hexane, and toluene solubility in water at low temperature (below 298.15 K) and atmospheric pressure conditions. The new experimental data together with those reported in the literature have been used in developing a new equation for Henry's constants of normal alkanes (methane to decane), BETEX compounds, and acid gases in aqueous phase over a wide range of temperature (typically from 273.15 K to 373.15 K). The new equation is based on a thermodynamic model, which uses the Peng-Robinson equation of state combined with the classical quadratic mixing rules for modelling non-aqueous phases, while the NRTL model is used to calculate the water activity. The predictions of the developed thermodynamic model are compared to the experimental data and the results of a thermodynamic approach, which uses the Valderrama modification of the Patel-Teja equation of state and non-density dependent mixing rules for modelling all fluid phases. Good agreement is observed between the experimental data and the model predictions

  2. Diclofenac Potassium Transdermal Patches Using Natural Rubber Latex Biomembranes as Carrier

    Directory of Open Access Journals (Sweden)

    Natan Roberto de Barros

    2015-01-01

    Full Text Available The aim of this study was to design a compound transdermal patch containing diclofenac potassium (Dic-K using natural rubber latex (NRL biomembrane. The NRL from Hevea brasiliensis is easily manipulated and low cost and presents high mechanical resistance. It is a biocompatible material which can stimulate natural angiogenesis and is capable of adhering cells on its surface. Recent researches have used the NRL for Transdermal Drug Delivery Systems (TDDSs. Dic-K is used for the treatment of rheumatoid arthritis and osteoarthritis and pain relief for postoperative and posttraumatic cases, as well as inflammation and edema. Results showed that the biomembrane can release Dic-K for up to 216 hours. The kinetics of the Dic-K release could be fitted with double exponential function. X-ray diffraction and Fourier Transform Infrared (FTIR spectroscopy show some interaction by hydrogen bound. The results indicated the potential of the compound patch.

  3. Antioxidant Property of Jobelyn as the Possible Mechanism Underlying its Anti-amnesic Activity in Rodents

    Directory of Open Access Journals (Sweden)

    Solomon Umukoro

    2013-02-01

    Full Text Available Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. This investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities. Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice.  The effect of JB on acetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out.  Results: JB was found to produce a signi.cant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a signi.cant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property.  In addition, it increased the defense armory of the brain tissues, as it signi.cantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and hippocampus

  4. Correlation and prediction of Henry constants for liquids and gases in five industrially important polymers using a CS-type correlation based on the van der Waals equation of state. Comparison with other predictive models

    DEFF Research Database (Denmark)

    Bithas, Sotiris; Kontogeorgis, Georgios M; Kalospiros, Nikolaos

    1995-01-01

    A simple two-parameter corresponding states-type method for the prediction of Henry constants of gases and liquid solvents in polymer solutions recently presented in the literature is thoroughly evaluated here and compared with the predictions of other models used for polymers. The corresponding...... states-type method is based on the van der Waals equation of state which has been recently extended to mixtures including polymers. Results are presented for systems containing five polymers in a variety of gases and nonpolar and polar liquid solutes. It is shown that agreement between experimental...

  5. Surface magnetization of the Ising ferromagnet in semi-infinite cubic lattice: renormalization group approach

    International Nuclear Information System (INIS)

    Chame, A.M.N.; Tsallis, C.

    1988-01-01

    The behaviour of the spontaneous surface and bulk magnetizations as function of the temperature for the Ising ferromagnet in a semi-infinitre cubic lattice for various ratios JS/JB (JS and JB are the surface and bulk coupling constants, respectively), is studied. The extraordinary transition where the surface maintains its magnetization as the bulk disorders, was study, in particular; a discontinuity on the first derivative of the surface magnetization at the bulk transition temperature was found. The criticality of the system (universality classes, critical exponents and amplitudes) is discussed. An unexpected slight lack of monotonicity of the surface magnetization as a function of JS/JB for JS/JB [pt

  6. Controls on sediment cover in bedrock-alluvial channels of the Henry Mountains, Utah

    Science.gov (United States)

    Hodge, R. A.; Yager, E.; Johnson, J. P.; Tranmer, A.

    2017-12-01

    The location and extent of sediment cover in bedrock-alluvial channels influences sediment transport rates, channel incision and instream ecology. However, factors affecting sediment cover and how it responds to changes in relative sediment supply have rarely been quantitatively evaluated in field settings. Using field surveys and SFM analysis of channel reach topography, we quantified sediment cover and channel properties including slope, width, grain size distributions, and bedrock and alluvial roughness in North Wash and Chelada Creek in the Henry Mountains, Utah. Along reaches where upstream sediment supply does not appear to be restricted, we find that the fraction of local bedrock exposure increases as a function of local relative transport capacity . In a downstream section of Chelada Creek, decadal-scale sediment supply has been restricted by an upstream culvert that has caused a backwater effect and corresponding upstream deposition. In this section, alluvial cover is uncorrelated with local stream power. To test the impact of relative sediment supply on sediment cover, a 1D sediment transport model was used to predict the equilibrium sediment cover in Chelada Creek under varying flow and sediment supply conditions. Sediment transport in each model section was predicted using the partial cover model of Johnson (2015), which accounts for differences in bedrock and alluvial roughness on critical shear stress and flow resistance. Model runs in which sediment supply was approximately equal to mean transport capacity produced a pattern of sediment cover which best matched the field observations upstream of the culvert. However, runs where sediment supply was under-capacity produced the pattern most similar to field observations downstream of the culvert, consistent with our field-based interpretations. Model results were insensitive to initial sediment cover, and equilibrium was relatively quickly reached, suggesting that the channel is responsive to changes in

  7. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 10032, T. aestivum L. var. aestivum, Mexico, Spring, Q4 ... TRI 10311, T. aestivum L. var. aestivum, Japan, Spring, Q2 ..... precursor (sucrose export defective 1), dihydrolipoamide dehydrogenase precursor, disulfide-isomerase precursor.

  8. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 3569, T. aestivum L. var. lutescens, Uruguay, Spring, Q4 ..... putative resistance complex protein, putative disease resistance protein, cold shock protein, barley stem rust resistance protein, seven transmembrane protein, cytochrome P450, glutamate dehydrogenase, pyruvate decarboxylase, peroxidase and chaperonin.

  9. Quantum dot lattice as nano-antenna for collective spontaneous emission

    NARCIS (Netherlands)

    Mokhlespour, S.; Haverkort, J.E.M.; Slepyan, G.Y.; Maksimenko, S.A.; Hoffmann, A.; Maffucci, A.; Maksimenko, S.A.

    2016-01-01

    We present a theory for the collective spontaneous emission of timed Dicke states in a periodic 2D-array of quantum dots (QDs) coupled by dipoledipole (d-d) interactions. The master equation is first reformulated with respect to the timed Dicke basis. As a result, we obtain simple analytical

  10. Rooseveltův muž v Trumanově době: Henry A. Wallace a jeho postoje k zahraniční politice Spojených států amerických ve 40. a 50. letech 20. století

    OpenAIRE

    Rýgrová, Pavla

    2016-01-01

    This thesis is dedicated to the rupture between Henry A. Wallace and Truman's administration during the forties of the twentieth century, that is mainly to the Wallace's disagreement with the Democratic Party regarding U. S.-Soviet relations. Disapproval of the former Roosevelt's vicepresident with the official standing of the American foreign policy ultimately lead to his presidency candidacy in 1948 and to the creation of protest Progressive Party, which was supposed to shield this candidac...

  11. Impact of biodiesel blend on injector deposit formation

    International Nuclear Information System (INIS)

    Liaquat, A.M.; Masjuki, H.H.; Kalam, M.A.; Rizwanul Fattah, I.M.

    2014-01-01

    Continued legislative pressure to reduce exhaust emissions from CI (compression ignition) has resulted in the development of advanced fuel injection equipment. This advanced injection system produces higher temperatures and pressures at the injector tip, where deposit formation is initiated. In this research, an endurance test was carried out for 250 h on 2 fuel samples; DF (diesel fuel) as baseline fuel and JB20 (20% jatropha biodiesel and 80% DF) in a single-cylinder CI engine. The effects of JB20 on injector nozzle deposits, engine lubricating oil, and fuel economy and exhaust emissions were investigated during the endurance test. According to the results of the investigation, visual inspection showed some deposit accumulation on injectors for both fuel samples. SEM (scanning electron microscopy) and EDX (energy dispersive X-ray spectroscopy) analysis showed greater carbon deposits on and around the injector tip for JB20 compared to the engine running with DF. Similarly, lubricating oil analysis presented excessive wear metal concentrations and decreased viscosity values when the engine was fueled with JB20. Finally, fuel economy and emission results during the endurance test showed higher BSFC (brake specific fuel consumption) and NO x emissions, and lower HC (hydrocarbons) and CO (carbon monoxide) emissions, for the JB20 blend compared to DF. - Highlights: • Endurance test for 250 h on 2 fuel samples; diesel fuel and JB20. • Investigation on effects of JB20 on the injector deposits and exhaust emissions. • Lubricating oil analysis during endurance test. • SEM (scanning electron microscopy) analysis. • EDX (energy dispersive X-ray spectroscopy) analysis

  12. A question mark on the equivalence of Einstein and Jordan frames

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Narayan [Department of Physical Sciences, Indian Institute of Science Education and Research - Kolkata, West Bengal 741246 (India); Majumder, Barun, E-mail: barunbasanta@iitgn.ac.in [Department of Physics, Montana State University, Bozeman, MT 59717 (United States); Department of Physics, IIT Gandhinagar, Ahmedabad (India)

    2016-03-10

    With an explicit example, we show that Jordan frame and the conformally transformed Einstein frames clearly lead to different physics for a non-minimally coupled theory of gravity, namely Brans–Dicke theory, at least at the quantum level. The example taken up is the spatially flat Friedmann cosmology in Brans–Dicke theory.

  13. Using Formative Assessment to Facilitate Learner Self-Regulation: A Case Study of Assessment Practices and Student Perceptions in Hong Kong

    Science.gov (United States)

    Jing Jing, Ma

    2017-01-01

    One of the key aims of formative assessment in higher education is to enable students to become self-regulated learners (Nicol & Macfarlane-Dick, 2006). Based on Nicol and Macfarlane-Dick's (2006) framework, this exploratory study investigates which formative assessment practices proposed by them were used by one college EFL writing teacher to…

  14. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from Surface underway observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from NOAA Ship HENRY B. BIGELOW in the North Atlantic Ocean and Stellwagen Bank National Marine Sanctuary from 2016-04-08 to 2016-11-21 (NCEI Accession 0157405)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157405 includes Surface underway, chemical, meteorological and physical data collected from NOAA Ship HENRY B. BIGELOW in the North Atlantic Ocean...

  15. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from Surface underway observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from NOAA Ship HENRY B. BIGELOW in the North Atlantic Ocean and Stellwagen Bank National Marine Sanctuary from 2015-03-12 to 2015-11-17 (NCEI Accession 0157418)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157418 includes Surface underway, chemical, meteorological and physical data collected from NOAA Ship HENRY B. BIGELOW in the North Atlantic Ocean...

  16. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from Surface underway observations using Carbon dioxide (CO2) gas analyzer, Shower head chamber equilibrator for autonomous carbon dioxide (CO2) measurement and other instruments from NOAA Ship HENRY B. BIGELOW in the North Atlantic Ocean and Stellwagen Bank National Marine Sanctuary from 2011-03-01 to 2012-08-24 (NCEI Accession 0157459)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157459 includes Surface underway, chemical, meteorological and physical data collected from NOAA Ship HENRY B. BIGELOW in the North Atlantic Ocean...

  17. New hematological key for bovine leukemia virus-infected Japanese Black cattle.

    Science.gov (United States)

    Mekata, Hirohisa; Yamamoto, Mari; Kirino, Yumi; Sekiguchi, Satoshi; Konnai, Satoru; Horii, Yoichiro; Norimine, Junzo

    2018-02-20

    The European Community's (EC) Key, which is also called Bendixen's Key, is a well-established bovine leukemia virus (BLV) diagnostic method that classifies cattle according to the absolute lymphocyte count and age. The EC Key was originally designed for dairy cattle and is not necessarily suitable for Japanese Black (JB) beef cattle. This study revealed the lymphocyte counts in the BLV-free and -infected JB cattle were significantly lower than those in the Holstein cattle. Therefore, applying the EC Key to JB cattle could result in a large number of undetected BLV-infected cattle. Our proposed hematological key, which was designed for JB cattle, improves the detection of BLV-infected cattle by approximately 20%. We believe that this study could help promote BLV control.

  18. Antioxidant Property of Jobelyn as the Possible Mechanism Underlying

    Directory of Open Access Journals (Sweden)

    Solomon Umukoro

    2013-01-01

    Full Text Available   Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. T his investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities.   Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice. The effect of JB on a cetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out.   Results: JB was found to produce a significant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a significant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property. In addition, it increased the defense armory of the brain tissues, as it significantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and

  19. A question mark on the equivalence of Einstein and Jordan frames

    Directory of Open Access Journals (Sweden)

    Narayan Banerjee

    2016-03-01

    Full Text Available With an explicit example, we show that Jordan frame and the conformally transformed Einstein frames clearly lead to different physics for a non-minimally coupled theory of gravity, namely Brans–Dicke theory, at least at the quantum level. The example taken up is the spatially flat Friedmann cosmology in Brans–Dicke theory.

  20. Effect of Vertical Shoot-Positioned, Scott-Henry, Geneva Double-Curtain, Arch-Cane, and Parral Training Systems on the Volatile Composition of Albariño Wines

    Directory of Open Access Journals (Sweden)

    Mar Vilanova

    2017-09-01

    Full Text Available Viticultural practices influence both grape and wine quality. The influence of training systems on volatile composition was investigated for Albariño wine from Rías Baixas AOC in Northwest Spain. The odoriferous contribution of the compounds to the wine aroma was also studied. Volatile compounds belonging to ten groups (alcohols, C6-compounds, ethyl esters, acetates, terpenols, C13-norisoprenoids, volatile phenols, volatile fatty acids, lactones and carbonyl compounds were determined in Albariño wines from different training systems, Vertical Shoot-Positioned (VSP, Scott-Henry (SH, Geneva Double-Curtain (GDC, Arch-Cane (AC, and Parral (P during 2010 and 2011 vintages. Wines from GDC showed the highest total volatile composition with the highest concentrations of alcohols, ethyl esters, fatty acids, and lactones families. However, the highest levels of terpenes and C13-norisoprenoids were quantified in the SH system. A fruitier aroma was observed in Albariño wines from GDC when odor activity values were calculated.