WorldWideScience

Sample records for dick henry jb

  1. Moby Dick.

    Science.gov (United States)

    Stern, Milton R.

    1986-01-01

    Discusses examples in "Moby Dick" of Melvillean words symptomatic of the significance of Ishmael's rhetorical energy, in order to suggest that Ishmael's language reflects Melville's search for lexical and rhetorical forms that express the democratic impulse. (SRT)

  2. On JB-Rings

    Institute of Scientific and Technical Information of China (English)

    Huanyin CHEN

    2007-01-01

    A ring R is a QB-ring provided that aR + bR = R with a, b ∈ R implies that there exists a y ∈ R such that a+by ∈ R-1q. It is said that a ring R is a JB-ring provided that R/J(R) is a QB-ring, where J(R) is the Jacobson radical of R. In this paper, various necessary and sufficient conditions, under which a ring is a JB-ring, are established. It is proved that JB-rings can be characterized by pseudo-similarity. Furthermore, the author proves that R is a J B-ring iff so is R/J(R)2.

  3. Dick receives 2011 Harry H. Hess Medal: Citation

    Science.gov (United States)

    Niu, Yaoling

    2012-01-01

    Henry J. B. Dick was awarded the 2011 Harry H. Hess Medal at the AGU Fall Meeting Honors Ceremony, held on 7 December 2011 in San Francisco, Calif. The medal is for "outstanding achievements in research on the constitution and evolution of Earth and other planets."

  4. Dick receives 2011 Harry H. Hess Medal: Response

    Science.gov (United States)

    Dick, Henry J. B.

    2012-01-01

    Henry J. B. Dick was awarded the 2011 Harry H. Hess Medal at the AGU Fall Meeting Honors Ceremony, held on 7 December 2011 in San Francisco, Calif. The medal is for "outstanding achievements in research on the constitution and evolution of Earth and other planets."

  5. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  6. Interview with Dick Whiteside

    Science.gov (United States)

    Winarski, Kathy

    2005-01-01

    Dick Whiteside, Vice President for Enrollment Management at Tulane University, is one of the leading strategists in the field of enrollment management. Dr. Whiteside has held influential positions at the University of Hartford, in West Hartford, Connecticut, The Johns Hopkins University in Baltimore, Maryland, the City University of New York in…

  7. Dicke Superradiance in Solids

    OpenAIRE

    Cong, Kankan; Zhang, Qi; Wang, Yongrui; Noe II, G. Timothy; Belyanin, Alexey; Kono, Junichiro

    2016-01-01

    Recent advances in optical studies of condensed matter have led to the emergence of phenomena that have conventionally been studied in the realm of quantum optics. These studies have not only deepened our understanding of light-matter interactions but also introduced aspects of many-body correlations inherent in optical processes in condensed matter systems. This article is concerned with superradiance (SR), a profound quantum optical process predicted by Dicke in 1954. The basic concept of S...

  8. Brans-Dicke geometry

    CERN Document Server

    Punzi, Raffaele; Wohlfarth, Mattias N R

    2008-01-01

    We reveal the non-metric geometry underlying omega-->0 Brans-Dicke theory by unifying the metric and scalar field into a single geometric structure. Taking this structure seriously as the geometry to which matter universally couples, we show that the theory is fully consistent with solar system tests. This is in striking constrast with the standard metric coupling, which grossly violates post-Newtonian experimental constraints.

  9. Brans-Dicke geometry

    Energy Technology Data Exchange (ETDEWEB)

    Punzi, Raffaele [Zentrum fuer Mathematische Physik und II. Institut fuer Theoretische Physik, Universitaet Hamburg, Luruper Chaussee 149, 22761 Hamburg (Germany)], E-mail: raffaele.punzi@desy.de; Schuller, Frederic P. [Max Planck Institut fuer Gravitationsphysik, Albert Einstein Institut, Am Muehlenberg 1, 14467 Potsdam (Germany)], E-mail: fps@aei.mpg.de; Wohlfarth, Mattias N.R. [Zentrum fuer Mathematische Physik und II. Institut fuer Theoretische Physik, Universitaet Hamburg, Luruper Chaussee 149, 22761 Hamburg (Germany)], E-mail: mattias.wohlfarth@desy.de

    2008-12-11

    We reveal the non-metric geometry underlying {omega}{yields}0 Brans-Dicke theory by unifying the metric and scalar field into a single geometric structure. Taking this structure seriously as the geometry to which matter universally couples, we show that the theory is fully consistent with solar system tests. This is in striking contrast with the standard metric coupling, which grossly violates post-Newtonian experimental constraints.

  10. Louis Dick (1921 - 2014)

    CERN Multimedia

    2014-01-01

    Louis Dick, a CERN experimental physicist of international renown, passed away on 14 July.   Louis in his office, a veritable archaeological wonder with strata of documents corresponding to various eras of physics. Born in Geneva on 27 April 1921, Louis obtained a physics degree at ETH-Zurich in 1946 before moving to the Institut du Radium in Paris, where he joined the group led by Frédéric and Irène Joliot-Curie. He took a leave of absence in 1957 to go to CERN, where he remained until well beyond his retirement in 1986. In the late 1950s and early 1960s, Louis worked at CERN’s Synchrocyclotron (SC) and later on studies at the Proton Synchrotron (PS). When the first polarised proton target arrived at CERN from Saclay in 1963, Louis proposed using it for studies of spin effects in pion-proton elastic scattering at the PS, and between 1964 and 1966 sizeable spin effects were found. Louis and his collaborators then continued these studies wi...

  11. Lovelock-Brans-Dicke gravity

    CERN Document Server

    Tian, David Wenjie

    2016-01-01

    According to Lovelock's theorem, the Hilbert-Einstein and the Lovelock actions are indistinguishable from their field equations. However, they have different scalar-tensor counterparts, which correspond to the Brans-Dicke and the \\emph{Lovelock-Brans-Dicke} (LBD) gravities, respectively. In this paper the LBD model of alternative gravity with the Lagrangian density $\\mathscr{L}_{\\text{LBD}}=\\frac{1}{16\\pi}\\left[\\phi\\left(R+\\frac{a}{\\sqrt{-g}}{}^*RR + b\\mathcal{G}\\right)-\\frac{\\omega_{\\text L}}{\\phi}\

  12. Vanglateenistuse enesekaitsekoolitus / Henri Palm

    Index Scriptorium Estoniae

    Palm, Henri

    2014-01-01

    Vanglateenistus korraldab Tartus, Tallinnas ja Jõhvis enesekaitsekoolitusi gümnaasiumiõpilastele. Jakob Westholmi abiturient Henri Palm on osalenud treeningutel osalenud kolm aastat ning jagab kogemusi

  13. Vanglateenistuse enesekaitsekoolitus / Henri Palm

    Index Scriptorium Estoniae

    Palm, Henri

    2014-01-01

    Vanglateenistus korraldab Tartus, Tallinnas ja Jõhvis enesekaitsekoolitusi gümnaasiumiõpilastele. Jakob Westholmi abiturient Henri Palm on osalenud treeningutel osalenud kolm aastat ning jagab kogemusi

  14. De geurtocht van Marcel Dicke.

    NARCIS (Netherlands)

    Beekman, W.

    1994-01-01

    Interview with Marcel Dicke who is involved in research on the relationship between phytophagous insects and mites, their predators and the host plants. Plants produce attractants, mostly terpenes, to attrack the predators. Possible applications of this mechanism for pest control are discussed

  15. Moby-Dick. [Lesson Plan].

    Science.gov (United States)

    Soderquist, Alisa

    Based on Herman Melville's novel "Moby-Dick," this lesson plan presents activities designed to help students understand that the novel is grounded in facts that Melville acquired in his own experiences at sea; New England was the center of a prospering whaling industry in the 19th century; and journal keeping was not uncommon among 19th-century…

  16. Detecting Multiparticle Entanglement of Dicke States

    DEFF Research Database (Denmark)

    Lücke, Bernd; Peise, Jan; Vitagliano, Giuseppe

    2014-01-01

    of entangled states, including Dicke states. Experimentally, we produce a Dicke-like state using spin dynamics in a Bose-Einstein condensate. Our criterion proves that it contains at least genuine 28-particle entanglement. We infer a generalized squeezing parameter of −11.4(5)  dB....

  17. Brans-Dicke brane cosmology

    CERN Document Server

    Mendes, L E; Mendes, Luis E.; Mazumdar, Anupam

    2001-01-01

    A five dimensional brane cosmology with non-minimally coupled scalar field to gravity has been considered in a Jordan-Brans-Dicke frame. We derive an effective four dimensional field equations on a 3+1 dimensional brane where the fifth dimension has been assumed to have an orbifold symmetry. We have noticed that the evolution equation for the matter component stuck to the brane is non-trivially coupled to the scalar field living on the brane and the bulk. Finally we discuss some cosmological consequences of this set-up.

  18. The universal enveloping TRO of a JB*-triple system

    CERN Document Server

    Bohle, Dennis

    2010-01-01

    We associate to every JB*-triple system a so-called universal enveloping TRO and show some functorial properties of this correspondence. We compute the universal enveloping TROs of the finite dimensional Cartan factors.

  19. Genetic Characterization of Bacillus anthracis 17 JB strain

    Directory of Open Access Journals (Sweden)

    Sakineh Seyed-Mohamadi

    2015-11-01

    Full Text Available Background and Objectives: Bacillus anthracis is one of the most homogenous bacteria ever described. Bacillus anthracis 17JB is a laboratory strain. It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine.Material and Methods: This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping.Results and Conclusion: In SNPs typing, the originally French 17JB strain represented the A. Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.Keywords: Bacillus anthracis 17JB, Genetic characterization, SNPs typing

  20. Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.

    Science.gov (United States)

    Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel

    2013-08-01

    The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.

  1. Organocatalytic Enantioselective Henry Reactions

    Directory of Open Access Journals (Sweden)

    Raquel P. Herrera

    2011-05-01

    Full Text Available A large number of interesting organocatalytic enantioselective protocols have been explored and successfully applied in the last decade. Among them, the Henry (nitroaldol reaction represents a powerful carbon-carbon bond-forming procedure for the preparation of valuable synthetic intermediates, such as enantioenriched nitro alcohols, which can be further transformed in a number of important nitrogen and oxygen-containing compounds. This area of research is still in expansion and a more complex version of this useful process has recently emerged, the domino Michael/Henry protocol, affording highly functionalized cycles with multiple stereogenic centers.

  2. Nicolas-Henri Jardin

    DEFF Research Database (Denmark)

    Kjær, Ulla

    Forskningsbaseret formidling af det samme emne som forfatterens disputats fra 2010: en redegørelse for den franskfødte arkitekt Nicolas-Henri Jardins liv og tid og for hans arbejder i Danmark med særligt henblik på hans afgørende betydning for udviklingen af den danske kunst og arkitektur....

  3. Conformal classes of Brans-Dicke gravity

    CERN Document Server

    Quirós, I

    1999-01-01

    A classification of Brans-Dicke theories of gravitation, based on the behaviour of the dimensionless gravitational coupling constant, is given. It is noted that the discussion takes place in the current literature, about which of the two distinguished conformal frames in which scalar-tensor theories of gravity can be formulated: the Jordan frame and the Einstein frame, is the physical one, may, in most cases, be meaningless for both frames may belong to the same conformal class. It is also noted that the Jordan frame formulation of Brans-Dicke gravity with ordinary matter nonminimally coupled is scale-invariant, unlike the situation with the Jordan frame formulation of Brans-Dicke gravity with matter minimally coupled (the original formulation of Brans-Dicke theory), where the presence of nonzero mass ordinary matter breaks the scale-invariance of the theory.

  4. Quintessence Problem and Brans-Dicke Theory

    OpenAIRE

    Chakraborty, Subenoy; Chakraborty, N. C.; Debnath, Ujjal

    2003-01-01

    It has been shown that Brans-Dicke (BD) theory in anisotropic cosmological model can alone solve the quintessence problem and we have accelerated expanding universe without any quintessence matter. Also the flatness problem has been discussed in this context.

  5. Fermions in Brans-Dicke cosmology

    CERN Document Server

    Samojeden, L L; Kremer, G M

    2010-01-01

    Using the Brans-Dicke theory of gravitation we put under investigation a hypothetical universe filled with a fermionic field (with a self interaction potential) and a matter constituent ruled by a barotropic equation of state. It is shown that the fermionic field (in combination with the Brans-Dicke scalar field could be responsible for a final accelerated era, after an initial matter dominated period.

  6. THE ALTERNATE REALITIES OF PHILIP K. DICK

    OpenAIRE

    Mladen M. Jakovljević

    2012-01-01

    The science fiction of Philip K. Dick examines the issues of authenticity of reality and ontologicalpluralism through unique theories and mechanisms that Dick developed by using his ownunderstanding of alternate realities, time, simulations and cognitive processes, which all play animportant role in the perception of reality. Dick’s fiction describes a search for truth and highlightsthat reality might be fake and that it may be a construct, an illusion among numerous levels of theinauthentici...

  7. Genetic Characterization of Bacillus anthracis 17 JB strain.

    Science.gov (United States)

    Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak

    2015-06-01

    Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.

  8. JB-300: An advanced medium size transport for 2005

    Science.gov (United States)

    Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold

    1993-01-01

    In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.

  9. HENRY'S "HAND OF GOD"

    Directory of Open Access Journals (Sweden)

    Željko Kaluđerović

    2014-04-01

    Full Text Available In this paper the author discusses the views and statements of the French football player Thierry Henry he gave after his illegal play during the playoff match between France and the Republic of Ireland to claim one of the final spots in the World Cup 2010 in South Africa. First, by controlling the ball with his hand before passing it on for the goal Henry has shown disregard for the constitutive rules of football. Then, by stating that he is "not a referee" he demonstrated that for some players rules are not inherent to football and that they can be relativized, given that for them winning is the goal of the highest ontological status. Furthermore, he has rejected the rules of sportsmanship, thus expressing his opinion that the opponents are just obstacles which have to be removed in order to achieve your goals. Henry's action has disrupted major moral values, such as justice, honesty, responsibility and beneficence. The rules of fair play have totally been ignored both in Henry's action and in the Football Association of France's unwillingness to comment on whether a replay should take place. They have ignored one of the basic principles stated in the "Declaration of the International Fair Play Committee", according to which, fair play is much more than playing to the rules of the game; it's about the attitude of the sportsperson. It's about respecting your opponent and preserving his or her physical and psychological integrity. Finally, the author believes that the rules, moral values and fair play in football are required for this game to become actually possible to play.

  10. The complete Brans–Dicke theories

    Energy Technology Data Exchange (ETDEWEB)

    Kofinas, Georgios, E-mail: gkofinas@aegean.gr

    2017-01-15

    Given that the simple wave equation of Brans–Dicke theory for the scalar field is preserved, we have investigated, through exhaustively analyzing the Bianchi identities, the consistent theories which violate the exact energy conservation equation. It is found that only three theories exist which are unambiguously determined from consistency, without imposing arbitrary functions by hand. Each of these theories possesses a specific interaction term which controls the energy exchange between the scalar field and ordinary matter. The theories contain new parameters (integration constants from the integration procedure) and when these are switched-off, Brans–Dicke theory emerges. As usually, the vacuum theories can be defined from the complete Brans–Dicke theories when the matter energy–momentum tensor vanishes.

  11. The complete Brans-Dicke theory

    CERN Document Server

    Kofinas, Georgios

    2015-01-01

    The most general completion of Brans-Dicke gravity is found when energy is exchanged in a uniquely defined way between the scalar field and ordinary matter. The theory contains a new parameter (integration constant from the integration procedure) and when this is switched off, Brans-Dicke theory emerges. As usually, the vacuum theory can be defined from the complete Brans-Dicke theory when the matter energy-momentum tensor vanishes. However, additionally, the complete family of vacuum theories is found, consistent with the free wave equation for the scalar field. The subclass of this family with identically covariantly conserved energy-momentum tensor is identified and, thus, can be supplemented by any equation of motion for the scalar field.

  12. Detecting multiparticle entanglement of Dicke states.

    Science.gov (United States)

    Lücke, Bernd; Peise, Jan; Vitagliano, Giuseppe; Arlt, Jan; Santos, Luis; Tóth, Géza; Klempt, Carsten

    2014-04-18

    Recent experiments demonstrate the production of many thousands of neutral atoms entangled in their spin degrees of freedom. We present a criterion for estimating the amount of entanglement based on a measurement of the global spin. It outperforms previous criteria and applies to a wider class of entangled states, including Dicke states. Experimentally, we produce a Dicke-like state using spin dynamics in a Bose-Einstein condensate. Our criterion proves that it contains at least genuine 28-particle entanglement. We infer a generalized squeezing parameter of -11.4(5)  dB.

  13. Henry Gray, plagiarist.

    Science.gov (United States)

    Richardson, Ruth

    2016-03-01

    The first edition of Anatomy Descriptive and Surgical (1858) was greeted with accolades, but also provoked serious controversy concerning Henry Gray's failure to acknowledge the work of earlier anatomists. A review in the Medical Times (1859) accused Gray of intellectual theft. The journal took the unusual step of substantiating its indictment by publishing twenty parallel texts from Gray and from a pre-existing textbook, Quain's Anatomy. At the recent "Vesalius Continuum" conference in Zakynthos, Greece (2014) Professor Brion Benninger disputed the theft by announcing from the floor the results of a computer analysis of both texts, which he reported exonerated Gray by revealing no evidence of plagiarism. The analysis has not been forthcoming, however, despite requests. Here the historian of Gray's Anatomy supplements the argument set out in the Medical Times 150 years ago with data suggesting unwelcome personality traits in Henry Gray, and demonstrating the utility of others' work to his professional advancement. Fair dealing in the world of anatomy and indeed the genuineness of the lustre of medical fame are important matters, but whether quantitative evidence has anything to add to the discussion concerning Gray's probity can be assessed only if Benninger makes public his computer analysis.

  14. Wormholes in vacuum Brans-Dicke theory

    CERN Document Server

    Bhadra, A; Bhadra, Arunava; Sarkar, Kabita

    2005-01-01

    It is shown that among the different classes of claimed static wormhole solutions of the vacuum Brans-Dicke theory only Brans Class I solution with coupling constant $\\omega$ less than -1.5 (excluding the point $\\omega =2$) gives rise to physically viable traversable wormhole geometry. Usability of this wormhole geometry for interstellar travel has been examined.

  15. Mass Inflation in Brans-Dicke gravity

    CERN Document Server

    Pina-Avelino, P; Herdeiro, C A R

    2009-01-01

    A detailed non-linear analysis of the internal structure of spherical, charged black holes that are accreting scalar matter is performed in the framework of the Brans-Dicke theory of gravity. We choose the lowest value of the Brans-Dicke parameter that is compatible with observational constraints. First, the homogeneous approximation is used. It indicates that mass inflation occurs and that the variations of the Brans-Dicke scalar inside the black hole, which could in principle be large in the absence of mass inflation, become small when mass inflation does occur. Then, a full non-linear numerical study of the black hole interior perturbed by a self-gravitating massless uncharged scalar-field is performed. We use an algorithm with adaptive mesh refinement capabilities. In this way, the changes in the internal structure of the black hole caused by mass inflation are determined, as well as the induced variations of the Brans-Dicke scalar, confirming, qualitatively, the indications given by the homogeneous appro...

  16. Overview of the Moby Dick project

    NARCIS (Netherlands)

    Smit, Gerardus Johannes Maria; Havinga, Paul J.M.; Mullender, Sape J.; Helme, A.; Hartvigsen, Gunnar; Fallmyr, Terje; Stabell-Kulo, Tage; Bartoli, Alberto; Dini, Gianluca; Rizzo, Luigi; Avvenuti, Marco; Seppanen, T.

    The Moby Dick project focuses on developing theories, architectures and applications for a new generation of hand-held computers. The combination of an intelligent information system and a location system enables many new types of applications, such as admission control, digital chequebook, paging,

  17. Joseph Henry and Astronomy

    Science.gov (United States)

    Rothenberg, Marc

    2016-01-01

    Joseph Henry (1797-1878) is best known for his work in electromagnetism and as the first secretary of the Smithsonian Institution. But he was also a pioneer solar physicist, an early advocate of US participation in astrophysics, and a facilitator of international cooperation in astronomy. This paper will briefly trace his role in the development of the US astronomical community from the time he taught astronomy at Princeton in the 1830s through his death, focusing on failed efforts to persuade US astronomers and patrons of astronomy that the best path for US astronomy should be astrophysics. He thought that the US could make a more significant contribution to astronomy science by striking out on a less travelled path rather than competing with the established European observatories.

  18. Ternary Weakly Amenable C*-algebras and JB*-triples

    CERN Document Server

    Ho, Tony; Russo, Bernard

    2012-01-01

    A well known result of Haagerup from 1983 states that every C*-algebra A is weakly amenable, that is, every (associative) derivation from A into its dual is inner. A Banach algebra B is said to be ternary weakly amenable if every continuous Jordan triple derivation from B into its dual is inner. We show that commutative C*-algebras are ternary weakly amenable, but that B(H) and K(H) are not, unless H is finite dimensional. More generally, we inaugurate the study of weak amenability for Jordan Banach triples, focussing on commutative JB*-triples and some Cartan factors.

  19. Third Quantization of Brans-Dicke Cosmology

    CERN Document Server

    Pimentel, L O; Pimentel, Luis O.; Mora, Cesar

    2001-01-01

    We study the third quantization of a Brans-Dicke toy model, we calculate the number density of the universes created from nothing and found that it has a Planckian form. Also, we calculated the uncertainty relation for this model by means of functional Schr"odinger equation and we found that fluctuations of the third-quantized universe field tends to a finite limit in the course of cosmic expansion.

  20. Generalized Mattig's relation in Brans-Dicke-Rastall gravity

    CERN Document Server

    Salako, Ines G; Jawad, Abdul

    2016-01-01

    The Geodesic Deviation Equation is being studied in Brans-Dicke-Rastall gravity. We briefly discuss the Brans-Dicke-Rastall gravity and then construct GDE for FLRW metric. In this way, the obtained geodesic deviation equation will correspond to the Brans-Dicke-Rastall gravity. Eventually, we solve numerically the null vector GDE to obtain from Mattig relation, the deviation vector $\\eta(z)$ and observer area distance $r_0(z)$ and compare the results with $\\Lambda$CDM model.

  1. Numerical Modeling on the Accelerated Aging of JB-9014 Explosive%JB-9014炸药加速老化模拟研究

    Institute of Scientific and Technical Information of China (English)

    高大元; 何松伟; 周建华; 鲁斌

    2009-01-01

    为了解老化对JB-9014炸药爆轰性能的影响,分析了JB-9014炸药加速老化的机理和效应.由JB-9014炸药在升温速率分别为5 K/min、10 K/min、20 K/min的热重曲线,用Ozawa公式和反应深度计算JB-9014炸药的热分解活化能、指前因子,机理函数和动力学方程.根据推导的动力学方程计算了JB-9014炸药在70℃、75℃加速老化过程中不同反应深度的密度、组成和生成热.进而通过VLWR爆轰程序计算JB-9014炸药的爆轰参数.研究结果表明,JB-9014炸药经过加速老化后,当密度减少时,爆速和爆压均有所降低.

  2. Moby Dick, het ontwerp van een Digitale Kameraad

    NARCIS (Netherlands)

    Havinga, Paul J.M.; Smit, Gerard J.M.

    2000-01-01

    Zullen de zaktelefoon en de mobiele computer uitgroeien tot een Digitale Kameraad waarmee je betaalt, de voordeur opent, jezelf identificeert en luistert naar muziek tijdens het joggen? Dit is een vraag waar het MOBY DICK project zich mee bezig houdt. In het MOBY DICK project van het cluster Embedde

  3. What We Talk around when We Talk about "The Dick"

    Science.gov (United States)

    Savage, Elizabeth

    2011-01-01

    Some years ago, the author had her first opportunity to teach an undergraduate American Romanticism course, which meant she had a chance to teach "Moby-Dick" the way she thought it should be taught. Meeting two days a week, her course was set up so that students read about thirty pages of "Moby-Dick" for one class meeting a week paired with…

  4. What We Talk around when We Talk about "The Dick"

    Science.gov (United States)

    Savage, Elizabeth

    2011-01-01

    Some years ago, the author had her first opportunity to teach an undergraduate American Romanticism course, which meant she had a chance to teach "Moby-Dick" the way she thought it should be taught. Meeting two days a week, her course was set up so that students read about thirty pages of "Moby-Dick" for one class meeting a week paired with…

  5. Euclidean non-vacuum wormholes in Brans-Dicke theory

    Institute of Scientific and Technical Information of China (English)

    Lu Hui-Qing; Ji Pei-Yong; Pan Peng-Peng

    2004-01-01

    The Brans-Dicke theory is investigated in which the Pauli metric is identified to be a physical spacetime metric.The solutions of a wormhole are obtained in Brans-Dicke theory with a relativistic radiation field for ω> -3/2.However, it is found that one cannot construct a wormhole in the presence of a 3-form axion field.

  6. Henry David Thoreau's Spiritual World

    Institute of Scientific and Technical Information of China (English)

    马云

    2013-01-01

    Henry David Thoreau was wholeheartedly in love with nature and he devoted almost all his life time to observation, appreciation and study of nature. Thus he formed a deep understanding of nature. In 1845, Thoreau began a two-year and two-month residence at Walden Pond. His life was lonely but full of fragrance. He wanted to live meaningfully, confront the essential facts of life and live a simple life. Based on the review of the literature related to this topic, this paper aims to study Henry David Thoreau’s spiritual world, especially reflected in his famous book-Walden.

  7. Solar Oblateness from Archimedes to Dicke

    CERN Document Server

    Sigismondi, C; Sigismondi, Costantino; Oliva, Pietro

    2005-01-01

    The non-spherical shape of the Sun has been invoked to explain the anomalous precession of Mercury. A brief history of some methods for measuring solar diameter is presented. Archimedes was the first to give upper and lower values for solar diameter in third century before Christ; we also show the method of total eclipses, used after Halley's observative campaign of 1715 eclipse; the variant of partial eclipses useful to measure different chords of the solar disk; the method of Dicke which correlates oblateness with luminous excess in the equatorial zone.

  8. Functional methods in the generalized Dicke model

    Energy Technology Data Exchange (ETDEWEB)

    Alcalde, M. Aparicio; Lemos, A.L.L. de; Svaiter, N.F. [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil)]. E-mails: aparicio@cbpf.br; aluis@cbpf.br; nfuxsvai@cbpf.br

    2007-07-01

    The Dicke model describes an ensemble of N identical two-level atoms (qubits) coupled to a single quantized mode of a bosonic field. The fermion Dicke model should be obtained by changing the atomic pseudo-spin operators by a linear combination of Fermi operators. The generalized fermion Dicke model is defined introducing different coupling constants between the single mode of the bosonic field and the reservoir, g{sub 1} and g{sub 2} for rotating and counter-rotating terms respectively. In the limit N -> {infinity}, the thermodynamic of the fermion Dicke model can be analyzed using the path integral approach with functional method. The system exhibits a second order phase transition from normal to superradiance at some critical temperature with the presence of a condensate. We evaluate the critical transition temperature and present the spectrum of the collective bosonic excitations for the general case (g{sub 1} {ne} 0 and g{sub 2} {ne} 0). There is quantum critical behavior when the coupling constants g{sub 1} and g{sub 2} satisfy g{sub 1} + g{sub 2}=({omega}{sub 0} {omega}){sup 1/2}, where {omega}{sub 0} is the frequency of the mode of the field and {omega} is the energy gap between energy eigenstates of the qubits. Two particular situations are analyzed. First, we present the spectrum of the collective bosonic excitations, in the case g{sub 1} {ne} 0 and g{sub 2} {ne} 0, recovering the well known results. Second, the case g{sub 1} {ne} 0 and g{sub 2} {ne} 0 is studied. In this last case, it is possible to have a super radiant phase when only virtual processes are introduced in the interaction Hamiltonian. Here also appears a quantum phase transition at the critical coupling g{sub 2} ({omega}{sub 0} {omega}){sup 1/2}, and for larger values for the critical coupling, the system enter in this super radiant phase with a Goldstone mode. (author)

  9. Dynamical symmetries in Brans-Dicke cosmology

    CERN Document Server

    Papagiannopoulos, G; Basilakos, S; Giacomini, A; Paliathanasis, A

    2016-01-01

    In the context of generalised Brans-Dicke cosmology we use the Killing tensors of the minisuperspace in order to determine the unspecified potential of a scalar-tensor gravity theory. Specifically, based on the existence of contact symmetries of the field equations, we find four types of potentials which provide exactly integrable dynamical systems. We investigate the dynamical properties of these potentials by using a critical point analysis and we find solutions which lead to cosmic acceleration and under specific conditions we can have de-Sitter points as stable late-time attractors.

  10. The Symbolism in the Moby Dick

    Institute of Scientific and Technical Information of China (English)

    孙婷

    2012-01-01

    Moby Dick,written by Herman Melville,is considered to be one of the greatest American Novels and a treasure of world literature.In this book,Melville uses a lot of symbols.If the readers do not understand the symbolism of this book,they will have many difficulties to grasp the complex theme of it.Here,I'd like to analyze the symbolism of the some main characters and objects,simply to help readers understand the themes:the concepts of class and social status,good and evil,the existence of God and the struggl...

  11. Gravitation and the earth sciences: the contributions of Robert Dicke

    CERN Document Server

    Kragh, Helge

    2015-01-01

    The American physicist Robert Dicke (1916-1997) is primarily known for his important contributions to gravitation, cosmology, and microwave physics. Much less known is his work in geophysics and related areas of the earth sciences in which he engaged himself and several of his collaborators in the period from about 1957 to 1969. Much of Dicke's work in geophysics was motivated by his wish to obtain evidence in support of the non-Einstenian Brans-Dicke theory of gravitation. The idea of a decreasing gravitational constant, as entertained by Dicke and some other physicists (including Pascual Jordan), played some role in the process that transformed the static picture of the Earth to a dynamical picture. It is not by accident that Dicke appears as a minor actor in histories of the plate tectonic revolution in the 1960s.

  12. Generation and classification of robust remote symmetric Dicke states

    Institute of Scientific and Technical Information of China (English)

    Zhu Yan-Wu; Gao Ke-Lin

    2008-01-01

    In this paper,we present an approach to generating arbitrary symmetric Dicke states with distant trapped ions and linear optics.Distant trapped ions can be prepared in the symmetric Dicke states by using two photon-number-resolving detectors and a polarization beam splitter.The atomic symmetric Dicke states are robust against decoherence,for atoms are in a metastable level.We discuss the experimental feasibility of our scheme with current technology.Finally,we discuss the classification of arbitrary n-qubit symmetric Dicke states under statistical local operation and classical communication and prove the existence of[n/2]inequivalent classes of genuine entanglement of n-qubit symmetric Dicke states.

  13. Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; San Román, L

    1998-02-01

    1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.

  14. JB-9322, a new selective histamine H2-receptor antagonist with potent gastric mucosal protective properties.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; Román, L S

    1995-05-01

    1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.

  15. Homotopes of JB*-triples and a Russo—Dye Theorem

    OpenAIRE

    Mackey, Michael

    2009-01-01

    In this note, we look at homotopes of Jordan triple structures and show that, following a renorming, an isotope of a JB*-triple is also a JB*-triple. We also provide a proof of the Russo—Dye theorem for JBW*-triples.

  16. O legado de Henry Kissinger

    OpenAIRE

    PAULO ROBERTO DE ALMEIDA

    2010-01-01

    O presente artigo busca analisar criticamente a importância e o legado do ex-secretário de Estado e ex-Conselheiro de Segurança Internacional dos EUA Henry Kissinger, figura emblemática e multifacetada.

  17. O legado de Henry Kissinger

    Directory of Open Access Journals (Sweden)

    PAULO ROBERTO DE ALMEIDA

    2010-10-01

    Full Text Available O presente artigo busca analisar criticamente a importância e o legado do ex-secretário de Estado e ex-Conselheiro de Segurança Internacional dos EUA Henry Kissinger, figura emblemática e multifacetada.

  18. The Right Fit for Henry

    Science.gov (United States)

    Gould, J. Christine; Staff, Linda K.; Theiss, Heather M.

    2012-01-01

    When Henry was enrolled in a gifted program in 3rd grade, he showed many of the classic signs of giftedness, but his reading and writing skills were below grade level. An evaluation revealed that he was twice-exceptional--he was gifted and he had a learning disability. Believing that both his giftedness and his learning disability warranted…

  19. The Right Fit for Henry

    Science.gov (United States)

    Gould, J. Christine; Staff, Linda K.; Theiss, Heather M.

    2012-01-01

    When Henry was enrolled in a gifted program in 3rd grade, he showed many of the classic signs of giftedness, but his reading and writing skills were below grade level. An evaluation revealed that he was twice-exceptional--he was gifted and he had a learning disability. Believing that both his giftedness and his learning disability warranted…

  20. Josh Billings (Henry Wheeler Shaw).

    Science.gov (United States)

    Kesterson, David B.

    Designed for use by the general reader, the college student, and the teacher, this book analyzes the life and literary career of Josh Billings (Henry Wheeler Shaw), emphasizing his literary ventures and artistic talents. The analysis reveals Billings' talents as a subtle humorist, homespun philosopher, and artist of the essay. Chapters include…

  1. Võidukad kuningad "Henry" ja "Cymbeline"

    Index Scriptorium Estoniae

    2001-01-01

    VAT Teatri Shakespeare'i lavastused "Henry V" ja "Cymbeline" (lavastaja Rein Agur) on leidnud rahvusvahelist tunnustust. USA teatriväljaandes "Shakespeare Bulletin" (2001, Vol. 19, No. 1, Winter) ilmus Maris Pähni artikkel. "Cymbeline" esines menukalt ka Lätis Daugavpilsis toimunud rahvusvahelisel teatrifestivalil

  2. [The Henry E. Huntington Library.

    Science.gov (United States)

    Abraham, Terry

    The biographical sketch of Henry E. Huntington includes a description of the establishment of the Huntington Library and the purpose and scope of its collection. Although this is a free and public library, its use is restricted to qualified scholars having legitimate research needs. Photographic techniques were developed at the Huntington Library…

  3. Joseph Henry and the Telegraph

    Science.gov (United States)

    Hochfelder, David

    1997-04-01

    Morse's telegraph rested upon three scientific advances which occured between 1800 and 1830: the development of battery technology, the formulation of laws governing the behavior of electrical components in circuits, and the discovery of electromagnetic phenomena. Joseph Henry was crucial to the development of the early telegraph. His work on electromagnetism made it possible for the electric current to manifest itself as useful mechanical work. Henry developed electromagnets of sufficient lifting power, but which drew relatively small currents; these magnets were the heart of Morse's telegraph receiver. Morse also used electromagnets as relays, which allowed him to transmit signals over great distances. Morse often acknowledged his debt to Henry, and the two enjoyed a cordial working relationship until the mid-1840s. But during the bitter and protracted litigation over Morse's patent, Henry testified (unwillingly, he claimed) against the inventor. This began a lifelong quarrel between the two men, the specifics of which were tedious and petty. In general terms, however, their conflict arose over different notions regarding scientific discovery and technological innovation.

  4. On the Geometry of the Unit Ball of a JB*-Triple

    Directory of Open Access Journals (Sweden)

    Haifa M. Tahlawi

    2013-01-01

    Full Text Available We explore a JB*-triple analogue of the notion of quasi invertible elements, originally studied by Brown and Pedersen in the setting of C*-algebras. This class of BP-quasi invertible elements properly includes all invertible elements and all extreme points of the unit ball and is properly included in von Neumann regular elements in a JB*-triple; this indicates their structural richness. We initiate a study of the unit ball of a JB*-triple investigating some structural properties of the BP-quasi invertible elements; here and in sequent papers, we show that various results on unitary convex decompositions and regular approximations can be extended to the setting of BP-quasi invertible elements. Some C*-algebra and JB*-algebra results, due to Kadison and Pedersen, Rørdam, Brown, Wright and Youngson, and Siddiqui, including the Russo-Dye theorem, are extended to JB*-triples.

  5. Composite vacuum Brans-Dicke wormholes

    CERN Document Server

    Sushkov, Sergey V

    2011-01-01

    We construct a new static spherically symmetric configuration composed of interior and exterior Brans-Dicke vacua matched at a thin matter shell. Both vacua correspond to the same Brans-Dicke coupling parameter $\\omega$, however they are described by the Brans class I solution with different sets of parameters of integration. In particular, the exterior vacuum solution has $C_{ext}(\\omega)\\equiv 0$. In this case the Brans class I solution for any $\\omega$ reduces to the Schwarzschild one being consistent with restrictions on the post-Newtonian parameters following from recent Cassini data. The interior region possesses a strong gravitational field, and so the interior vacuum solution has $C_{int}(\\omega)=-1/(\\omega+2)$. In this case the Brans class I solution describes a wormhole spacetime provided $\\omega$ lies in the narrow interval $-2-\\frac{\\sqrt{3}}{3}<\\omega<-2$. The interior and exterior regions are matched at a thin shell made from an ordinary perfect fluid with positive energy density and press...

  6. On the Chameleon Brans-Dicke Cosmology

    CERN Document Server

    Bisabr, Yousef

    2012-01-01

    We consider a generalized Brans-Dicke model in which the scalar field has a potential function and is also allowed to couple non-minimally with the matter sector. We assume a power law form for the potential and the coupling functions as the inputs of the model and show that acceleration of the universe can be realized for a constrained range of exponent of the potential function. We also argue that this accelerating phase is consistent with a large and positive Brans-Dicke parameter. In our analysis, the potential plays a more important role with respect to the coupling function in dynamics of the universe as the latter does not contribute to any of the relations characterizing evolution of scale factor of the universe and the scalar field. However, we will show that the coupling function is closely related to magnitude and direction of the energy transfer between matter and the scale field. We use this fact and some thermodynamic aspects of the model to put some constraints on the coupling function. In part...

  7. JB/T 6381.1~6381.4-2007标准介绍%Interpretation of JB/T 6381.1~6381.4-2007

    Institute of Scientific and Technical Information of China (English)

    薛婧

    2008-01-01

    @@ 1 概述 由中国机械工业联合会提出,机械工业冶金设备标准化技术委员会归口,西安重型机械研究所负责起草的JB/T 6381.1-2007、JB/T 6381.2-2007、JB/T 6381.3-2007和JB/T 6381.4-2007已于2007年3月6日发布,2007年9月1日实施,相应的JB/T 6381.1-1992、JB/T 6381.2-1992、JB/T 6381.3-1992和JB/T 6381.4-1992四项标准作废.

  8. Interpretation of JB/T 6382.1~6382.4-2007%JB/T 6382.1~6382.4-2007标准介绍

    Institute of Scientific and Technical Information of China (English)

    王曼宁

    2008-01-01

    @@ 1 概述 由中国机械工业联合会提出,机械工业冶金设备标准化技术委员会归口,西安重型机械研究所负责起草的JB/T 6382.1-2007、JB/T 6382.2-2007、JB/T 6382.3-2007和JB/T 6382.4-2007已于2007年3月6日发布,2007年9月1日实施,相应的JB/T 6382.1-1992、JB/T 6382.2-1992、JB/T 6382.3-1992和JB/T 6382.4-1992四项标准作废.

  9. Critical behavior in the Brans-Dicke theory of gravitation

    CERN Document Server

    Chiba, T; Chiba, Takeshi; Soda, Jiro

    1996-01-01

    The collapse of a massless scalar field in the Brans-Dicke theory of gravitation is studied in the analysis of both analytical solution and numerical one. By conformally transforming the Roberts's solution into the Brans-Dicke frame, we find for \\omega > -3/2 that a continuous self-similarity continues and that the critical exponent does depend on \\omega. By conformally transforming the Choptuik's solution into the Brans-Dicke frame, we find for \\omega > -3/2 that at the critical solution shows discrete self-similarity, however, the critical exponent depends strongly on \\omega while the echoing parameter weakly on it.

  10. Jordan-Brans-Dicke stochastic inflation

    CERN Document Server

    García-Bellido, J

    1994-01-01

    We study stochastic inflation in the presence of a dynamical gravitational constant. We describe the Arnowitt--Deser--Misner formalism for Jordan--Brans--Dicke theory of gravity with an inflaton field. The inflaton and dilaton scalar fields can be separated into coarse-grained background fields and quantum fluctuations. We compute the amplitude of the perturbations generated by those quantum fluctuations in JBD theory with an arbitrary potential for the inflaton field. The effect of the quantum fluctuations on the background fields is equivalent to a Brownian motion of the scalar fields, which can be described with the use of a Fokker--Planck diffusion equation. The probability to find a given value of the fields in the comoving frame can be written as a Gaussian distribution centered on their classical trajectory, with decreasing dispersion along both field directions. We also calculate the condition for the Universe to enter a self-regenerating inflationary phase. The probability distribution in the physica...

  11. Optimized entanglement witnesses for Dicke states

    Energy Technology Data Exchange (ETDEWEB)

    Bergmann, Marcel; Guehne, Otfried [Naturwissenschaftlich-Technische Fakultaet, Universitaet Siegen, Department Physik, Walter-Flex-Strasse 3, D-57068 Siegen (Germany)

    2013-07-01

    Quantum entanglement is an important resource for applications in quantum information processing like quantum teleportation and cryptography. Moreover, the number of particles that can be entangled experimentally using polarized photons or ion traps has been significantly enlarged. Therefore, criteria to decide the question whether a given multi-particle state is entangled or not have to be improved. Our approach to this problem uses the notion of PPT mixtures which form an approximation to the set of bi-separable states. With this method, entanglement witnesses can be obtained in a natural manner via linear semi-definite programming. In our contribution, we will present analytical results for entanglement witnesses for Dicke states. This allows to overcome the limitations of convex optimization.

  12. Henry Morgenthau's voice in history.

    Science.gov (United States)

    Steiner, Pamela

    2015-01-01

    Henry Morgenthau (1856-1946) distinguished himself as the U.S. Ambassador to the Ottoman Empire, 1913-1916, and as the chairman of the League of Nations Refugee Settlement Commission (RSC) for Greece, 1923-24. I describe aspects of his early life that shaped the man he became, his accomplishments in these two posts, and his feelings about himself over time. At the end I briefly describe his attitude toward a possible Jewish state in Palestine.

  13. JB-9014炸药热损伤及其表征

    Institute of Scientific and Technical Information of China (English)

    李志鹏; 龙新平; 黄毅民; 王蓉; 何松伟; 颜熹琳

    2005-01-01

    200℃高温条件下恒温2h,对JB-9014炸药进行了热损伤模拟实验。用光学显微镜以及超声波检测等手段,对JB-9014炸药的损伤程度进行了表征分析。结果表明:热损伤后JB-9014炸药样品的表面以及内部出现了裂纹和孔隙。

  14. Generalized Brans-Dicke inflation with a quartic potential

    CERN Document Server

    Tahmasebzadeh, Behzad

    2016-01-01

    Within the framework of Brans-Dicke gravity, we investigate inflation with a quartic potential, $\\lambda\\varphi^4/4$, in the presence of generalized Brans-Dicke parameter $\\omega_{\\rm GBD}(\\varphi)$. We obtain the inflationary observables containing the scalar spectral index, the tensor-to-scalar ratio, the running of the scalar spectral index and the equilateral non-Gaussianity parameter in terms of general form of the potential $U(\\varphi)$ and $\\omega_{\\rm GBD}(\\varphi)$. For the quartic potential, our results show that the predictions of the model are in well agreement with the Planck 2015 data for the generalized Brans-Dicke parameters $\\omega_{\\rm GBD}(\\varphi)=\\omega_0\\varphi^{n}$ and $\\omega_0e^{b\\varphi}$. This is in contrast with both the Einstein and standard Brans-Dicke gravity, in which the result of quartic potential is disfavored by the Planck data.

  15. Herman Melville’s Nature Views in Moby Dick

    Institute of Scientific and Technical Information of China (English)

    Sun Gengmei; Yao Kun

    2015-01-01

    In Moby Dick, Melvil e presents his basic idea of nature view. Human beings are capable of improving their living environment, but can not overcome nature. Man lives under the mercy of nature, and is destined to doom.

  16. Data of evolutionary structure change: 1A4JB-3FCTD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4JB-3FCTD 1A4J 3FCT B D QVQLLESGPELKKPGETVKISCKASGYTFTNYGMNWVKQ...SCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRD-...HHHH EEEEEEE EEEEEEE 0 3FCT... D 3FCTD CT...RRD-----MDYWG ure>EEE ----- ure> AT

  17. Employment of synchronized cells and flow microfluorometry in investigations on the JB-1 ascites tumour chalones.

    Science.gov (United States)

    Bichel, P; Barfod, N M; Jakobsen, A

    1975-11-01

    In most experimental ascites tumours the growth rate decreases with increasing age and cell number. This decrease is caused by a prolongation of the cell cycle and an increasing accumulation of non-cycling cells in resting (or quiescent) G1 and G2 compartments. In cell-free ascitic fluid from the JB-1 ascites tumour in the plateau phase of growth lowmolecular-weight substances have been found which reversibly and specifically arrest JB-1 cells in G1 and G2. The present paper describes an in-vitro model for testing the effect of the humoral growth inhibitors contained in the ascitic fluid. The test system is based on synchronized JB-1 cells analysed by flow-through cytofluorometry. Addition to the synchronous cells of a ultrafiltrate (less than 50000 Daltons) of the JB-1 ascitic fluid was found to induce a complete, but temporary arrest of the cells at the G1-S border.

  18. Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.

    Science.gov (United States)

    Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K

    2010-09-01

    A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area

  19. Treatment for Fracture of Thoracolumbar Vertebrae with Dick Nail%Dick 钉治疗胸腰椎骨折

    Institute of Scientific and Technical Information of China (English)

    王法; 马昕; 谢爱国; 丁海蛟

    2001-01-01

    目的探讨 Dick 钉治疗胸、腰椎骨折的疗效。方法应用 Dick 钉治疗胸、腰椎骨折 40 例(伴有神经损伤 13 例)。结果椎体前缘高度由术前的 50.7 % 恢复至术后的 82.6 %,中柱突入椎管内程度由术前的 30.0 % 下降至术后的 7.6 %,神经功能和疼痛程度也有不同程度的恢复。结论 Dick 钉是治疗胸、腰椎骨折的有效方法之一。%Objective To explore the therapeutic effect of dick nail in treatment of fracture of thoracolumbar vertebrae.Methods Dick nails were used in the treatment of 40 such cases (13 cases with nervous injury).Results The height of anterior margin of vertebral body was restored from 50.7%(preoperation) to 82.6%(postoperation).The degree for the middle spine to project into the vertebral canal was reduced from 30.0%(preoperation) to 7.6%(postopeation)with nervous function recovered and pain relieved.Conclusion Dick nail is one of the effective methods for treatment of fracture of thoracolumbar vertebrae.

  20. Henry's law constants of polyols

    Directory of Open Access Journals (Sweden)

    S. Compernolle

    2014-05-01

    Full Text Available Henry's law constants (HLC are derived for several polyols bearing between 2 and 6 hydroxyl groups, based on literature data for water activity, vapour pressure and/or solubility. Depending on the case, infinite dilution activity coefficients (IDACs, solid state pressures or activity coefficient ratios are obtained as intermediary results. For most compounds, these are the first values reported, while others compare favourably with literature data in most cases. Using these values and those from a previous work (Compernolle and Müller, 2014, an assessment is made on the partitioning of polyols, diacids and hydroxy acids to droplet and aqueous aerosol.

  1. Cosmological constraint on Brans-Dicke Model

    CERN Document Server

    Li, Ji-Xia; Li, Yi-Chao; Gong, Yan; Chen, Xue-Lei

    2015-01-01

    We combine new Cosmic Microwave Background (CMB) data from Planck with Baryon Acoustic Oscillation (BAO) data to constrain the Brans-Dicke (BD) theory, in which the gravitational constant $G$ evolves with time. Observations of type Ia supernovae (SNeIa) provide another important set of cosmological data, as they may be regarded as standard candles after some empirical corrections. However, in theories that include modified gravity like the BD theory, there is some risk and complication when using the SNIa data because their luminosity may depend on $G$. In this paper, we assume a power law relation between the SNIa luminosity and $G$, but treat the power index as a free parameter. We then test whether the difference in distances measured with SNIa data and BAO data can be reduced in such a model. We also constrain the BD theory and cosmological parameters by making a global fit with the CMB, BAO and SNIa data set. For the CMB+BAO+SNIa data set, we find $0.08\\times10^{-2} < \\zeta <0.33\\times10^{-2} $ at ...

  2. Endoscopic Release of Master Knot of Henry.

    Science.gov (United States)

    Lui, Tun Hing

    2015-12-01

    A post-traumatic partial tear of the flexor hallucis longus tendon at the master knot of Henry and the resultant fibrosis of the knot can result in pain at the medial foot arch or posteromedial ankle pain with trigger hallux. Open debridement of the master knot of Henry is indicated if the symptoms do not improve with nonoperative treatment. The open procedure requires extensive soft-tissue dissection because the master knot of Henry is a deep structure. Endoscopic release of the master knot of Henry is an alternative to the open procedure and has the advantage of less surgical trauma and potential for less chance of recurrence of fibrosis of the master knot of Henry.

  3. Conformal relativity versus Brans-Dicke and superstring theories

    CERN Document Server

    Blaschke, D; Blaschke, David; Dabrowski, Mariusz P

    2004-01-01

    Conformal relativity theory which is also known as Hoyle-Narlikar theory has recently been given some new interest. It is an extended relativity theory which is invariant with respect to conformal transformations of the metric. In this paper we show how conformal relativity is related to the Brans-Dicke theory and to the low-energy-effective superstring theory. We show that conformal relativity action is equaivalent to a transformed Brans-Dicke action for Brans-Dicke parameter $\\omega = -3/2$ in contrast to a reduced (graviton-dilaton) low-energy-effective superstring action which corresponds to a Brans-Dicke action with Brans-Dicke parameter $\\omega = -1$. We also present basic cosmological solutions of conformal relativity in both Einstein and string frames. The Eintein limit for flat conformal cosmology solutions is unique and it is flat Minkowski space. This requires the scalar field/mass evolution instead of the scale factor evolution in order to explain cosmological redshift. It is interesting that like...

  4. Dick Jewell’s Found Photos

    Directory of Open Access Journals (Sweden)

    Ian Walker

    2010-12-01

    Full Text Available

    Abstract (E:

    In 1977, the young British artist Dick Jewell self-published a small book Found Photos, a collection of photobooth images that had been thrown away or torn up by the people in the photos. This essay places that book in the context of the development of interest in vernacular photography during the 1970s, and relates it to other projects using pictures made in photobooths, both before and since.

     

    Abstract (F:

    Psychoactive bacteria Lactobacillus rhamnosus (JB-1) elicits rapid frequency facilitation in vagal afferents.

    Science.gov (United States)

    Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang

    2013-01-15

    Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.

  5. Specific chalone inhibition of the regeneration of the JB-1 ascites tumour studied by flow microfluorometry.

    Science.gov (United States)

    Bichel, P; Barfod, N M

    1977-03-01

    The variation in the DNA distribution in the JB-1 and the Lla2 ascites tumour was investigated by means of flow microfluorometry (FMF) in the plateau stage and during the initiation of the regenerative growth induced by percutaneous aspiration. The study showed that a considerable influx of cells with G1DNA content into the S phase occurred in both tumours about 10 hr after aspiration. In the JB-1 tumour, these initial regenerative changes could be reversibly blocked by injections of cell-free plateau JB-1 ascitic fluid or an ultrafiltrate of this ascites. In contrast to these observations no delay in the regenerative changes was observed in the L1a2 tumour after treatment with JB-1 ascites or the ultrafiltrate. The study supports the assumption of a specific growth regulation of the JB-1 ascites tumour and emphasizes the suitability of FMF analyses in cell-kinetic studies in which short-term fluctuations take place in the distribution of cells with different DNA content.

  6. Aspects of a supersymmetric Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Catena, R.

    2006-11-15

    We consider a locally supersymmetric theory where the Planck mass is replaced by a dynamical superfield. This model can be thought of as the Minimal Supersymmetric extension of the Brans-Dicke theory (MSBD). The motivation that underlies this analysis is the research of possible connections between Dark Energy models based on Brans-Dicke-like theories and supersymmetric Dark Matter scenarios. We find that the phenomenology associated with the MSBD model is very different compared to the one of the original Brans-Dicke theory: the new scalar and fermionic degrees of freedom do not couple to matter in a universal metric way, i.e. they can not be removed from the matter sector by a Weyl rescaling of the metric. This feature could make the minimal supersymmetric extension of the BD idea phenomenologically inconsistent. (orig.)

  7. On Stationary Axially Symmetric Solutions in Brans-Dicke Theory

    CERN Document Server

    Kirezli, Pınar

    2015-01-01

    Stationary axially symmetric Brans-Dicke-Maxwell solutions are re-examined in the framework of the Brans-Dicke theory. We see that, employing a particular parametrization of the standard axially symmetric metric simplifies the procedure of obtaining the Ernst equations for axially symmetric electro-vacuum space-times for this theory. This analysis also permit us to construct a two parameter extension in both Jordan and Einstein frames of an old solution generating technique frequently used to construct axially symmetric solutions for Brans-Dicke theory from a seed solution of General Relativity. As applications of this technique, several known and new solutions are constructed including a general axially symmetric BD-Maxwell solution of Plebanski-Demianski with vanishing cosmological constant, i.e. the Kinnersley solution and general magnetized Kerr-Newman type solutions. Some physical properties and circular motion of test particles for a particular subclass of Kinnersley solution, i.e. Kerr-Newman-NUT type ...

  8. Relationship between Humans and Nature in Melville's Moby Dick

    Institute of Scientific and Technical Information of China (English)

    余奕汶

    2015-01-01

    Herman Melville,with Moby Dick as his masterpiece,is a famous romantic writer.Moby Dick is a"bright pearl" in the literary treasury of the world.By allegorically depicting the cruel killing of whales by the Captain Ahab and other sailors in his whaling ship,and their tragically being drowned in the sea,the writer reveals that if humans are too self-centered,we will inevitably be punished by nature.Start with the three states that humans get along with nature in Moby Dick,my thesis aims at exploring the transformations of the relationship between humans and nature as well as the edification that humans may gain from the tragic story.

  9. Every Tom,Dick and Harry的含义

    Institute of Scientific and Technical Information of China (English)

    霍秀梅

    2013-01-01

    一大早,同事就来抱怨:“我本想办一个小型的私人聚会,没想到老婆把该请的、不该请的全请来了!”如何用英语来表达“该请的和不该请的”?看好了:“Every Tom,Dick and Harry”。这里的“Tom,Dick and Harry”,泛指普通人,但含有蔑视意,特指“非常非常一般、毫无半点建树的普通人”,如:Every Tom,Dick and Harry is qualified to do the job.(这活儿谁都能干!)

  10. New views on classical and quantum Brans-Dicke theory

    CERN Document Server

    Fabris, Júlio C; Rodrigues, Davi C; Almeida, Carla R; Piattella, Oliver F

    2016-01-01

    The Brans-Dicke action is one of the most natural extensions of the Einstein-Hilbert action. It is based on the introduction of a fundamental scalar field that effectively incorporates a dynamics to the gravitational coupling $G$. In spite of the diverse motivations and the rich phenomenology that comes from its solutions, Solar System tests impose strong constraints on the Brans-Dicke theory, rendering it indistinguishable from General Relativity. In the present text, new perspectives for the Brans-Dicke theory are presented, based on the possibility that the scalar field presented in the BD theory can be external, as well as on the applications to black hole physics and the primordial universe.

  11. Conformal Relativity versus Brans–Dicke and Superstring Theories

    Directory of Open Access Journals (Sweden)

    David B. Blaschke

    2012-10-01

    Full Text Available We show how conformal relativity is related to Brans–Dicke theory and to low-energy-effective superstring theory. Conformal relativity or the Hoyle–Narlikar theory is invariant with respect to conformal transformations of the metric. We show that the conformal relativity action is equivalent to the transformed Brans–Dicke action for ω = -3/2 (which is the border between standard scalar field and ghost in contrast to the reduced (graviton-dilaton low-energy-effective superstring action which corresponds to the Brans–Dicke action with ω = -1. We show that like in ekpyrotic/cyclic models, the transition through the singularity in conformal cosmology in the string frame takes place in the weak coupling regime. We also find interesting self-duality and duality relations for the graviton-dilaton actions.

  12. Henry's law constants of polyols

    Directory of Open Access Journals (Sweden)

    S. Compernolle

    2014-12-01

    Full Text Available Henry's law constants (HLC are derived for several polyols bearing between 2 and 6 hydroxyl groups, based on literature data for water activity, vapour pressure and/or solubility. While deriving HLC and depending on the case, also infinite dilution activity coefficients (IDACs, solid state vapour pressures or activity coefficient ratios are obtained as intermediate results. An error analysis on the intermediate quantities and the obtained HLC is included. For most compounds, these are the first values reported, while others compare favourably with literature data in most cases. Using these values and those from a previous work (Compernolle and Müller, 2014, an assessment is made on the partitioning of polyols, diacids and hydroxy acids to droplet and aqueous aerosol.

  13. Level statistics of a pseudo-Hermitian Dicke model.

    Science.gov (United States)

    Deguchi, Tetsuo; Ghosh, Pijush K; Kudo, Kazue

    2009-08-01

    A non-Hermitian operator that is related to its adjoint through a similarity transformation is defined as a pseudo-Hermitian operator. We study the level statistics of a pseudo-Hermitian Dicke Hamiltonian that undergoes quantum phase transition (QPT). We find that the level-spacing distribution of this Hamiltonian near the integrable limit is close to Poisson distribution, while it is Wigner distribution for the ranges of the parameters for which the Hamiltonian is nonintegrable. We show that the assertion in the context of the standard Dicke model that QPT is a precursor to a change in the level statistics is not valid in general.

  14. Pairwise Quantum Correlations for Superpositions of Dicke States

    Institute of Scientific and Technical Information of China (English)

    席政军; 熊恒娜; 李永明; 王晓光

    2012-01-01

    Pairwise correlation is really an important property for multi-qubit states.For the two-qubit X states extracted from Dicke states and their superposition states,we obtain a compact expression of the quantum discord by numerical check.We then apply the expression to discuss the quantum correlation of the reduced two-qubit states of Dicke states and their superpositions,and the results are compared with those obtained by entanglement of formation,which is a quantum entanglement measure.

  15. Holographic Principle of Black Holes in Brans-Dicke Theory

    CERN Document Server

    Chen, C Y; Chen, Chi-Yi; Shen, You-Gen

    2003-01-01

    We consider the general situation of type-I stationary solutions of black holes in Brans-Dicke theory and investigate their statistical entropies by using the brick wall model. Compare with a generalized entropy formula derived from their thermodynamical evolution by Kang, We get the ultimate scenario of black holes entropies in Brans-Dicke theory. For further considering the bound of holographic principle, we obtain a new constraint on parameters in this type solution read as $2Q-\\chi=2$, which corresponds to $\\omega=-{3/2}$.

  16. Negative Correlations and Entanglement in Higher-Spin Dicke States

    Science.gov (United States)

    Wang, Xiaoqian; Zhong, Wei; Wang, Xiaoguang

    2016-10-01

    We consider entanglement criteria based on the spin squeezing inequalities for arbitrary spin systems. Here we use the negative correlations to detect the entanglement in the system with exchange symmetry. For arbitrary spin systems, we can find that the state is entangled, when the minimal pairwise correlation is negative. Then we give a parameter which is defined by the collective angular momentum operator, to detect the entanglement for the Dicke state with N spin -1 particles, and the results are as the same as negative correlation. We also consider the directions of negative correlation, the state is entangled in two orthogonal directions for the superposition of Dicke state without parity.

  17. Inflation and dark energy from the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Artymowski, Michał [Institute of Physics, Jagiellonian UniversityŁojasiewicza 11, 30-348 Kraków (Poland); Lalak, Zygmunt; Lewicki, Marek [Institute of Theoretical Physics, Faculty of Physics, University of Warsawul. Pasteura 5, 02-093 Warszawa (Poland)

    2015-06-17

    We consider the Brans-Dicke theory motivated by the f(R)=R+αR{sup n}−βR{sup 2−n} model to obtain a stable minimum of the Einstein frame scalar potential of the Brans-Dicke field. As a result we have obtained an inflationary scalar potential with non-zero value of residual vacuum energy, which may be a source of dark energy. In addition we discuss the probability of quantum tunnelling from the minimum of the potential. Our results can be easily consistent with PLANCK or BICEP2 data for appropriate choices of the value of n and ω.

  18. The Characters of the Captain Ahab in Moby Dick

    Institute of Scientific and Technical Information of China (English)

    李哲慧

    2013-01-01

    Captain Ahab is a controversy and complicated figure in Moby Dick. The studies of Ahab in the past has become in-creasingly involved various aspects. Ahab is a figure with many faces, among which the most significant and decisive ones are his individualist, arrogance and humanity. He persists in taking revenging on the white whale is quite compatible with such charac-ter. Besides, his fate is also leads to his attachment behavior. In this essay ,I will mainly analyze the fate and characters of Ahab in order to help readers understand Moby Dick better.

  19. Vacuum less global monopole in Brans-Dicke theory

    CERN Document Server

    Rahaman, F; Kalam, M; Mukherjee, R; Roy, T

    2007-01-01

    In the present work, the gravitational field of a vacuum less global monopole has been investigated in Brans-Dicke theory under weak field assumption of the field equations. It has been shown that the vacuum less global monopole exerts attractive gravitational effects on a test particle. It is dissimilar to the case studied in general relativity.

  1. Composite spherically symmetric configurations in Jordan-Brans-Dicke theory

    CERN Document Server

    Kozyrev, S

    2010-01-01

    In this article, a study of the scalar field shells in relativistic spherically symmetric configurations has been performed. We construct the composite solution of Jordan-Brans-Dicke field equation by matching the conformal Brans solutions at each junction surfaces. This approach allows us to associate rigorously with all solutions as a single glued "space", which is a unique differentiable manifold M^4.

  2. Cosmological Evolution of Black Holes in Brans-Dicke Gravity

    CERN Document Server

    Sakai, N; Sakai, Nobuyuki; Barrow, John D.

    2001-01-01

    We consider a modified ``Swiss cheese'' model in Brans-Dicke theory, and use it to discuss the evolution of black holes in an expanding universe. We define the black hole radius by the Misner-Sharp mass and find their exact time evolutions for dust and vacuum universes of all curvatures.

  3. Evolution of Black Holes in Brans-Dicke Cosmology

    CERN Document Server

    Sakai, N; Sakai, Nobuyuki; Barrow, John D.

    2000-01-01

    We consider a modified ``Swiss cheese'' model in the Brans-Dicke theory, and discuss the evolution of black holes in the expanding universe. We define the black hole radius by the Misner-Sharp mass and find the time evolution for dust and vacuum universes.

  4. Cosmological evolution of black holes in Brans-Dicke gravity

    Science.gov (United States)

    Sakai, Nobuyuki; Barrow, John D.

    2001-11-01

    We consider a modified 'Swiss cheese' model in the Brans-Dicke theory and use it to discuss the evolution of black holes in an expanding universe. We define the black hole radius by the Misner-Sharp mass and find the exact time evolutions for dust and vacuum universes of all curvatures.

  5. Brans–Dicke gravity theory from topological gravity

    Energy Technology Data Exchange (ETDEWEB)

    Inostroza, C.; Salazar, A.; Salgado, P.

    2014-06-27

    We consider a model that suggests a mechanism by which the four dimensional Brans–Dicke gravity theory may emerge from the topological gravity action. To achieve this goal, both the Lie algebra and the symmetric invariant tensor that define the topological gravity Lagrangian are constructed by means of the Lie algebra S-expansion procedure with an appropriate abelian semigroup S.

  6. Static Generalized Brans-Dicke Universe and Gravitational Waves Amplification

    CERN Document Server

    Berman, M S; Berman, Marcelo S.; Trevisan, Luis A.

    2001-01-01

    We find a static solution for the scale-factor in a Brans-Dicke generalized theory where the scalar field and the coupling constant vary with time. We find also that in the early Universe there may be amplification of gravitational waves.

  7. Inflationary Phase in a Generalized Brans-Dicke Theory

    Science.gov (United States)

    Berman, Marcelo S.; Trevisan, Luis A.

    2009-07-01

    We find a solution for exponential inflation in a Brans-Dicke generalized model, where the coupling “constant” is variable. While in General Relativity the equation of state is p=- ρ, here we find p= α ρ, where α<-2/3. The negativity of cosmic pressure implies acceleration of the expansion, even with Λ<0.

  8. Minimizing energy consumption for wireless computers in Moby Dick

    NARCIS (Netherlands)

    Havinga, Paul J.M.; Smit, Gerard J.M.

    1997-01-01

    The Moby Dick project is a joint European project to develop and define the architecture of a new generation of mobile hand-held computers, called Pocket Companions. The Pocket Companion is a hand-held device that is resource-poor, i.e. small amount of memory, limited battery life, low processing po

  9. Dynamical squeezing enhancement in the off-resonant Dicke model

    Energy Technology Data Exchange (ETDEWEB)

    Shindo, D; Chavez, A; Chumakov, S M; Klimov, A B [Departamento de FIsica, Universidad de Guadalajara, Revolucion 1500, 44420, Guadalajara, Jalisco (Mexico)

    2004-01-01

    We show that the maximum atomic squeezing that can be achieved in the vacuum off-resonant Dicke model (governed by the effective Hamiltonian {approx} S{sub z}{sup 2}) can be essentially enhanced by applying a sequence of {pi}/2 pulses at certain time moments. The major effect is obtained after the first pulse.

  10. General class of vacuum Brans-Dicke wormholes

    CERN Document Server

    Lobo, Francisco S N

    2010-01-01

    Recently, traversable wormhole geometries were constructed in the context of f(R) gravity. The latter is equivalent to a Brans-Dicke theory with a coupling parameter w=0, which is apparently excluded from the narrow interval, -3/2Dicke theory. However, this latter interval is only valid for a specific choice of an integration constant of the field equations derived on the basis of a post-Newtonian weak field approximation, and there is no reason for it to hold in the presence of compact objects with strong gravitational fields. In this context, we construct a general class of vacuum Brans-Dicke wormholes that include the value of w=0. Furthermore, we present the general condition for the existence of vacuum Brans-Dicke wormhole geometries, and show that the presence of effective negative energy densities is a generic feature of these vacuum solutions.

  11. Minimizing energy consumption for wireless computers in Moby Dick

    NARCIS (Netherlands)

    Havinga, Paul J.M.; Smit, Gerardus Johannes Maria

    1997-01-01

    The Moby Dick project is a joint European project to develop and define the architecture of a new generation of mobile hand-held computers, called Pocket Companions. The Pocket Companion is a hand-held device that is resource-poor, i.e. small amount of memory, limited battery life, low processing

  12. Author! Author! The Gallant Children's Author: Dick King-Smith

    Science.gov (United States)

    Brodie, Carolyn S.

    2005-01-01

    This column presents a brief biography of Dick King-Smith. Born on March 27, 1922 and raised in Gloucestershire, England, he grew up with animals of all kinds. King-Smith was a farmer for twenty years and then became a school teacher. He was also a soldier during wartime, a traveling salesman, shoe factory worker, and television presenter. He…

  13. Ahab——The main Character in Moby-dick

    Institute of Scientific and Technical Information of China (English)

    佟玉平

    2007-01-01

    Herman Melville is not only a great Romanticist in the American literary history but also an influential figure in the world.Moby--dick,which was published in 1851,is his representative work..This thesis focus on the analysis of the character of the hero--the captain Ahab from three aspects:his pride,his madness,his humanity.

  14. Using Herman Melville's "Moby-Dick" to Explore Geographic Themes

    Science.gov (United States)

    Gesler, Wil

    2004-01-01

    The classic American novel, Herman Melville's "Moby-Dick", can be used in geography and English classes at the high school and college levels to explore five themes that have a geographic component or are of interest to geography students: (1) the journey, (2) human/environment interactions, (3) social relationships in space, (4) acquiring…

  15. The Dick and Carey Model: Will It Survive the Decade?

    Science.gov (United States)

    Dick, Walter

    1996-01-01

    Reviews changes in the original Dick and Carey model of instructional design and considers its future usefulness. Topics include alternative instructional design textbooks, the influence of constructivist theory on the 1996 version of the model with its systems approach, and the influence of constructivist and objectivist models. (Author/LRW)

  16. Obituary: Henry Emil Kandrup, 1955-2003

    Science.gov (United States)

    Merritt, David; Gottesman, Stephen T.

    2004-12-01

    Henry Emil Kandrup died on 18 October 2003 at his home in Gainesville Florida. Henry was a theoretical astrophysicist specializing in the application of chaotic dynamics to stellar systems. At the time of his death, Henry was a Professor at the University of Florida where he had taught for 13 years. Henry was born in Manhasset, New York on July 24, 1955 and spent most of his childhood in Great Neck. His parents, Jytte and Fred, were immigrants from Denmark where his father had worked as a silver smith. Henry was a precocious child, skipping both third and fifth grades. With the help of Sidney Spivack, a professor of sociology at Columbia University, his parents enrolled Henry in the Brooks Preparatory School in Andover, Massachusetts. After graduating at age 16, Henry enrolled at Cornell, transferring to Princeton the following year. Henry's parents adored their only child and worked hard to provide him with intellectual opportunities. Henry became an accomplished musician (organ, piano, French horn) and linguist (English, Danish, German) and was a passionate devotee of opera and ballet. Henry received his PhD in 1980 from the University of Chicago, where his thesis advisor was James Ipser. He taught at Oakland University in Michigan and Syracuse University in New York before coming to the University of Florida in 1990. Henry was sui generis. He shunned conventionality in his personal appearance and in his public demeanor, and always chose forthrightness and candor over polite silence. But to those of us who knew Henry well, his bluntness was a reflection of his intellectual consistency. Henry always said exactly what he thought, both in his published work and his public presentations, and never compromised himself for the sake of appearances. Nothing that he said or wrote was less than fully thought out. Henry's PhD thesis was entitled "Stochastic Problems in Stellar Dynamics," and most of his subsequent research was in this field. Motion in stellar systems can be

  17. Tablet PCs in Engineering Mathematics Courses at the J.B. Speed School of Engineering

    Science.gov (United States)

    Hieb, Jeffrey L.; Ralston, Patricia A. S.

    2010-01-01

    In fall 2007, J.B. Speed School of Engineering at the University of Louisville joined the ranks of universities requiring the purchase of Tablet PCs for all new entering students. This article presents a description of how the Department of Engineering Fundamentals incorporated Tablet PCs into their instruction, a review of the literature…

  18. Cometabolic Degradation of Dibenzofuran and Dibenzothiophene by a Naphthalene-Degrading Comamonas sp. JB.

    Science.gov (United States)

    Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan

    2017-08-18

    Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.

  19. Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1

    Science.gov (United States)

    We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....

  20. Preparation of Dicke States in an Ion Chain

    CERN Document Server

    Hume, D B; Rosenband, T; Wineland, D J

    2009-01-01

    We have investigated theoretically and experimentally a method for preparing Dicke states in trapped atomic ions. We consider a linear chain of $N$ ion qubits that is prepared in a particular Fock state of motion, $|m>$. The $m$ phonons are removed by applying a laser pulse globally to the $N$ qubits, and converting the motional excitation to $m$ flipped spins. The global nature of this pulse ensures that the $m$ flipped spins are shared by all the target ions in a state that is a close approximation to the Dicke state $\\D{N}{m}$. We calculate numerically the fidelity limits of the protocol and find small deviations from the ideal state for $m = 1$ and $m = 2$. We have demonstrated the basic features of this protocol by preparing the state $\\D{2}{1}$ in two $^{25}$Mg$^+$ target ions trapped simultaneously with an $^{27}$Al$^+$ ancillary ion.

  1. Preparation of Dicke states in an ion chain

    Science.gov (United States)

    Hume, D. B.; Chou, C. W.; Rosenband, T.; Wineland, D. J.

    2009-11-01

    We have investigated theoretically and experimentally a method for preparing Dicke states in trapped atomic ions. We consider a linear chain of N ion qubits that is prepared in a particular Fock state of motion |m⟩ . The m phonons are removed by applying a laser pulse globally to the N qubits and converting the motional excitation to m flipped spins. The global nature of this pulse ensures that the m flipped spins are shared by all the target ions in a state that is a close approximation to the Dicke state |DN(m)⟩ . We calculate numerically the fidelity limits of the protocol and find small deviations from the ideal state for m=1 and m=2 . We have demonstrated the basic features of this protocol by preparing the Bell state |D2(1)⟩ in two M25g+ target ions trapped simultaneously with an A27l+ ancillary ion.

  2. Pairwise Quantum Correlations for Superpositions of Dicke States

    CERN Document Server

    Xi, Zhengjun; Li, Yongming; Wang, Xiaoguang

    2011-01-01

    Using the concept of quantum discord (QD), we study the quantum correlation for a class of two-qubit X states with exchange and parity symmetries, whose density matrices have complex off-diagonal elements. We derive an upper bound of the QD, which is independent of the arguments of the complex off-diagonal elements of the reduced two-qubit density matricies. Moreover, for the two-qubit X states obtained from Dicke states and their superposition states, we obtain a compact expression of the QD by numerical check. Finally, we apply the expression to discuss the quantum correlation of the reduced two-qubit states of Dicke states and their superpositions, and the results are compared with those obtained by entanglement of formation (EoF), which is a quantum entanglement measure.

  3. The Hero Journey of Ishmael in Moby Dick

    Institute of Scientific and Technical Information of China (English)

    郭妮

    2014-01-01

    MobyDick, a novel acclaimed as a success of nineteenth-century American fiction, has always been challenging to readers,as it can be interpreted from different perspectives. There are two Ishmaels in it:one is the character and the other is the narrator.This paper studies the hero journey of Ishmael from the perspective of hero motif.Through the analysis of the differences between the two Ishmaels---the changes take place in younger Ishmael after his quest on the sea,the hero journey of Ishmael is presented.The paper concludes that Moby Dick suggests the hidden terror of nineteenth century America and people’s concern about the spiritual freedom.

  4. Unified dark fluid in Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Tripathy, Sunil K. [Indira Gandhi Institute of Technology, Department of Physics, Dhenkanal, Odisha (India); Behera, Dipanjali [Government College of Engineering, Department of Physics, Kalahandi, Odisha (India); Mishra, Bivudutta [Birla Institute of Technology and Science-Pilani, Department of Mathematics, Hyderabad (India)

    2015-04-01

    Anisotropic dark energy cosmological models are constructed in the frame work of generalised Brans-Dicke theory with a self-interacting potential. A unified dark fluid characterised by a linear equation of state is considered as the source of dark energy. The shear scalar is considered to be proportional to the expansion scalar simulating an anisotropic relationship among the directional expansion rates. The dynamics of the universe in the presence of a unified dark fluid in anisotropic background have been discussed. The presence of an evolving scalar field makes it possible to get an accelerating phase of expansion even for a linear relationship among the directional Hubble rates. It is found that the anisotropy in expansion rates does not affect the scalar field, the self-interacting potential, but it controls the non-evolving part of the Brans-Dicke parameter. (orig.)

  5. Non-static local string in Brans–Dicke theory

    Indian Academy of Sciences (India)

    A A Sen

    2000-09-01

    A recent investigation showed that a local gauge string with a phenomenological energy momentum tensor, as prescribed by Vilenkin, is inconsistent in Brans–Dicke theory. In this work it has been shown that such a string is indeed consistent if one introduces time dependences in the metric. A set of solutions of full non-linear Einstein’s equations for the interior region of such a string are presented.

  6. New static spheroidal solution in Jordan-Brands-Dicke theory

    CERN Document Server

    Kozyrev, S M

    2010-01-01

    The static spheroidal solutions of Jordan-Brands-Dicke theory (JBD) are studied. We consider the effect of the anisotropic stresses of scalar field on the shape of JBD self-graviting objects. It is shown that scalar fields can have significant effect on the structure and properties of self-graviting objects. In contrast with general relativity in JBD theory there are nonflat static spheroidal solutions.

  7. Higher dimensional global monopole in Brans–Dicke theory

    Indian Academy of Sciences (India)

    Farook Rahaman; Subenoy Chakraborty; Mehedi Kalam

    2002-01-01

    The gravitational field of a higher dimensional global monopole in the context of Brans–Dicke theory of gravity is investigated. The space time metric and the scalar field generated by a global monopole are obtained using the weak field approximation. Finally, the geodesic of a test particle due to the gravitational field of the monopole is studied.

  8. On the Identity of Ishmael in Moby Dick

    Institute of Scientific and Technical Information of China (English)

    DU Liang-xia

    2015-01-01

    Moby Dick is a retrospective novel about life at sea as well as a vast philosophical allegory of life in general. The novel begins with a famous statement“Call me Ishmael”. The identity of Ishmael is analyzed, revealing that he functions not only as an indispensable narrator, but as an actor—a sailor on the Pequod, and psychologically a religious wonderer and a truth seeker.

  9. Antigravity in F( R) and Brans-Dicke theories

    Science.gov (United States)

    Oikonomou, V. K.; Karagiannakis, N.

    2014-12-01

    We study antigravity in F( R)-theory originating scalar-tensor theories and also in Brans-Dicke models without cosmological constant. For the F( R) theory case, we obtain the Jordan frame antigravity scalar-tensor theory by using a variant of the Lagrange multipliers method and we numerically study the time dependent effective gravitational constant. As we shall demonstrate in detail by using some viable F( R) models, although the initial F( R) models have no antigravity, their scalar-tensor counterpart theories might or not have antigravity, a fact mainly depending on the parameter that characterizes antigravity. Similar results hold true in the Brans-Dicke model, which we also studied numerically. In addition, regarding the Brans-Dicke model we also found some analytic cosmological solutions. Since antigravity is an unwanted feature in gravitational theories, our findings suggest that in the case of F( R) theories, antigravity does not occur in the real world described by the F( R) theory, but might occur in the Jordan frame scalar-tensor counterpart of the F( R) theory, and this happens under certain circumstances. The central goal of our study is to present all different cases in which antigravity might occur in modified gravity models.

  10. Obituary: Richard L. (Dick) Walker, Jr., 1938-2005

    Science.gov (United States)

    Pier, Jeffrey R.; Mason, Brian

    2005-12-01

    Dick Walker, 67, died 30 March 2005 in Flagstaff, AZ, following a long illness. He was born on 9 March 1938 in Hampton, Iowa and grew up in Waterloo, Iowa. As a child, Dick was fascinated with astronomy and built his own telescope. He saved his pennies and bought and read every book on the subject he could find. He also raised pigeons, naming four of them Hertzsprung, Hoyle, Gamow, and Kron. In 1957, the year Sputnik was launched, Dick began his college studies at the University of Northern Iowa in Cedar Falls. In 1959, he transferred to the State University of Iowa (subsequently renamed the University of Iowa) in Iowa City, where he earned a BA degree in astronomy and physics in 1963. He joined the staff of the U.S. Naval Observatory in Washington, DC, where he worked in the Time Service Division for a year before his assignment to the Astrometry and Astrophysics Division. Dick relocated to Flagstaff, AZ, in 1966 to continue his Naval Observatory service at the Flagstaff Station. His retirement in May 1999, ended a thirty-six-year career with USNO. Dick was first and foremost an observational astronomer. From the mid 1960s through the late 1970s, much of Dick's time was devoted to the measurement of binary stars, observing with the 12-inch and 26-inch refractors in Washington and later the 40-inch and 61-inch reflectors in Flagstaff. He also made many trips to Lick Observatory to work with the 36-inch Clark Refractor there. During this time he consulted with Charles Worley, who was observing on the 26-inch, to make sure time was well-spent examining doubles that could not be observed in Washington. This period of observing overlapped with the early years of speckle interferometry, and Dick's observations, made with the largest telescope used for micrometry at the time, were very important for ascertaining the veracity of this new technique. He was a studious and very careful observer of doubles and made over 8,000 measures, resulting in almost 3,000 mean positions

  11. Exact Cosmological Solutions in Modified Brans--Dicke Theory

    CERN Document Server

    Rasouli, S M M

    2016-01-01

    In this paper, we obtain exact cosmological vacuum solutions for an extended FLRW homogenous and isotropic Brans-Dicke (BD) universe in five dimensions for all values of the curvature index. Then, by employing the equations associated to a modified Brans-Dicke theory (MBDT) [1], we construct the physics on a four-dimensional hypersurface. We show that the induced matter obeys the equation of state of a fluid of a barotropic type. We discuss the properties of such an induced matter for some values of the equation of state parameter and analyze in detail their corresponding solutions. To illustrate the cosmological behaviors of the solutions, we contrast our solutions with those present the standard Brans-Dicke theory. We retrieve that, in MBDT scenario, it is impossible to find a physically acceptable solution associated to the negative curvature for both the dust-dominated and radiation-dominated universes. However, for a spatially flat and closed universes, we argue that our obtained solutions are more gener...

  12. Brans-Dicke Galileon and the Variational Principle

    CERN Document Server

    Quiros, Israel; Gonzalez, Tame; Horta-Rangel, F Antonio; Saavedra, Joel

    2016-01-01

    This paper is aimed at a (mostly) pedagogical exposition of the derivation of the motion equations of certain modifications of general relativity. Here we derive in all detail the motion equations in the Brans-Dicke theory with the cubic self-interaction. This is a modification of the Brans-dicke theory by the addition of a term in the Lagrangian which is non-linear in the derivatives of the scalar field: it contains second-order derivatives. This is the basis of the so-called Brans-Dicke Galileon. We pay special attention to the variational principle and to the algebraic details of the derivation. It is shown how higher order derivatives of the fields appearing in the intermediate computations cancel out leading to second order motion equations. The reader will find useful tips for the derivation of the field equations of modifications of general relativity such as the scalar-tensor theories and $f(R)$ theories, by means of the (stationary action) variational principle. The content of this paper is specially...

  13. Dicke phase transition with multiple superradiant states in quantum chaotic resonators

    KAUST Repository

    Liu, C.

    2014-06-12

    We experimentally investigate the Dicke phase transition in chaotic optical resonators realized with two-dimensional photonics crystals. This setup circumvents the constraints of the system originally investigated by Dicke and allows a detailed study of the various properties of the superradiant transition. Our experimental results, analytical prediction, and numerical modeling based on random-matrix theory demonstrate that the probability density P? of the resonance widths provides a new criterion to test the occurrence of the Dicke transition.

  14. Kolmanda maailma raudteekunn / Henry Posner ; interv. Krister Kivi

    Index Scriptorium Estoniae

    Posner, Henry

    2005-01-01

    Raudteeärimees Henry Posner III, kes kuulub ka Eesti Raudtee omanikeringi, oma äritegevusest, sealhulgas investeeringutest Eestisse. Suhtumisest raudteeturu avamisse. Lisa: Henry Posner mängib rongidega maailma hämarates nurkades

  15. Kolmanda maailma raudteekunn / Henry Posner ; interv. Krister Kivi

    Index Scriptorium Estoniae

    Posner, Henry

    2005-01-01

    Raudteeärimees Henry Posner III, kes kuulub ka Eesti Raudtee omanikeringi, oma äritegevusest, sealhulgas investeeringutest Eestisse. Suhtumisest raudteeturu avamisse. Lisa: Henry Posner mängib rongidega maailma hämarates nurkades

  16. Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving

    Science.gov (United States)

    Yu, Xin; Huang, Kuibang; Zheng, Miao

    2016-06-01

    A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.

  17. Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.

    Science.gov (United States)

    Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D

    2011-01-01

    Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.

  18. A flow cytometric in vivo chalone assay using retransplanted old murine JB-1 ascites tumour cells.

    Science.gov (United States)

    Barfod, N M

    1981-07-01

    A flow cytometric in vivo chalone assay is described. Transplantation of old JB-1 ascites tumour cells to new hosts induced an influx of tumour cells, with G1 DNA content, to the S phase. This induction could be reversibly and specifically blocked by injections of an ultrafiltrate of old JB-1 ascites fluid. The method described is superior to a previously published in vivo chalone assay using regenerating ascites tumours. Owing to a reduced variability in time of onset of DNA synthesis, a smaller scatter of observations is achieved and thus the number of mice per group may be reduced using the new method. In contrast to the older technique, the present one does not necessitate killing of mice during the observation period.

  19. Von Neumann Regularity and Quadratic Conorms in JB*-triples and C*-algebras

    Institute of Scientific and Technical Information of China (English)

    Mar(I)a BURGOS; El Amin KAIDI; Antonio Morales CAMPOY; Antonio M. PERALTA; Maribel RAM(I)REZ

    2008-01-01

    We revise the notion of von Neumann regularity in JB*-triples by finding a new character-isationin terms of the range of the quadratic operator Q(a). We introduce the quadratic conorm of anelement a in a JB*-triple as the minimum reduced modulus of the mapping Q(a). It is shown that thequadratic conorm of a coincides with the infimum of the squares of the points in the triple spectrumof a. It is established that a contractive bijection between JBW*-triples is a triple isomorphism if, andonly if, it preserves quadratic conorms. The continuity of the quadratic conorm and the generalizedinverse are discussed. Some applications to C*-algebras and von Neumann algebras are also studied.

  20. Brans-Dicke theory of gravity with torsion: A possible solution of $\\omega$-problem

    CERN Document Server

    Wu, Yu-Huei

    2012-01-01

    We study Brans-Dicke theory of gravity in Riemann-Cartan space-times, and obtain general torsion solutions, which are completely determined by Brans-Dicke scalar field $\\Phi$, in the false vacuum energy dominated epoch. The substitution of the torsion solutions back to our action gives the original Brans-Dicke action with $\\Phi$-dependent Brans-Dicke parameter $\\omega(\\Phi)$. The evolution of $\\omega(\\Phi)$ during inflation is studied and it yields that $\\omega$ approaches to infinity at the end of inflation. It may solve the $\\omega$-problem in the extended inflation model.

  1. Biosorption of cationic basic dye and cadmium by the novel biosorbent Bacillus catenulatus JB-022 strain.

    Science.gov (United States)

    Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol

    2015-04-01

    Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  2. An Analysis of Coherence in "At the Tailors" by J.B Priestly

    Institute of Scientific and Technical Information of China (English)

    王浪

    2010-01-01

    It's universally known that textual coherence is essen-tial for any essayist who has an well-orgainized prose in mind, the reputated essayist J.B Priesdy is no exception. In his prose, "At the Tailors", he manages to achieve hish artisanship of coherence by re-peatedly employing synonyms and antonyms, contrast and humor.This paper will therefore briefly analyize the author's exquisite craftsmanship in building the intergrity of discourse.

  3. Modulation of JB6 Mouse Epidermal Cell Transformation Response by the Prostaglandin F2 Alpha Receptor

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Markillie, Lye MENG.; Chrisler, William B.; Vielhauer, George A.; Regan, John W.

    2002-12-01

    Prostaglandin F2a (PGF2a) has been associated with the modulation of clonal selection processes in the mouse skin model of carcinogenesis. We have investigated whether JB6 mouse epidermal cells express a functional PGF2a receptor (FP) coupled to the regulation of anchorage-dependent and -independent growth. Treatment of JB6 cells with a FP receptor ligand (fluprostenol) potently (pM-nM) increased anchorage-dependent and -independent growth, as determined by a battery of in vitro assays. Treatment of JB6 cells with PGF2a and fluprostenol increased inositol phospholipid accumulation and extracellular signal regulated kinase (ERK) activity, consistent with FP receptor-related signaling. FP receptor mRNA was detected by reverse transcription-polymerase chain reaction and a radiolabel binding assay determined the average specific [3H]PGF2a binding to be 8.25 + 0.95 fmol/mg protein. Treatment of cells with fluprostenol as a single exposure resulted in a significant increase in anchorage-dependent and -independent growth in media containing low (0.1-0.5%), but not high (5%) concentrations of fetal bovine serum (FBS). In contrast, treatment of cells with fluprostenol at two day intervals resulted in a more robust growth response under anchorage-dependent conditions only in media containing low FBS concentrations; and under anchorage-independent conditions only in media containing high FBS concentrations. ERK activation and colony size were increased by cotreatment of JB6 cells with EGF and fluprostenol to a greater extent than either treatment alone, while the cotreatment effect on colony number appeared to be simply additive. In summary, FBS concentration and signal oscillation exert pronounced effects on the biological response to a FP receptor agonist. The data raise the possibility that the FP receptor may independently contribute to clonal selection processes, but may play a more important role as a response modifier.

  4. Interpretation of JB/T 6383.1~6383.3-2007%JB/T 6383.1~6383.3-2007标准介绍

    Institute of Scientific and Technical Information of China (English)

    薛靖

    2008-01-01

    @@ 1概述 由中国机械工业联合会提出,机械工业冶金设备标准化技术委员会归口,西安重型机械研究所负责起草的JB/T 6383.1-2007《锥密封两端焊接式直通管接头》、JB/T 6383.2-2007《锥密封焊接式直角管接头》和JB/T 6383.3-2007《锥密封焊接式三通管接头》已于2007年3月6日发布,2007年9月1日实施,相应的JB/T6383.1~6383.3-1992标准作废.

  5. Appreciating Gantos' Jack Henry as an Archetype.

    Science.gov (United States)

    Watson, Jinx Stapleton

    2001-01-01

    Examines the contemporary realism of the literary character Jack Henry, a middle school child, as representative of two classic literary elements, the quest cycle and the lone hero. Concludes that classic structures of plots and characteristics of hero offer many modern protagonists a shape for their realistic and ordinary adventures. (SG/47)

  6. Translating China : Henri Borel (1869-1933)

    NARCIS (Netherlands)

    Heijns, A.J.

    2016-01-01

    This thesis investigates how Dutch sinologist Henri Borel ‘translated’ China, by examining his renditions of Chinese literature and the writings about China that he produced over a period of forty years. Borel studied Hokkien Chinese at Leiden University and in Xiamen toward a career as Chinese Inte

  7. New books about Henri Poincaré

    NARCIS (Netherlands)

    Ginoux, J.-M.; Verhulst, F.; Gray, J.

    2012-01-01

    In the ‘centennial year’ 2012 there will appear three books on life and work of Henri Poincaré. Each of the respective authors Jean-Marc Ginoux, Ferdinand Verhulst and Jeremy Gray gives a short description of his own book.

  8. The Ideas of Henry Jenkins and Libraries

    Science.gov (United States)

    Anderson, Byron

    2008-01-01

    Henry Jenkins, director of the Comparative Media Studies Program at the Massachusetts Institute of Technology and keynote speaker at the 2007 American Library Association's "Gaming, Learning and Libraries Symposium" in Chicago is a visionary leader in the areas of new media and media convergence. In a white paper on digital media and learning…

  9. In the Style of Henry Moore

    Science.gov (United States)

    Hinshaw, Craig

    2010-01-01

    In this article, the author describes an art project inspired by Henry Moore's sculptures. This project consists of two activities. In the first activity, students select, sand and stain a wood block that would become a base for their plaster sculpture. This activity would keep the students independently engaged (classroom management) while the…

  10. Role of the Brans-Dicke scalar in the holographic description of dark energy

    CERN Document Server

    Kim, H L; Myung, Y S; Kim, Hungsoo

    2005-01-01

    We study cosmological application of the holographic energy density in the Brans-Dicke theory. Considering the holographic energy density as a dynamical cosmological constant, it is more natural to study it in the Brans-Dicke theory than in general relativity. Solving the Friedmann and Brans-Dicke field equations numerically, we clarify the role of Brans-Dicke field during evolution of the universe. When the Hubble horizon is taken as the IR cutoff, the equation of state ($w_{\\Lmd}$) for the holographic energy density is determined to be 5/3 when the Brans-Dicke parameter $\\omg$ goes infinity. This means that the Brans-Dicke field plays a crucial role in determining the equation of state. For the particle horizon IR cutoff, the Brans-Dicke scalar mediates a transition from $w_{\\Lmd} = -1/3$ (past) to $w_{\\Lmd} = 1/3$ (future). If a dust matter is present, it determines future equation of state. In the case of future event horizon cutoff, the role of the Brans-Dicke scalar and dust matter are turned out to be ...

  11. Dicke superradiance, Bose-Einstein condensation of photons and spontaneous symmetry breaking

    CERN Document Server

    Vyas, Vivek M; Srinivasan, V

    2016-01-01

    It is shown that the phenomenon of Dicke superradiance essentially occurs due to spontaneous symmetry breaking. Two generalised versions of the Dicke model are studied, and compared with a model that describes photonic Bose-Einstein condensate, which was experimentally realised. In all the models, it is seen that, the occurrence of spontaneous symmetry breaking is responsible for coherent radiation emission.

  12. The Symbols in" Moby- Dick" and Melville's Description of the Figures

    Institute of Scientific and Technical Information of China (English)

    康强

    2005-01-01

    When we mention Melville's masterpiece "Moby - Dick", our first impression must be the original symbols.But at the same time, most of us neglect his outstanding talent of describing the figures.In this article, we will discuss the characteristic of Melville's" Moby- Dick".

  13. Contaminant Monitoring Strategy for Henrys Lake, Idaho

    Energy Technology Data Exchange (ETDEWEB)

    John S. Irving; R. P. Breckenridge

    1992-12-01

    Henrys Lake, located in southeastern Idaho, is a large, shallow lake (6,600 acres, {approx} 17.1 feet maximum depth) located at 6,472 feet elevation in Fremont Co., Idaho at the headwaters of the Henrys Fork of the Snake River. The upper watershed is comprised of high mountains of the Targhee National Forest and the lakeshore is surrounded by extensive flats and wetlands, which are mostly privately owned. The lake has been dammed since 1922, and the upper 12 feet of the lake waters are allocated for downriver use. Henrys Lake is a naturally productive lake supporting a nationally recognized ''Blue Ribbon'' trout fishery. There is concern that increasing housing development and cattle grazing may accelerate eutrophication and result in winter and early spring fish kills. There has not been a recent thorough assessment of lake water quality. However, the Department of Environmental Quality (DEQ) is currently conducting a study of water quality on Henrys Lake and tributary streams. Septic systems and lawn runoff from housing developments on the north, west, and southwest shores could potentially contribute to the nutrient enrichment of the lake. Many houses are on steep hillsides where runoff from lawns, driveways, etc. drain into wetland flats along the lake or directly into the lake. In addition, seepage from septic systems (drainfields) drain directly into the wetlands enter groundwater areas that seep into the lake. Cattle grazing along the lake margin, riparian areas, and uplands is likely accelerating erosion and nutrient enrichment. Also, cattle grazing along riparian areas likely adds to nutrient enrichment of the lake through subsurface flow and direct runoff. Stream bank and lakeshore erosion may also accelerate eutrophication by increasing the sedimentation of the lake. Approximately nine streams feed the lake (see map), but flows are often severely reduced or completely eliminated due to irrigation diversion. In addition, subsurface

  14. An instance of sleep paralysis in Moby-Dick.

    Science.gov (United States)

    Herman, J

    1997-07-01

    It is suggested that picturesque medical conditions can, at times, be encountered in literary works composed prior to their clinical delineation. This is true of sleep paralysis, of which the first scientific description was given by Silas Weir Mitchell in 1876. A quarter of a century earlier, Herman Melville, in Moby-Dick, gave a precise account of a case, including the predisposing factors and sexual connotations, all in accord with modern theory. The details of Ishmael's attack of sleep paralysis, the stresses leading up to it, and the associations causing him to recall the experience are given here.

  15. Stellar filaments in self-interacting Brans-Dicke gravity

    Energy Technology Data Exchange (ETDEWEB)

    Sharif, M. [University of the Punjab, Department of Mathematics, Lahore (Pakistan); Manzoor, Rubab [University of the Punjab, Department of Mathematics, Lahore (Pakistan); University of Management and Technology, Department of Mathematics, Lahore (Pakistan)

    2016-05-15

    This paper is devoted to the study of the cylindrically symmetric stellar filaments in self-interacting Brans-Dicke gravity. For this purpose, we construct polytropic filamentary models through a generalized Lane-Emden equation in the Newtonian regime. The resulting models depend upon the values of the cosmological constant (due to the scalar field) along with the polytropic index and represent a generalization of the corresponding models in general relativity. We also investigate the fragmentation of the filaments by exploring the radial oscillations through a stability analysis. This stability criterion depends only upon the adiabatic index. (orig.)

  16. Brans-Dicke corrections to the gravitational Sagnac effect

    CERN Document Server

    Nandi, K K; Evans, J C; Nayak, T B

    2001-01-01

    The effect of the Brans-Dicke scalar field on the gravitational corrections to the Sagnac effect has been computed for the first time in the Jordan and Einstein frames. The calculations suggest the possibility that the presence of the scalar field can be detected directly from the basic Sagnac effect in the case of geodesic motions. A second order correction of roughly 0.1 fringe shift for visible light is introduced by the scalar field in the case of polar orbits of the source/observer. It is also demonstrated how the final results in the two frames differ.

  17. Cosmic Wave Functions with the Brans-Dicke Theory

    Institute of Scientific and Technical Information of China (English)

    ZHU Zong-Hong

    2000-01-01

    Using the standard Wentzel-Kramers-Brillouin method, the Wheeler-De Witt equation for the Brans-Dicke theory is solved under three kinds of boundary conditions (proposed by Hattie-Hawking, Vilenkin and Linde, respectively). It is found that, although the gravitational and cosmological"constants" are dynamical and timedependent in the classical models, they will acquire constant values when the universe comes from the quantum creation, and that in particular, the amplitude of the resulting wave function under Linde or Vilenkin boundary conditions reaches its maximum if the cosmological constant is the minimum.

  18. Massive motion in Brans-Dicke geometry and beyond

    CERN Document Server

    Punzi, Raffaele; Wohlfarth, Mattias N R

    2009-01-01

    Gravity theories that can be viewed as dynamics for area metric manifolds, for which Brans-Dicke theory presents a recently studied example, require for their physical interpretation the identification of the distinguished curves that serve as the trajectories of light and massive matter. Complementing previous results on the propagation of light, we study effective massive point particle motion. We show that the relevant geometrical structure is a special Finsler norm determined by the area metric, and that massive point particles follow Finsler geodesics.

  19. Stellar Filaments in Self-Interacting Brans-Dicke Gravity

    CERN Document Server

    Sharif, M

    2016-01-01

    This paper is devoted to study cylindrically symmetric stellar filaments in self-interacting Brans-Dicke gravity. For this purpose, we construct polytropic filamentary models through generalized Lane-Emden equation in Newtonian regime. The resulting models depend upon the values of cosmological constant (due to scalar field) along with polytropic index and represent a generalization of the corresponding models in general relativity. We also investigate fragmentation of filaments by exploring the radial oscillations through stability analysis. This stability criteria depends only upon the adiabatic index.

  20. Dicke-Josephson effect in a cross-typed triple-quantum-dot junction

    Science.gov (United States)

    Wang, Xiao-Qi; Yi, Guang-Yu; Gong, Wei-Jiang

    2016-12-01

    We investigate the Dicke-Josephson effect in a superconductor/triple-quantum-dot/superconductor junction in which the central dot is coupled to the superconductors. It is found that the Dicke effect can modulate the Josephson effect in a nontrivial way. In the noninteracting case, the Dicke effect induces a subpeak in the supercurrent spectrum around the energy zero point. When intradot interactions are taken into account, the role of the Dicke effect changes completely. Namely, it tends to suppress the π-phase current near the position of electron-hole symmetry. With the increase of the Coulomb strength, it has an opportunity to reverse the current direction. We thus conclude that the Dicke-Josephson effect is also an important part in describing the Josephson effect in coupled-dot junctions.

  1. Copper and dyes enhance laccase production in gamma-proteobacterium JB.

    Science.gov (United States)

    Malhotra, Kanam; Sharma, Prince; Capalash, Neena

    2004-07-01

    Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.

  2. Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.

    Science.gov (United States)

    Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena

    2009-01-01

    Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.

  3. Henry P. McKean Jr. selecta

    CERN Document Server

    Moerbeke, Pierre; Moll, Victor

    2015-01-01

    This volume presents a selection of papers by Henry P. McKean, which illustrate the various areas in mathematics in which he has made seminal contributions. Topics covered include probability theory, integrable systems, geometry and financial mathematics. Each paper represents a contribution by Prof. McKean, either alone or together with other researchers, that has had a profound influence in the respective area.

  4. Black humor in O.Henry's novels

    Institute of Scientific and Technical Information of China (English)

    冯静楠

    2013-01-01

      Black humor is a kind of literary style rose in American and O .Henry's novels used it to express the satire to society and show the sympathy to the lower class .The most typical works contain black humor two are The Cop and the Anthem and The Gift of the Magi.By using black humor, he created his unique endings .This article is trying to analysis the use of black humor in his novels and the effect.

  5. Henri Vetch and His French Bookstore Peking

    Directory of Open Access Journals (Sweden)

    Chiang Lei

    2013-12-01

    Full Text Available Based on enormous firsthand materials as journals, memoirs, newspapers, correspondences, archives, bibliographies and books etc., this article tries to clarify some important aspects concerning Henri Vetch and his French Bookstore Peking such as when Henri Vetch took over his father Francis Vetch’s La Librairie Francaise and established his own French Bookstore Peking, how its inner structure worked and what its major businesses covered. By doing so, the author tells the story of the French Bookstore Peking: how it had witnessed the vicissitudes of its time and its own, how it had contributed to the cultural exchange and communication between China and the West through its daily business activities such as book retails, consignments, purchases on demand, and publication of books on various aspects of China in English and other languages written by distinguished western sinologists and authors. In all, this article makes efforts to explore the publishing history of an individual-Henri Vetch from 1930 to 1953, whose publishing house, the French Bookstore Peking, served both for an academic club and a private library, and had played an active role in the cultural life of Beijing or even the whole China during that time. [Article content in Chinese

  6. A critique of phrenology in Moby-Dick.

    Science.gov (United States)

    de Souza, Leonardo Cruz; Teixeira, Antônio Lúcio; de Oliveira, Guilherme Nogueira M; Caramelli, Paulo; Cardoso, Francisco

    2017-09-05

    Phrenology has a fascinating, although controversial, place in the history of localizationism of brain and mental functions. The 2 main proponents of phrenology were 2 German-speaking doctors, Joseph Gall (1758-1828) and Johann Spurzheim (1776-1832). According to their theory, a careful examination of skull morphology could disclose personality characters. Phrenology was initially restricted to medical circles and then diffused outside scientific societies, reaching nonscientific audiences in Europe and North America. Phrenology deeply penetrated popular culture in the 19th century and its tenets can be observed in British and American literature. Here we analyze the presence of phrenologic concepts in Moby-Dick; or, The Whale, by Herman Melville (1819-1891), one of the most prominent American writers. In his masterpiece, he demonstrates that he was familiarized with Gall and Spurzheim's writings, but referred to their theory as "semi-science" and "a passing fable." Of note, Melville's fine irony against phrenology is present in his attempt to perform a phrenologic and physiognomic examination of The Whale. Thus, Moby-Dick illustrates the diffusion of phrenology in Western culture, but may also reflect Melville's skepticism and criticism toward its main precepts. © 2017 American Academy of Neurology.

  7. Robert Dicke and the Naissance of Experimental Gravity Physics

    CERN Document Server

    Peebles, P J E

    2016-01-01

    The experimental study of gravity became much more active in the late 1950s, a change pronounced enough be termed the naissance of empirical gravity physics. A review of the developments since 1915, and up to the transition to what might be termed a normal and accepted part of physical science in the late 1960s, shows the importance of advances in technologies, here as in all branches of science. The role of contingency is illustrated by Robert Dicke's decision to change directions in mid-career, to lead a research group dedicated to the experimental study of gravity. One sees the power of nonempirical evidence, which led some in the 1950s to feel that general relativity theory is so logically sound as to be scarcely worth the testing, while Dicke and others argued that a poorly tested theory is only that, and that other nonempirical arguments, based on Mach's Principle and Dirac's Large Numbers, suggested it was worth looking for a better theory of gravity. I conclude by offering lessons from this history, s...

  8. Nucleation of vacuum bubbles in Brans-Dicke type theory

    CERN Document Server

    Kim, Hongsu; Lee, Wonwoo; Lee, Young Jae; Yeom, Dong-han

    2010-01-01

    In this paper, we study nucleation of vacuum bubbles in the Brans-Dicke type theory of gravity. In the Euclidean signatures, we calculate field combinations of vacuum bubbles as solutions of Einstein and field equations as well as their probabilities by integrating the Euclidean action. We illustrate three possible ways to obtain vacuum bubbles: true vacuum bubbles for $\\omega$ > -3/2, false vacuum bubbles for $\\omega$ -3/2 when the vacuum energy of the false vacuum in the potential of the Einstein frame is less than that of the true vacuum. After the bubble is nucleated at the t = 0 surface, we can smoothly connect and match the field combinations to some solutions of the Lorentzian signatures and consistently continue their subsequent evolutions. Therefore, we conclude that, in general scalar-tensor theories or Brans-Dicke type theories, which include some models of string theory, vacuum bubbles are allowed not only in the form of true vacuum bubbles but also false vacuum bubbles, as long as a special cond...

  9. On the action of the complete Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Kofinas, Georgios [University of the Aegean, Research Group of Geometry, Dynamical Systems and Cosmology, Department of Information and Communication Systems Engineering, Karlovassi, Samos (Greece); Tsoukalas, Minas [Bogazici University, Physics Department, Istanbul (Turkey); National Technical University of Athens, Physics Division, Athens (Greece)

    2016-12-15

    Recently the most general completion of Brans-Dicke theory has appeared with energy exchanged between the scalar field and ordinary matter, given that the equation of motion for the scalar field keeps the simple wave form of Brans-Dicke. This class of theories contain undetermined functions, but there exist only three theories which are unambiguously determined from consistency. Here, for the first such theory, the action of the vacuum theory is found, which arises as the limit of the full matter theory. A symmetry transformation of this vacuum action in the Jordan frame is found which consists of a conformal transformation of the metric together with a redefinition of the scalar field. Since the general family of vacuum theories is parametrized by an arbitrary function of the scalar field, the action of this family is also found. As for the full theory with matter the action of the system is only found when the matter Lagrangian vanishes on-shell, as for example for pressureless dust. Due to the interaction, the matter Lagrangian is non-minimally coupled either in the Jordan or the Einstein frame. (orig.)

  10. Adiabatic invariants for the regular region of the Dicke model

    Science.gov (United States)

    Bastarrachea-Magnani, M. A.; Relaño, A.; Lerma-Hernández, S.; López-del-Carpio, B.; Chávez-Carlos, J.; Hirsch, J. G.

    2017-04-01

    Adiabatic invariants for the non-integrable Dicke model are introduced. They are shown to provide approximate second integrals of motion in the energy region where the system exhibits a regular dynamics. This low-energy region, present for any set of values of the Hamiltonian parameters is described both with a semiclassical and a full quantum analysis in a broad region of the parameter space. Peres lattices in this region exhibit that many observables vary smoothly with energy, along distinct lines which beg for a formal description. It is demonstrated how the adiabatic invariants provide a rationale to their presence in many cases. They are built employing the Born–Oppenheimer approximation, valid when a fast system is coupled to a much slower one. As the Dicke model has one bosonic and one fermionic degree of freedom, two versions of the approximation are used, depending on which one is the faster. In both cases a noticeably accord with exact numerical results is obtained. The employment of the adiabatic invariants provides a simple and clear theoretical framework to study the physical phenomenology associated to these regimes, far beyond the energies where a quadratic approximation around the minimal energy configuration can be used.

  11. Frequency comparison of optical lattice clocks beyond the Dick limit

    Science.gov (United States)

    Takamoto, Masao; Takano, Tetsushi; Katori, Hidetoshi

    2011-05-01

    The supreme accuracy of atomic clocks relies on the universality of atomic transition frequencies. The stability of a clock, meanwhile, measures how quickly the clock's statistical uncertainties are reduced. The ultimate measure of stability is provided by the quantum projection noise, which improves as 1/√N by measuring N uncorrelated atoms. Quantum projection noise limited stabilities have been demonstrated in caesium clocks and in single-ion optical clocks, where the quantum noise overwhelms the Dick effect attributed to local oscillator noise. Here, we demonstrate a synchronous frequency comparison of two optical lattice clocks using 87Sr and 88Sr atoms, respectively, for which the Allan standard deviation reached 1 × 10-17 in an averaging time of 1,600 s by cancelling out the Dick effect to approach the quantum projection noise limit. The scheme demonstrates the advantage of using a large number (N ~ 1,000) of atoms in optical clocks and paves the way to investigating the inherent uncertainties of clocks and relativistic geodesy on a timescale of tens of minutes.

  12. Anisotropic Cosmological Model in Modified Brans--Dicke Theory

    CERN Document Server

    Rasouli, S M M; Sepangi, Hamid R

    2011-01-01

    It has been shown that four dimensional Brans-Dicke theory with effective matter field and self interacting potential can be achieved from vacuum 5D BD field equations, where we refer to as modified Brans-Dicke theory (MBDT). We investigate a generalized Bianchi type I anisotropic cosmology in 5D BD theory, and by employing obtained formalism, we derive induced-matter on any 4D hypersurface in context of the MBDT. We illustrate that if the usual spatial scale factors are functions of time while scale factor of extra dimension is constant, and scalar field depends on time and fifth coordinate, then in general, one will encounter inconsistencies in field equations. Then, we assume the scale factors and scalar field depend on time and extra coordinate as separated variables in power law forms. Hence, we find a few classes of solutions in 5D spacetime through which, we probe the one which leads to a generalized Kasner relations among Kasner parameters. The induced scalar potential is found to be in power law or i...

  13. Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.

    Science.gov (United States)

    West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A

    2017-01-01

    Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1(™) . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.

  14. Introduction to the JB/T 6576.1-2005 Cupola Part1:Technical Requirements%JB/T 6576.1-2005《冲天炉第1部分:技术条件》介绍

    Institute of Scientific and Technical Information of China (English)

    王开远

    2006-01-01

    @@ 1 概述 冲天炉的系列标准均为机械行业推荐性标准,它包括JB/T 6576-1993《冲天炉型式与基本参数》和JB/T 6576.1-2005《冲天炉第1部分:技术条件》.JB/T 6576.2规定了冲天炉的具体参数,目前尚未发布.冲天炉技术条件标准1989年首次发布,1999年转化为行业标准.

  15. Cosmological implications of a supersymmetric extension of the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Catena, R.

    2007-09-15

    In the Brans-Dicke theory the Planck mass is replaced by a dynamical scalar field. We consider here the supersymmetric analogous of this mechanism replacing in the supergravity Lagrangian the Planck mass with a chiral superfield. This analysis is motivated by the research of possible connections between supersymmetric Dark Matter scenarios and Dark Energy models based on Brans-Dicke-like theories. We find that, contrary to the original Brans-Dicke theory, in its supersymmetric analogous the gravitational sector does not couple to the matter sector in a universal metric way. As a result, violations of the weak equivalence principle could be present in such a scenario. (orig.)

  16. New Black Hole Solutions in Brans-Dicke Theory of Gravity

    CERN Document Server

    Kim, H

    1999-01-01

    Existence check of non-trivial, stationary axisymmetric black hole solutions in Brans-Dicke theory of gravity in different direction from those of Penrose, Thorne and Dykla, and Hawking is performed. Namely, working directly with the known explicit spacetime solutions in Brans-Dicke theory, it is found that non-trivial Kerr-Newman-type black hole solutions different from general relativistic solutions could occur for the generic Brans-Dicke parameter values -5/2\\leq ømega <-3/2. Finally, issues like whether these black holes can really arise in nature are discussed carefully.

  17. Generalized Sparling-Thirring form in the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Baykal, Ahmet [Nigde University, Department of Physics, Faculty of Arts and Sciences, Bor Yolu, Nigde (Turkey); Delice, Oezguer [Marmara University, Department of Physics, Faculty of Arts and Sciences, Istanbul (Turkey)

    2015-02-01

    The definition of the Sparling-Thirring form is extended to Brans-Dicke theory. By writing the Brans-Dicke field equations in a formally Maxwell-like form, a superpotential and a corresponding pseudo-energy-momentum form are defined. The general energy expression provided by the superpotential in the Jordan frame is discussed in relation to the corresponding expression in the Einstein frame. In order to substantiate its formal definition, the generalized Sparling-Thirring form is used to calculate the energy for the spherically symmetric vacuum solution in Brans-Dicke theory. (orig.)

  18. Dick Effect in a Microwave Frequency Standard Based on Laser-Cooled 113Cd+ Ions

    Science.gov (United States)

    Zhang, Jian-Wei; Miao, Kai; Wang, Li-Jun

    2015-01-01

    The Dick effect is one of the main limits to the frequency stability of a passive frequency standard, especially for the fountain clock and ion clock operated in pulsed mode which require unavoidable dead time during interrogation. Here we measure the phase noise of the interrogation oscillator applied in the microwave frequency standard based on laser-cooled 113Cd+ ions, and analyze the Allan deviation limited by the Dick effect. The results indicate that the Dick effect is one of the key issues for the cadmium ion clock to reach expected frequency stability. This problem can be resolved by interrogating the local oscillator continuously with two ion traps.

  19. Isolation of Burkholderia cepacia JB12 from lead- and cadmium-contaminated soil and its potential in promoting phytoremediation with tall fescue and red clover.

    Science.gov (United States)

    Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang

    2013-07-01

    Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.

  20. Biodegradation of Benzene, Toluene, Ethylbenzene, and o-, m-, and p-Xylenes by the Newly Isolated Bacterium Comamonas sp. JB.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan

    2015-07-01

    A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.

  1. A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.

    Science.gov (United States)

    Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian

    2016-05-01

    Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.

  2. Isolation and partial identification of eight endogenous G1 inhibitors of JB-1 ascites tumor cell proliferation.

    Science.gov (United States)

    Barfod, N M

    1982-06-01

    Eight endogenous G1 inhibitors of the proliferation of JB-1 ascites tumor cells have been isolated and characterized. The activity of the inhibitors has been analyzed on synchronized JB-1 (murine plasmacytoma) and L1A2 (murine sarcoma) cells in vitro using flow cytometry. The purified inhibitors have been tested for in vivo activity on partially synchronized JB-1 and L1A2 ascites tumors in situ. Four of the inhibitors exhibited a high degree of cell specificity (chalone-like inhibitors) and were chemically related, whereas the other four showed no cell specificity. In most extractions, the amount of cell-specific activity is more than 50% of the total G1-inhibitory activity. Most of the inhibitors are low-molecular-weight peptides and glycopeptides.

  3. Henri Tamm : algul küsiti mult kogu aeg autogrammi / Henri Tamm ; interv. Ada Kallam

    Index Scriptorium Estoniae

    Tamm, Henri

    2005-01-01

    Draamaseriaali "Kodu keset linna" lapsnäitleja. Lisaks kolleegid Henrist : M. Veinmann "Tekst on tal esimesena peas", K. Maibaum "Võrdväärne partner suurtele". Artikkel pealkirjaga "Henri Tamm : nüüd saan veidi puhkust" : Linnaleht nr. 22, 3. juuni 2005, A2-A3

  4. Henri Tamm : algul küsiti mult kogu aeg autogrammi / Henri Tamm ; interv. Ada Kallam

    Index Scriptorium Estoniae

    Tamm, Henri

    2005-01-01

    Draamaseriaali "Kodu keset linna" lapsnäitleja. Lisaks kolleegid Henrist : M. Veinmann "Tekst on tal esimesena peas", K. Maibaum "Võrdväärne partner suurtele". Artikkel pealkirjaga "Henri Tamm : nüüd saan veidi puhkust" : Linnaleht nr. 22, 3. juuni 2005, A2-A3

  5. La música de Henry Purcell

    OpenAIRE

    Arias Solano, José Eurico

    2013-01-01

    El siguiente articulo pretende demostrar cómo una sólida base cultural musical cultivada por los músicos de un país o región puede contrarrestar las influencias culturales musicales de paises dominantes. Para ello se analiza la música barroca inglesa de Henry Purcell, empezando con una biografía y delimitando cuales de las influencias que él desarro116 provienen de la música del renacimiento inglés, y cuáles se importaron de países dturalmente dominantes para la época como Italia y Francia. S...

  6. HENRY C. WALLICH: A THIRD GENERATION BANKER

    Directory of Open Access Journals (Sweden)

    Saul Engelbourg

    2001-01-01

    Full Text Available Born in Germany and descendant of a wealthy banking family, Henry C. Wallich emigrated to the United States like others of Jewish ancestry who fled during the 1930s. A professor of money and banking at Yale for two decades, Wallich capped his career as a Governor of the Federal Reserve. During the stagflation of the late 1960s, Wallich, a dissenter, tirelessly advocated tighter monetary policy to stem inflation. Always a scholar, Wallich published extensively; he also served as the Fed’s public spokesman. Owing to his Harvard doctorate and his eminence as an economist, Wallich knew everyone worth knowing in the economics profession.

  7. Henry Fuseli’s Alternative Classicism

    Directory of Open Access Journals (Sweden)

    Martin Myrone

    2015-12-01

    Full Text Available The review considers Andrei Pop’s Antiquity, Theatre & The Painting of Henry Fuseli. This argues for the history painter and writer Fuseli as an exemplary ‘Neopagan’, a term coined by Pop to refer to the new sense of cultural pluralism and historical relativism which emerged in Europe after the discovery of the remains of Pompeii and Herculaneum in 1748. While this perspective offers a fresh view of the artist, relating him to the emergence of modernity, and illuminates some important aspects of his work, the reviewer also suggests that the monographic focus risks re-asserting a sense of Fuseli’s exceptionalism.

  8. Naked singularity formation in Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Ziaie, Amir Hadi; Atazadeh, Khedmat [Department of Physics, Shahid Beheshti University, Evin, Tehran 19839 (Iran, Islamic Republic of); Tavakoli, Yaser, E-mail: am.ziaie@mail.sbu.ac.i, E-mail: k-atazadeh@sbu.ac.i, E-mail: tavakoli@ubi.p [Departamento de Fisica, Universidade da Beira Interior, Rua Marques d' Avila e Bolama, 6200 Covilha (Portugal)

    2010-04-07

    Gravitational collapse of the Brans-Dicke scalar field with non-zero potential in the presence of matter fluid obeying the barotropic equation of state, p = wrho, is studied. Utilizing the concept of the expansion parameter, it is seen that the cosmic censorship conjecture may be violated for w=-1/3 and w=-2/3 which correspond to the cosmic string and domain wall, respectively. We have shown that physically, it is the rate of collapse that governs the formation of a black hole or a naked singularity as the final fate of dynamical evolution and only for these two cases can the singularity be naked as the collapse end state. Also the weak energy condition is satisfied by the collapsing configuration.

  9. Cavity cooling beyond the Lamb-Dicke approximation

    CERN Document Server

    Blake, Tony; Beige, Almut

    2011-01-01

    Calculations based on the Lamb-Dicke approximation suggest that cavity cooling and ordinary laser cooling are essentially the same [see e.g. T. Blake et al., J. Mod. Opt., in press (2011)]. However, going beyond this approximation we obtain very different results. Here we show that cavity cooling can transfer particles to much lower temperatures than currently assumed, when the phonon frequency nu is comparable to or larger than the spontaneous cavity decay rate kappa. For nu << kappa, we predict much higher final phonon numbers than previous calculations. Moreover, we show that the optimal laser detuning is in both cases close to kappa. Our results should be more accurate than earlier predictions, since our calculations involve fewer approximations.

  10. Ultrastrong-coupling phenomena beyond the Dicke model

    Science.gov (United States)

    Jaako, Tuomas; Xiang, Ze-Liang; Garcia-Ripoll, Juan José; Rabl, Peter

    2016-09-01

    We study effective light-matter interactions in a circuit QED system consisting of a single L C resonator, which is coupled symmetrically to multiple superconducting qubits. Starting from a minimal circuit model, we demonstrate that, in addition to the usual collective qubit-photon coupling, the resulting Hamiltonian contains direct qubit-qubit interactions, which have a drastic effect on the ground- and excited-state properties of such circuits in the ultrastrong-coupling regime. In contrast to the superradiant phase transition expected from the standard Dicke model, we find an opposite mechanism, which at very strong interactions completely decouples the photon mode and projects the qubits into a highly entangled ground state. These findings resolve previous controversies over the existence of superradiant phases in circuit QED, but they more generally show that the physics of two- or multiatom cavity QED settings can differ significantly from what is commonly assumed.

  11. Generalized ghost dark energy in Brans-Dicke theory

    CERN Document Server

    Sheykhi, A; Yosefi, Y

    2013-01-01

    It was argued that the vacuum energy of the Veneziano ghost field of QCD, in a time-dependent background, can be written in the general form, $H + O(H^2)$, where $H$ is the Hubble parameter. Based on this, a phenomenological dark energy model whose energy density is of the form $\\rho=\\alpha H+\\beta H^{2}$ was recently proposed to explain the dark energy dominated universe. In this paper, we investigate this generalized ghost dark energy model in the setup of Brans-Dicke cosmology. We study the cosmological implications of this model. In particular, we obtain the equation of state and the deceleration parameters and a differential equation governing the evolution of this dark energy model. It is shown that the equation of state parameter of the new ghost dark energy can cross the phantom line ($w_D=-1$) provided the parameters of the model are chosen suitably.

  12. The momentum four-vector in Brans-Dicke wormholes

    CERN Document Server

    Pirinccioglu, N; Salti, M; Acikgoz, Irfan; Pirinccioglu, Nurettin; Salti, Mustafa

    2006-01-01

    In this work, in order to compute energy and momentum distributions (due to matter plus fields including gravitation) associated with the Brans-Dicke wormhole solutions we consider Moller's energy-momentum complexes both in general relativity and the teleparallel gravity, and the Einstein energy-momentum formulation in general relativity. We find exactly the same energy and momentum in three of the formulations. The results obtained in teleparallel gravity is also independent of the teleparallel dimensionless coupling parameter, which means that it is valid not only in the teleparallel equivalent of general relativity, but also in any teleparallel model. Furthermore, our results also sustains (a) the importance of the energy-momentum definitions in the evaluation of the energy distribution of a given spacetime and (b) the viewpoint of Lessner that the M{\\o}ller energy-momentum complex is a powerful concept of energy and momentum. (c) The results calculated supports the hypothesis by Cooperstock that the energ...

  13. Cosmological solutions of Brans-Dicke equations with cosmological constant

    Directory of Open Access Journals (Sweden)

    I. Ahmadi-Azar

    2002-12-01

    Full Text Available   In this paper, the analytical solutions of Brans-Dicke (B-D equations with cosmological constant are presented, in which the equation of state of the universe is P=mÙ° ρ , under the assumption φRn=c between the B-D field and the scale factor of the universe. The flat (K=0 Robertson- Walker metric has been considered for the metric of the universe. These solutions are rich in the sense that they include dust B-D theory with cosmological constant, Nariai Ù=° solutions, vacuum solutions of Ohanlen-Tupper and inflationary  Ù=° solutions.

  14. Dicke's Superradiance in Astrophysics. I -- The 21 cm Line

    CERN Document Server

    Rajabi, Fereshteh

    2016-01-01

    We have applied the concept of superradiance introduced by Dicke in 1954 to the ISM by extending the corresponding analysis to the magnetic dipole interaction characterizing the atomic hydrogen 21 cm line. Although it is unlikely that superradiance could take place in thermally relaxed regions, in situations where the conditions necessary for superradiance are met (i.e., close atomic spacing, high velocity coherence, population inversion, and long dephasing time-scales compared to those related to coherent behavior), our results suggest that relatively low levels of population inversion over short astronomical length-scales (e.g., as compared to those required for maser amplification) can lead to the cooperative behavior required for superradiance in the ISM. Given the results of our analysis, we expect the observational properties of superradiance to be characterized by the emission of high intensity, spatially compact, burst-like features potentially taking place over short periods ranging from minutes to d...

  15. Dicke's Superradiance in Astrophysics. II -- The OH 1612 MHz Line

    CERN Document Server

    Rajabi, Fereshteh

    2016-01-01

    We apply the concept of superradiance introduced by Dicke in 1954 to the OH molecule 1612 MHz spectral line often used for the detection of masers in circumstellar envelopes of evolved stars. As the detection of 1612 MHz OH masers in the outer shells of envelopes of these stars implies the existence of a population inversion and a high level of velocity coherence, and that these are two necessary requirements for superradiance, we investigate whether superradiance can also happen in these regions. Superradiance is characterized by high intensity, spatially compact, burst-like features taking place over time-scales on the order of seconds to years, depending on the size and physical conditions present in the regions harboring such sources of radiation. Our analysis suggests that superradiance provides a valid explanation for previous observations of intensity flares detected in that spectral line for the U Orionis Mira star and the IRAS18276-1431 pre-planetary nebula.

  16. Testing Brans-Dicke gravity using the Einstein telescope

    Science.gov (United States)

    Zhang, Xing; Yu, Jiming; Liu, Tan; Zhao, Wen; Wang, Anzhong

    2017-06-01

    Gravitational radiation is an excellent field for testing theories of gravity in strong gravitational fields. The current observations on the gravitational-wave (GW) bursts by LIGO have already placed various constraints on the alternative theories of gravity. In this paper, we investigate the possible bounds which could be placed on the Brans-Dicke gravity using GW detection from inspiraling compact binaries with the proposed Einstein Telescope, a third-generation GW detector. We first calculate in detail the waveforms of gravitational radiation in the lowest post-Newtonian approximation, including the tensor and scalar fields, which can be divided into the three polarization modes, i.e., "plus mode," "cross mode," and "breathing mode." Applying the stationary phase approximation, we obtain their Fourier transforms, and derive the correction terms in amplitude, phase, and polarization of GWs, relative to the corresponding results in general relativity. Imposing the noise level of the Einstein Telescope, we find that the GW detection from inspiraling compact binaries, composed of a neutron star and a black hole, can place stringent constraints on the Brans-Dicke gravity. The bound on the coupling constant ωBD depends on the mass, sky position, inclination angle, polarization angle, luminosity distance, redshift distribution, and total observed number NGW of the binary systems. Taking into account all the burst events up to redshift z =5 , we find that the bound could be ωBD≳1 06×(NGW/1 04)1/2. Even for the conservative estimation with 1 04 observed events, the bound is still more than one order tighter than the current limit from Solar System experiments. So, we conclude that the Einstein Telescope will provide a powerful platform to test alternative theories of gravity.

  17. Research on microstructural evolution and dynamic recrystallization behavior of JB800 bainitic steel by FEM

    Institute of Scientific and Technical Information of China (English)

    Qingjun Chen; Yonglin Kang; Hao Yu; Chunmei Wang; Chengxiang Li

    2008-01-01

    Single pass compression tests were conducted on Gleeble1500 thermal simulator. The effect of different deformation parameters on the grain size of dynamically recrystallized austenite was analyzed. A mathematical model of dynamic recrystallization and a material database of JB800 steel, whose tensile strength is above 800 Mpa, were set up. A subprogram was compiled using Fortran language and called by Marc finite element software. A thermal coupled elastoplastic finite element model was established to simulate the compression process. The grain size of recrystallized austenite obtained by different recrystailization models was simulated. The results show that the optimized dynamic recrystallization model of JBS00 bainitic steel has a higher precision and yields good agreement with metallographic observations.

  18. Can Brans-Dicke Scalar Field Account for Dark Energy and Dark Matter?

    Science.gov (United States)

    Arik, M.; Çalik, M. C.

    By using a linearized non-vacuum late time solution in Brans-Dicke cosmology, we account for the 75% dark energy contribution but not for approximately 23% dark matter contribution to the present day energy density of the universe.

  19. Brans--Dicke cosmology does not have the $\\Lambda$CDM phase as an universal attractor

    CERN Document Server

    García-Salcedo, Ricardo; Quiros, Israel

    2015-01-01

    In this paper we seek for relevant information on the asymptotic cosmological dynamics of the Brans--Dicke theory of gravity for several self-interaction potentials. By means of the simplest tools of the dynamical systems theory, it is shown that the general relativity de Sitter solution is an attractor of the Jordan frame (dilatonic) Brans--Dicke theory only for the exponential potential $U(\\vphi)\\propto\\exp\\vphi$, which corresponds to the quadratic potential $V(\\phi)\\propto\\phi^2$ in terms of the original Brans--Dicke field $\\phi=\\exp\\vphi$, or for potentials which asymptote to $\\exp\\vphi$. At the stable de Sitter critical point, as well as at the stiff-matter equilibrium configurations, the dilaton is necessarily massless. We find bounds on the Brans--Dicke coupling constant $\\omega_\\textsc{bd}$, which are consistent with well-known results.

  20. Amplification of Gravitational Waves During Inflation in Brans-Dicke Theory

    CERN Document Server

    Berman, M S; Berman, Marcelo S.; Trevisan, Luis A.

    2001-01-01

    We show that Gravitational Waves are exponetially amplified in the inflationary phase in Brans-Dicke theory, so that it would be possible to detect them and in this way verify several features of physical reality.

  1. Making Dick and Jane: Historical Genesis of the Modern Basal Reader.

    Science.gov (United States)

    Luke, Allan

    1987-01-01

    This article traces the development of the Dick and Jane texts, examining the dominent intellectual and economic considerations of their authors and publishers in order to demystify their transmission of values, beliefs, and meanings. (MT)

  2. Evolution of the Brans-Dicke Parameter in Generalized Chameleon Cosmology

    Institute of Scientific and Technical Information of China (English)

    Mubasher Jami; D.Momeni

    2011-01-01

    @@ Motivated by an earlier study of Sahoo and Singh[Mod.Phys.Lett.A 17(2002)2409],we investigate the time dependence of the Brans-Dicke parameter ω(t)for an expanding Universe in the generalized Brans-Dicke Chameleon cosmology,and obtain an explicit dependence of ω(t)in different expansion phases of the Universe.Also,we discuss how the observed accelerated expansion of the observable Universe can be accommodated in the present formalism.%Motivated by an earlier study of Sahoo and Singh [Mod. Phys. Lett. A 17(2002)2409], we investigate the time dependence of the Brans-Dicke parameter ui(t) for an expanding Universe in the generalized Brans-Dicke Chameleon cosmology, and obtain an explicit dependence of uj(t) in different expansion phases of the Universe. Also, we discuss how the observed accelerated expansion of the observable Universe can be accommodated in the present formalism.

  3. Basic Fibroblast Growth Factor Regulates Persistent ERK Osciliations in Premaligant but not Malignant JB6 Cells

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.

    2010-05-02

    basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.

  4. Henry James – Modern Theoretician of Narration

    Directory of Open Access Journals (Sweden)

    Alexandra - Denisa IGNA

    2013-01-01

    Full Text Available Henry James, properly named world writer, was one of the first modern novelists, with an exigent writing conscience. The American writer subverted the prejudgement of the omniscient author in favour of the narration which is centred on the characters’ point of view, thus modernising the novel before V. Woolf, Huxley, Thomas Mann, or in our case Camil Petrescu and G. Călinescu. Some bio-bibliographical information familiarises the reader with the life and work of this writer. The larger part of the article is dedicated to a case study of the novel with the metaphorical title: The Figure in the Carpet, where Henry James tries to illustrate in an artistic manner his conception regarding the profundity and ineffability of the literary creation. The conclusion which the author reaches, alternating the familiar plan of the relationship between a married couple with the esthetical plan, is that the relationship between writer and his work represents an act of fully intimacy, just like a ceremony that takes place in the wedding night

  5. Realization of the Dicke model using cavity-assisted Raman transitions

    CERN Document Server

    Baden, Markus P; Grimsmo, Arne L; Parkins, Scott; Barrett, Murray D

    2014-01-01

    We realize an open version of the Dicke model by coupling two hyperfine ground states using two cavity-assisted Raman transitions. The interaction due to only one of the couplings is described by the Tavis-Cummings model and we observe a normal mode splitting in the transmission around the dispersively shifted cavity. With both couplings present the dynamics are described by the Dicke model and we measure the onset of superradiant scattering into the cavity above a critical coupling strength.

  6. Realization of the Dicke model using cavity-assisted Raman transitions.

    Science.gov (United States)

    Baden, Markus P; Arnold, Kyle J; Grimsmo, Arne L; Parkins, Scott; Barrett, Murray D

    2014-07-11

    We realize an open version of the Dicke model by coupling two hyperfine ground states using two cavity-assisted Raman transitions. The interaction due to only one of the couplings is described by the Tavis-Cummings model and we observe a normal mode splitting in the transmission around the dispersively shifted cavity. With both couplings present the dynamics are described by the Dicke model and we measure the onset of superradiant scattering into the cavity above a critical coupling strength.

  7. Responses of the Brans-Dicke field due to gravitational collapses

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Dong-il; Yeom, Dong-han, E-mail: enotsae@gmail.co, E-mail: innocent@muon.kaist.ac.k [Department of Physics, KAIST, Daejeon 305-701 (Korea, Republic of)

    2010-10-21

    We study responses of the Brans-Dicke field due to gravitational collapses of scalar field pulses using numerical simulations. Double-null formalism is employed to implement the numerical simulations. If we supply a scalar field pulse, it will asymptotically form a black hole via dynamical interactions of the Brans-Dicke field. Hence, we can observe the responses of the Brans-Dicke field by two different regions. First, we observe the late time behaviors after the gravitational collapse, which include formations of a singularity and an apparent horizon. Second, we observe the fully dynamical behaviors during the gravitational collapse and view the energy-momentum tensor components. For the late time behaviors, if the Brans-Dicke coupling is greater (or smaller) than -1.5, the Brans-Dicke field decreases (or increases) during the gravitational collapse. Since the Brans-Dicke field should be relaxed to the asymptotic value with the elapse of time, the final apparent horizon becomes time-like (or space-like). For the dynamical behaviors, we observed the energy-momentum tensors around {omega} {approx} -1.5. If the Brans-Dicke coupling is greater than -1.5, the T{sub uu} component can be negative at the outside of the black hole. This can allow an instantaneous inflating region during the gravitational collapse. If the Brans-Dicke coupling is less than -1.5, the oscillation of the T{sub vv} component allows the apparent horizon to shrink. This allows a combination that violates weak cosmic censorship. Finally, we discuss the implications of the violation of the null energy condition and weak cosmic censorship.

  8. Experimental violation of the local realism for four-qubit Dicke state.

    Science.gov (United States)

    Zhao, Yuan-Yuan; Wu, Yu-Chun; Xiang, Guo-Yong; Li, Chuan-Feng; Guo, Guang-Can

    2015-11-16

    Dicke state is an widely used type of multi-particle entangled state in quantum information. However, very few works have been done on its nonlocality. Here we prepare a four-photon symmetric Dicke state, whose fidelity is as high as 0.904 ± 0.004, and devise a simple Bell-type inequality to demonstrate that it violates the local realism with 12 standard deviation.

  9. Through A Scanner Darkly: Neuropsychology and psychosis in Philip K. Dick's novel "A Scanner Darkly"

    OpenAIRE

    Bell, V.

    2006-01-01

    Partly motivated by his increasing brushes with psychosis, by the early 1970s the science fiction author Philip K. Dick was struggling with increasing doubts over the nature of reality and personal identity. Perhaps unsurprisingly, characters with unstable worlds and existential doubts are a familiar focus of his work. Dick was interested in more than just description however, and often used his novels to explore personal theories of existence. During his research, he discovered the work of R...

  10. An Analysis of Humanity Reflected in O.Henry's Works

    Institute of Scientific and Technical Information of China (English)

    范月红

    2008-01-01

    O. Henry was one of the greatest American short story writers, and most of his works had a theme on humanity. This paper appreciates some of O. Henry's popular short stories and tries to explore the humanity re-flected in them.

  11. The Attack on Panama City by Henry Morgan

    Science.gov (United States)

    1998-06-05

    1991) : 44- 49. 28 CHAPTER 3 HENRY MORGAN Henry Morgan was born in Whales in 1635. Not much is known about his childhood . Most accounts claim that...was between a Frenchman and an Englishman. The Englishman killed the Frenchman from behind as they prepared to duel . All the Frenchmen in Morgan’s

  12. Selective strategies for antibiotic fermentation, Part II: Effect of aeration on streptomycin production by Streptomyces griseus JB-19.

    Science.gov (United States)

    Maladkar, N K

    1991-01-01

    The effect of higher aerated fermentation medium which enhanced streptomycin production by Streptomyces griseus JB-19 was found mainly related to the changes in dextrose consumption, inorganic phosphate utilisation and ammonia nitrogen accumulation under optimal and suboptimal supply of soluble vegetative protein.

  13. Characterization of a G1 inhibitor from old JB-1 ascites tumor fluid. Interaction with polyions and ion exchangers.

    Science.gov (United States)

    Barfod, N M; Bichel, P

    1976-09-17

    In most experimental ascites tumors the growth rate decreases with increasing age and cell number. This decrease is caused by a prolongation of the cell cycle and an increasing accumulation of noncycling cells in resting (or quiescent) G1 and G2 compartments. In cell-free ascitic fluid from the JB-1 ascites tumor in the plateau phase of growth, low molecular weight substances have been found which reversibly and specifically arrest JB-1 cells in G1 and G2. In order to characterize the JB-1 G1 inhibitor we have investigated the effect of ion exchangers and polyions on the activity of this inhibitor assayed in vitro by means of a partially synchronized JB-1 cell population analyzed by flow microfluorometry. The results indicate that polyanions and cation exchangers (immobilized polyanions) bind and abolish the G1-inhibitory activity. From this it is suggested that the G1 inhibitor is of a basic or polycationic nature. Since anion exchangers (immobilized polycations) are without effect on this activity it was surprising to find that polycations also neutralize the activity. The results indicate that this occurs by blocking an anionic G2-inhibitor receptor on the cell, thus preventing the polycationic G1 inhibitor from being bound to this receptor.

  14. Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.

    Science.gov (United States)

    Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E

    1999-01-20

    JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999

  15. Henry Norris Russell and the Expanding Universe

    CERN Document Server

    DeVorkin, David H

    2013-01-01

    Henry Norris Russell, one of the most influential American astronomers of the first half of the 20th Century, had a special place in his heart for the Lowell Observatory. Although privately critical of the founder for his pronouncements about life on Mars and the superiority of the Mars Hill observing site, he always supported the Observatory in public and professional circles. He staunchly supported Tombaugh's detection of a planet as leading from Lowell's prediction, and always promoted V. M. Slipher's spectroscopic investigations of planetary and stellar phenomena. But how did he react to Slipher's puzzling detection of the extreme radial velocities of spiral nebulae starting in 1912, and how did he regard the extension and interpretation of those observations by Hubble and others in following decades? Here we describe the arc of Russell's reactions, dating from Slipher's first detection, as an indicator of how mainstream stellar astronomers reacted to the concept of an expanding universe.

  16. The development of Lewis Henry Morgan's evolutionism.

    Science.gov (United States)

    Kuper, A

    1985-01-01

    Lewis Henry Morgan never used the term evolution in any of his major sociological works. If he may be labeled an evolutionist, the specificity of his views must be taken into account. The main "evolutionist" issue that concerned him was that of the unity or diversity of the human species. This was an urgent political and theological issue in the America of his day, and it impinged also on research on the American Indians. Morgan's first major study was designed to demonstrate the unity of origin of the American aborigines and their "Asian" origins. His methods were derived from the tradition of Indo-European philology. It was virtually as an afterthought that he added a social evolutionary component to what he conceived of as an exercise in philology. Later he came under the direct influence of the English evolutionists, and this was crucial for the conception of Ancient Society.

  17. Obituary: Henry Albers (1925-2009)

    Science.gov (United States)

    Chromey, Fred

    2011-12-01

    Henry Albers, professor of astronomy at Vassar College for over thirty years, died March 29, 2009, in Fairhope, Alabama. For his work at Vassar, where he held the Maria Mitchell Chair, Albers received the first Maria Mitchell Women in Science Award for his inspiration of women astronomers. He said "In the final analysis it is the students who bring the joy into teaching." As a professional astronomer, Albers did observational work on Galactic structure in the southern Milky Way, and on the structure of the Magellanic Clouds. In retirement, Albers published Maria Mitchell - A Life in Journals and Letters, the firsthand account of America's first woman astronomer. Albers's research was on photographic near-infrared spectroscopy of red giant stars in the southern Milky Way, some proper motion studies, and on the structure of the Magellanic Clouds. A series of seven NSF grants supported his six trips to Chile to make spectroscopic observations, as well as his sabbatical collaborations at Minnesota, Leiden, and the Royal Observatory in Edinburgh. Henry Albers arrived at Vassar in 1958, to find an astronomy program that had been recently absorbed by the physics department, and that was suffering neglect after the retirement of Maud Makemson. For the next 31 years, with incredible energy -- he sometimes taught seven courses a year -- he built the astronomy program into one double in size (from one to two tenure lines), whose th century facilities have been replaced with a st century observatory. For a remarkable stretch of 20-some-years, Albers and physicist Bob Stearns, with considerable grace, alternated chairmanship of the joint department of physics and astronomy. Henry Albers was a devoted citizen of Vassar College and an enthusiastic participant in the process of faculty governance at that institution. He would have been the first to concede that his enthusiasm was sometimes excessive, and that his contributions at faculty meetings occasionally failed to move the

  18. Dicke subradiance in a large cloud of cold atoms

    CERN Document Server

    Guerin, William; Kaiser, Robin

    2015-01-01

    More than 60 years ago, Dicke published a seminal paper on coherence in spontaneous radiation process by a collection of atoms. Superradiance has since attracted a lot of interest, from its first experimental observation in a fully inverted system in the 1970s to single photon superradiance in the 2000s. Subradiance, on the contrary, has remained elusive, mainly because subradiant states are weakly coupled to the environment and are very sensitive to non radiative decoherence processes. They are thus much harder to populate and to observe. Avoiding decoherence effects by using a dilute cloud of laser-cooled atoms containing a large number of atoms, we report on direct observation of subradiance. In our experiment, we use a far detuned laser to avoid multiple scattering and detect the temporal decay after a sudden switch-off of the laser beam. After the fast decay of most of the fluorescence, we observe a very slow decay, with time constants as long as 100 times the natural lifetime of the excited state of ind...

  19. [A legend of tropical veterinary medicine: Dick Zwart].

    Science.gov (United States)

    Dwinger, Ron; Uilenberg, Gerrit

    2014-01-01

    An overview is given of the achievements of Professor Dr. D. Zwart (1930-2005). Following a brief introduction dealing with his background, his first eleven years of working in tropical countries are reviewed. Initially he was employed as a government veterinarian in Dutch New Guinea, followed by five years as a scientist at the agricultural faculty in Kumasi, Ghana, where he completed his PhD on liver cirrhosis in local pigs. He was seconded by the Department of Tropical Veterinary Medicine at Utrecht University to work as a virologist in Vom, Nigeria. Once back in The Netherlands, he was selected to take over the position of head of the Department due to the unexpected death of Professor S. G. Wilson. He stayed for 20 years at Utrecht University and was for another nine years department head at the Agricultural University of Wageningen. He was an influential man during this long period as department head, not only for his students, but also in the international field. Four aspects of the achievements by Dick are highlighted in detail: as a scientist, as an educator, as a stimulating figure, and as a visionary.

  20. The Critical Point Entanglement and Chaos in the Dicke Model

    Directory of Open Access Journals (Sweden)

    Lina Bao

    2015-07-01

    Full Text Available Ground state properties and level statistics of the Dicke model for a finite number of atoms are investigated based on a progressive diagonalization scheme (PDS. Particle number statistics, the entanglement measure and the Shannon information entropy at the resonance point in cases with a finite number of atoms as functions of the coupling parameter are calculated. It is shown that the entanglement measure defined in terms of the normalized von Neumann entropy of the reduced density matrix of the atoms reaches its maximum value at the critical point of the quantum phase transition where the system is most chaotic. Noticeable change in the Shannon information entropy near or at the critical point of the quantum phase transition is also observed. In addition, the quantum phase transition may be observed not only in the ground state mean photon number and the ground state atomic inversion as shown previously, but also in fluctuations of these two quantities in the ground state, especially in the atomic inversion fluctuation.

  1. Dark Energy From Fifth Dimensional Brans-Dicke Theory

    CERN Document Server

    Bahrehbakhsh, Amir F; Vakili, Hajar

    2013-01-01

    Following the approach of the induced-matter theory, we investigate the cosmological implications of a five-dimensional Brans-Dicke theory, and propose to explain the acceleration of the universe. After inducing in a four-dimensional hypersurface, we classify the energy-momentum tensor into two parts in a way that, one part represents all kind of the matter (the baryonic and dark) and the other one contains every extra terms emerging from the scale factor of the fifth dimension and the scalar field, which we consider as the energy-momentum tensor of dark energy. We also separate the energy-momentum conservation equation into two conservation equations, one for matter and the other for dark energy. We perform this procedure for different cases, without interacting term and with two particular (suitable) interacting terms between the two parts. By assuming the parameter of the state equation for dark energy to be constant, the equations of the model admit the power-law solutions. Though, the non-interacting cas...

  2. Quantized Brans Dicke Theory: Phase Transition and Strong Coupling Limit

    CERN Document Server

    Pal, Sridip

    2016-01-01

    We show that Friedmann-Robertson-Walker (FRW) geometry with flat spatial section in quantized (Wheeler deWitt quantization) Brans Dicke (BD) theory reveals a rich phase structure owing to anomalous breaking of a classical symmetry, which maps the scale factor $a\\mapsto\\lambda a$ for some constant $\\lambda$. In the weak coupling ($\\omega$) limit, the theory goes from a symmetry preserving phase to a broken phase. The existence of phase boundary is an obstruction to another classical symmetry [arXiv:gr-qc/9902083] (which relates two BD theory with different coupling) admitted by BD theory with scale invariant matter content i.e $T^{\\mu}{}_{\\mu}=0$. Classically, this prohibits the BD theory to reduce to General Relativity (GR) for scale invariant matter content. We show that strong coupling limit of BD and GR both preserves the symmetry involving scale factor. We also show that with a scale invariant matter content (radiation i.e $P=\\frac{1}{3}\\rho$), the quantized BD theory does reduce to GR as $\\omega\\rightarr...

  3. Transformation and tumor promoter sensitive phosphoproteins in JB-6 mouse epidermal cells: one is also sensitive to heat stress.

    Science.gov (United States)

    Gindhart, T D; Stevens, L; Copley, M P

    1984-09-01

    JB-6 mouse epidermal cells undergo irreversible transformation when exposed to tumor-promoting agents such as 12-O-tetradecanoyl-phorbol-13-acetate (TPA). Phosphoprotein changes related to transformation were sought in four tumor cell lines related to JB-6 cells. Two dimensional polyacrylamide gel electrophoresis showed altered abundances of five phosphoproteins in the tumor cell lines compared with five untransformed clones. The mol. wt. in Kilodaltons and isoelectric points in pH units were: 120/6.0, 80/4.5, 55/6.5, 37/5.0 and 23-25/4.5. In all four transformants pp80 was markedly decreased and the pp23-25 doublet increased. In two of the four transformants pp120 and pp55 were increased and pp37 decreased. Treatment of untransformed clones with TPA affected only one of the phosphoproteins altered in the transformants. Treatment of untransformed clones with TPA produced a 2-fold increase in pp80 after 5 h. pp80 returned to baseline levels by 24 h and changed little in the continuous presence of TPA for up to 96 h. The increase in pp80 with short term TPA treatment occurred in all of the untransformed clones but none of four transformants. Late preneoplastic (P+) JB-6 cells only require treatment with a tumor promoter to transform. Early preneoplastic (P-) JB-6 cells require prior transfection of DNA from late preneoplastic JB-6 cells to transform in response to tumor promoter treatment. Quantitative analysis of pp80 in early preneoplastic, late preneoplastic, and tumor cell lines showed an inverse relationship between the level of pp80 and degree of preneoplastic progression in these cells. pp80 represents approximately 2% of total cellular phosphoprotein in JB-6 cells, shows microheterogeneity of both mol. wt. and isoelectric point, occurs in the particulate fraction of cells and is readily solubilized by 1% Triton. pp80 is increased by heat stress and shares other properties with the recently described mammalian heat stress protein, hsp 80. pp80's decrease in

  4. Calmodulin Involvement in Stress-Activated Nuclear Localization of Albumin in JB6 Epithelial Cells.

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Negash, Sewite; Smallwood, Heather S.; Ramos, Kenneth S.; Thrall, Brian D.; Squier, Thomas C.

    2004-06-15

    We report that in response to oxidative stress, albumin is translocated to the nucleus where it binds in concert with known transcription factors to an antioxidant response element (ARE), which controls the expression of glutathione-S-transferase and other antioxidant enzymes, functioning to mediate adaptive cellular responses. To investigate the mechanisms underlying this adaptive cell response, we have identified linkages between calcium signaling and the nuclear translocation of albumin in JB6 epithelial cells. Under resting conditions, albumin and the calcium regulatory protein, calmodulin (CaM), co-immunoprecipitate using antibodies against either protein, indicating a tight association. Calcium activation of CaM disrupts the association between CaM and albumin, suggesting that transient increases in cytosolic calcium levels function to mobilize intracellular albumin to facilitate its translocation into the nucleus. Likewise, nuclear translocation of albumin is induced by exposure of cells to hydrogen peroxide or a phorbol ester, indicating a functional linkage between reactive oxygen species, calcium, and PKC-signaling pathways. Inclusion of an antioxidant enzyme (i.e., superoxide dismutase) blocks nuclear translocation, suggesting that the oxidation of sensitive proteins functions to coordinate the adaptive cellular response. These results suggest that elevated calcium transients, and associated increases in reactive oxygen species, contribute to adaptive cellular responses through the mobilization and nuclear translocation of cellular albumin to mediate the transcriptional regulation of antioxidant responsive elements.

  5. Tablet PCs in engineering mathematics courses at the J.B. Speed School of Engineering

    Science.gov (United States)

    Hieb, Jeffrey L.; Ralston, Patricia A. S.

    2010-06-01

    In fall 2007, J.B. Speed School of Engineering at the University of Louisville joined the ranks of universities requiring the purchase of Tablet PCs for all new entering students. This article presents a description of how the Department of Engineering Fundamentals incorporated Tablet PCs into their instruction, a review of the literature pertaining to the use of Tablet PCs for instruction and preliminary survey results from the students in engineering mathematics courses at the end of the first year, after students had been exposed to Tablet PCs for 1 year. Results show that a large majority of students in the Department of Engineering Fundamentals agree that presentation of engineering mathematics material using the Tablet PCs and DyKnow software is a vast improvement over overhead projector, blackboard, or PowerPoint lectures and course packs. However, students are split as to whether the Tablet PC is something they actually want to use for their own note-taking. Finally, a plan for assessment of tablet impact on student learning is presented.

  6. Lack of evidence of chalone activity in used medium and extract of JB-1 tumor cells in vitro. A flow cytometry study.

    Science.gov (United States)

    Naeser, F K; Barfod, N M; Bichel, P

    1978-02-14

    In cell-free mouse ascites fluid from the JB-1 ascites tumor in the plateau phase of growth low-molecular chalone substances have been found which reversibly and specifically arrest JB-1 cells in the G1 and G2 phase of the cell cycle. The aim of this study was to investigate whether chalones were involved in the regulation of in vitro growth of JB-1 tumor cells. Used medium and cell extract from confluent, stationary JB-1 cell cultures were investigated for proliferation-inhibitory properties. JB-1 cells from stationary cultures were explanted in test cultures and the traverse of cells through the S phase was investigated by means of flow cytometry (FCM). Inhibition--expressed as a delay of the traverse of cells through the S phase--was not observed when a surplus of used medium, concentrated and fractionated used medium or concentrated and fractionated cell extract from JB-1 cells in vitro was added to test cultures. On the contrary, used medium and concentrated and fractionated used medium stimulated growth. Thus, no involvement of chalones in the growth regulation of JB-1 tumor cells in vitro was detected.

  7. New agegraphic dark energy in Brans-Dicke theory with logarithmic form of scalar field

    CERN Document Server

    Kumar, Pankaj

    2016-01-01

    In a very recent paper, the current authors (arXiv:gr-qc/1609.01477) have proposed and analyzed in detail the logarithmic form of Brans-Dicke scalar field $\\phi$ as $\\phi \\propto ln(\\alpha+\\beta a)$, where $\\alpha$ and $\\beta$ are positive constants, to alleviate the problems of interacting holographic dark energy models in Brans-Dicke theory. In this paper, the cosmological evolution of a new agegraphic dark energy (NADE) model within the framework of Friedmann-Robertson-Walker Universe is analyzed with the same form of scalar field in Brans-Dicke theory. We derive the equation of state parameter $w_D$ and deceleration parameter $q$ of NADE model. It is observed that $w_D\\rightarrow -1$ when $a\\rightarrow \\infty$, i.e., the NADE mimics cosmological constant in the late time evolution. Indeed, due to the assumption of logarithmic form of Brans-Dicke scalar field the NADE in Brans-Dicke theory behaves like NADE in general relativity in the late time evolution. The NADE model shows a phase transition from matte...

  8. The Earliest Master: Henry Johnson (1867-1953).

    Science.gov (United States)

    Robinson, Paul

    1982-01-01

    The writings, teachings, scholarship, and contributions of Henry Johnson, considered the "foremost leader in the development of the teaching of history and social studies as a field of specialization" are discussed. (PN)

  9. NOAA Ship Henry B. Bigelow Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Henry B. Bigelow Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...

  10. Parcels and Land Ownership, Published in 2011, Henry County Government.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Parcels and Land Ownership dataset as of 2011. The extent of these data is generally Henry County, IA. This metadata was auto-generated through the Ramona GIS...

  11. Long-lived entangled qudits in a trapped three-level ion beyond the Lamb-Dicke limit

    Energy Technology Data Exchange (ETDEWEB)

    Dermez, Rasim [Department of Physics, Afyon Kocatepe University, Afyonkarahisar 03200 (Turkey); Muestecaplioglu, Oezguer E [Department of Physics, Koc University, Sariyer, Istanbul 34450 (Turkey)], E-mail: dermez@aku.edu.tr

    2009-01-15

    Higher dimensional quantum entanglement in a trapped three-level ion interacting with two laser beams in {lambda} scheme is investigated beyond the Lamb-Dicke limit. It is shown that higher dimensional entanglement can be established in a single step, with a tunable dimensionality and duration via the Lamb-Dicke parameter.

  12. 77 FR 35373 - Duke Energy Dicks Creek, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2012-06-13

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Duke Energy Dicks Creek, LLC; Supplemental Notice That Initial Market-Based... above-referenced proceeding of Duke Energy Dicks Creek, LLC's application for market-based...

  13. Squeezing properties of a trapped ion in the running-wave laser beyond the Lamb-Dicke limit

    Institute of Scientific and Technical Information of China (English)

    Pan Chang-Ning; Fang Mao-Fa; Zheng Xiao-Juan; Hu Yao-Hua

    2007-01-01

    Beyond the Lamb-Dicke limit, this paper investigates the squeezing properties of the trapped ion in the travelling-wave laser. It shows that the squeezing properties of the trapped ion in the travelling-wave laser are strongly affected by the sideband number k, the Lamb- Dicke parameterηand the initial average phonon number.

  14. Bioremediation of Petrochemical Wastewater Containing BTEX Compounds by a New Immobilized Bacterium Comamonas sp. JB in Magnetic Gellan Gum.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan

    2015-05-01

    In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.

  15. Fighting desires: Henry Miller's Queer Tropic.

    Science.gov (United States)

    Hardin, Michael

    2002-01-01

    "Fighting Desires: Henry Miller's Queer Tropic" is an investigation of Tropic of Cancer that investigates the deeply repressed homoerotic desire that periodically surfaces. This reading is dependent upon an interpretation of Eve Sedgwick that proposes male sexuality as a continuum. By looking at the nature of the male-male relationships, as well as the lack of emotion and presence in the male-female relationships, I will show that the most intimate relationships are between men, and that these relationships are expressed through the telling of stories about (heterosexual) sex; this is the function of women within the novel: one has sex with a woman, not for the pleasure that the act brings, but for the pleasure that the recounting of the story to other men brings. Furthermore, I will look at Miller's use of puns within the novel and how they also contribute to a homoerotic reading. None of this is to argue that Miller was not homophobic and sexist--Miller very clearly was--the purpose of this essay is to show the complex nature of sexuality, even within a protagonist who asserts a very defined heterosexuality.

  16. Henry Head and the Theatre of Reverie

    Directory of Open Access Journals (Sweden)

    Tiffany Watt-Smith

    2011-04-01

    Full Text Available In 1903, the neurologist Henry Head (1861-1940 embarked on a painful self-experiment, in which he severed the radial nerve of his left arm, and then charted the gradual and faltering return of sensitivity to the limb over the next four and a half years. To directly experience his own sensations, Head entered into a trance-like state of distraction or reverie he called a ‘negative attitude of attention’. This article explores Head’s peculiar technique for looking within, and argues that while introspection was an established strategy in psychological laboratories, Head’s reverie also resonated with techniques associated with actors and theatrical audiences during this period. Viewing psychological self-experimentation through the lens of theatre, this article makes visible aspects of Head’s embodied, affective laboratory encounters, often obscured in accounts of his experiment. At the same time, it proposes that the broader historical and cultural significance of Head’s experiment lies in his attempt to observe himself by producing states of inattention and reverie at will, mental ‘attitudes’ that were themselves the subject of a rapidly evolving debate in scientific and aesthetic circles at the turn of the twentieth century.

  17. L'Abbe Henri Breuil: Archaeologist

    Directory of Open Access Journals (Sweden)

    Lawrence Guy Straus

    1992-05-01

    Full Text Available In his otherwise excellent book, A History of Archaeological Thought, Trigger (1989: 156 makes only one passing reference in a half-sentence to the central figure in the development of Paleolithic prehistory in the first half of the 20th century -- and manages to get his name wrong, confusing Henri Breuil with his long-time, close colleague, Hugo Obenrnaie . Thirty years after his death, Breuil's role in the history of Old World prehistory required more serious consideration. He was a seminal figure not only in rock art studies, but also in the archaeology of at least France, Spain, England, Portugal, South Africa, and China. Before I had read Trigger's work or Sackett's (1991 critique of my supposed misinterpretation of Breuil's theoretical stance (e.g., Straus 1986, 1987, I had presented a review of Breuil's contributions in the 1991 Annual Snead-Wertheim Lecture in Anthropology and History at the University of New Mexico (Straus n.d.. The following is a brief summary of some of my conclusions.

  18. Victor Henri: 111 years of his equation.

    Science.gov (United States)

    Cornish-Bowden, Athel; Mazat, Jean-Pierre; Nicolas, Serge

    2014-12-01

    Victor Henri's great contribution to the understanding of enzyme kinetics and mechanism is not always given the credit that it deserves. In addition, his earlier work in experimental psychology is totally unknown to biochemists, and his later work in spectroscopy and photobiology almost equally so. Applying great rigour to his analysis he succeeded in obtaining a model of enzyme action that explained all of the observations available to him, and he showed why the considerable amount of work done in the preceding decade had not led to understanding. His view was that only physical chemistry could explain the behaviour of enzymes, and that models should be judged in accordance with their capacity not only to explain previously known facts but also to predict new observations against which they could be tested. The kinetic equation usually attributed to Michaelis and Menten was in reality due to him. His thesis of 1903 is now available in English. Copyright © 2014 Elsevier B.V. and Société française de biochimie et biologie Moléculaire (SFBBM). All rights reserved.

  19. James Henry Greathead and the London Underground

    Directory of Open Access Journals (Sweden)

    Laurence Wright

    2017-01-01

    Full Text Available This article investigates the origins and early history of the device known as the ‘Greathead Shield’, an important innovation in Victorian engineering crucial to constructing the London Underground. The aim is to explore the basis on which, many years later, a South African engineer, James Henry Greathead, was accorded prominent public acknowledgment, in the form of a statue, for ‘inventing’ the Shield. From a cultural studies perspective, how is the meaning of ‘invention’ to be understood, given that several other brilliant engineers were involved? The question is adjudicated using the notion of cultural ‘extelligence’, seen in relation to several contemporary and historical accounts, including Greathead’s own record of his achievements in the proceedings of the Institution of Civil Engineers and presented in The City and South London Railway (1896, edited by James Forrest. The paper was first delivered at the conference on ‘Novelty and Innovation in the Nineteenth Century’ held at the North-West University in May 2016.

  20. Holographic dark energy in Brans-Dicke cosmology with chameleon scalar field

    Energy Technology Data Exchange (ETDEWEB)

    Setare, M.R., E-mail: rezakord@ipm.i [Department of Science of Bijar, University of Kurdistan, Bijar (Iran, Islamic Republic of); Jamil, Mubasher, E-mail: mjamil@camp.edu.p [Center for Advanced Mathematics and Physics, National University of Sciences and Technology, Rawalpindi 46000 (Pakistan)

    2010-06-07

    We study a cosmological implication of holographic dark energy in the Brans-Dicke gravity. We employ the holographic model of dark energy to obtain the equation of state for the holographic energy density in non-flat (closed) universe enclosed by the event horizon measured from the sphere of horizon named L. Our analysis shows that one can obtain the phantom crossing scenario if the model parameter {alpha} (of order unity) is tuned accordingly. Moreover, this behavior is achieved by treating the Brans-Dicke scalar field as a Chameleon scalar field and taking a non-minimal coupling of the scalar field with matter. Hence one can generate phantom-like equation of state from a holographic dark energy model in non-flat universe in the Brans-Dicke cosmology framework.

  1. Phase-plane analysis of Friedmann-Robertson-Walker cosmologies in Brans-Dicke gravity

    CERN Document Server

    Holden, D J; Holden, Damien J.; Wands, David

    1998-01-01

    We present an autonomous phase-plane describing the evolution of Friedmann-Robertson-Walker models containing a perfect fluid (with barotropic index gamma) in Brans-Dicke gravity (with Brans-Dicke parameter omega). We find self-similar fixed points corresponding to Nariai's power-law solutions for spatially flat models and curvature-scaling solutions for curved models. At infinite values of the phase-plane variables we recover O'Hanlon and Tupper's vacuum solutions for spatially flat models and the Milne universe for negative spatial curvature. We find conditions for the existence and stability of these critical points and describe the qualitative evolution in all regions of the (omega,gamma) parameter space for 0-3/2. We show that the condition for inflation in Brans-Dicke gravity is always stronger than the general relativistic condition, gamma<2/3.

  2. Late time cosmic acceleration from vacuum Brans-Dicke theory in 5D

    CERN Document Server

    de Leon, J Ponce

    2009-01-01

    We show that the scalar-vacuum Brans-Dicke equations in 5D are equivalent to Brans-Dicke theory in 4D with a self interacting potential and an effective matter field. The cosmological implication, in the context of FRW models, is that the observed accelerated expansion of the universe comes naturally from the condition that the scalar field is not a ghost, i.e., $\\omega > - 3/2$. We find an effective matter-dominated 4D universe which shows accelerated expansion if $- 3/2 < \\omega < - 1$. We study the question of whether accelerated expansion can be made compatible with large values of $\\omega$, within the framework of a 5D scalar-vacuum Brans-Dicke theory with variable, instead of constant, parameter $\\omega$. In this framework, and based on a general class of solutions of the field equations, we demonstrate that accelerated expansion is incompatible with large values of $\\omega$.

  3. Nonlinearly charged dilatonic black holes and their Brans-Dicke counterpart: energy dependent spacetime

    Science.gov (United States)

    Hendi, S. H.; Talezadeh, M. S.

    2017-01-01

    Regarding the wide applications of dilaton gravity in the presence of electrodynamics, we introduce a suitable Lagrangian for the coupling of dilaton with gauge field. There are various Lagrangians which show the coupling between scalar fields and electrodynamics with correct special situations. In this paper, taking into account conformal transformation of Brans-Dicke theory with an electrodynamics Lagrangian, we show that how scalar field should couple with electrodynamics in dilaton gravity. In other words, in order to introduce a correct Lagrangian of dilaton gravity, one should check at least two requirements: compatibility with Brans-Dicke theory and appropriate special situations. Finally, we apply the mentioned method to obtain analytical solutions of dilaton-Born-Infeld and Brans-Dicke-Born-Infeld theories with energy dependent spacetime.

  4. Relationship between Humans and Nature in Melville’s Moby Dick

    Institute of Scientific and Technical Information of China (English)

    余奕汶

    2015-01-01

    Herman Melville,with Moby Dick as his masterpiece,is a famous romantic writer.Moby Dick is a "bright pearl" in the literary treasury of the world.By allegorically depicting the cruel killing of whales by the Captain Ahab and other sailors in his whaling ship,and their tragically being drowned in the sea,the writer reveals that if humans are too selfcentered,we will inevitably be punished by nature.Start with the three states that humans get along with nature in Moby Dick,my thesis aims at exploring the transformations of the relationship between humans and nature as well as the edification that humans may gain from the tragic story.

  5. Nonlinearly charged dilatonic black holes and their Brans-Dicke counterpart: Energy dependent spacetime

    CERN Document Server

    Hendi, S H

    2016-01-01

    Regarding the wide applications of dilaton gravity in the presence of electrodynamics, we introduce a suitable Lagrangian for the coupling of dilaton with gauge field. There are various Lagrangians which show the coupling between scalar fields and electrodynamics with correct special situations. In this paper, taking into account conformal transformation of Brans-Dick theory with an electrodynamics Lagrangian, we show that how the scalar field should couple with electrodynamics in dilaton gravity. In other words, in order to introduce a correct Lagrangian of dilaton gravity, one should check at least two requirements: compatibility with Brans-Dick theory and appropriate special situations. Finally, we apply the mentioned method to obtain analytical solutions of dilaton-Born-Infeld and Brans-Dicke-Born-Infeld theories with energy dependent spacetime.

  6. Magnetic point sources in three dimensional Brans-Dicke gravity theories

    CERN Document Server

    Dias, O J C; Dias, Oscar J. C.; Lemos, Jose' P. S.

    2002-01-01

    We obtain geodesically complete spacetimes generated by static and rotating magnetic point sources in an Einstein-Maxwell-Dilaton theory of the Brans-Dicke type in three dimensions (3D). The theory is specified by three fields, the dilaton, the graviton and the electromagnetic field, and two parameters, the cosmological constant and the Brans-Dicke parameter, w. When the Brans-Dicke parameter is infinity, our solution reduces to the magnetic counterpart of the BTZ solution, while the w=0 case is equivalent to 4D general relativity with one Killing vector. The source for the magnetic field can be interpreted as composed by a system of two symmetric and superposed electric charges. One of the electric charges is at rest and the other is spinning.

  7. Antibacterial activity of Pseudonocardia sp. JB05, a rare salty soil actinomycete against Staphylococcus aureus.

    Science.gov (United States)

    Jafari, Nesa; Behroozi, Reza; Farajzadeh, Davoud; Farsi, Mohammad; Akbari-Noghabi, Kambiz

    2014-01-01

    Staphylococcus aureus is a Gram-positive bacterium that causes many harmful and life-threatening diseases. Some strains of this bacterium are resistant to available antibiotics. This study was designed to evaluate the ability of indigenous actinomycetes to produce antibacterial compounds against S. aureus and characterize the structure of the resultant antibacterial compounds. Therefore, a slightly modified agar well diffusion method was used to determine the antibacterial activity of actinomycete isolates against the test microorganisms. The bacterial extracts with antibacterial activity were fractionated by silica gel and G-25 sephadex column chromatography. Also, the active fractions were analyzed by thin layer chromatography. Finally, the partial structure of the resultant antibacterial compound was characterized by Fourier transform infrared spectroscopy. One of the isolates, which had a broad spectrum and high antibacterial activity, was designated as Pseudonocardia sp. JB05, based on the results of biochemical and 16S rDNA gene sequence analysis. Minimum inhibitory concentration for this bacterium was 40 AU mL(-1) against S. aureus. The antibacterial activity of this bacterium was stable after autoclaving, 10% SDS, boiling, and proteinase K. Thin layer chromatography, using anthrone reagent, showed the presence of carbohydrates in the purified antibacterial compound. Finally, FT-IR spectrum of the active compound illustrated hydroxyl groups, hydrocarbon skeleton, and double bond of polygenic compounds in its structure. To the best of our knowledge, this is the first report describing the efficient antibacterial activity by a local strain of Pseudonocardia. The results presented in this work, although at the initial stage in bioactive product characterization, will possibly contribute toward the Pseudonocardia scale-up for the production and identification of the antibacterial compounds.

  8. Proposed realization of the Dicke-model quantum phase transition in an optical cavity QED system

    CERN Document Server

    Dimer, F; Estienne, B; Parkins, A S

    2006-01-01

    The Dicke model consisting of an ensemble of two-state atoms interacting with a single quantized mode of the electromagnetic field exhibits a zero-temperature phase transition at a critical value of the dipole coupling strength. We propose a scheme based on multilevel atoms and cavity-mediated Raman transitions to realise an effective Dicke system operating in the phase transition regime. Output light from the cavity carries signatures of the critical behavior which is analyzed for the thermodynamic limit where the number of atoms is very large.

  9. Thermodynamics of charged rotating solutions in Brans-Dicke gravity with Born-Infeld field

    Science.gov (United States)

    Pakravan, J.; Takook, M. V.

    2017-09-01

    We derive new exact charged rotating solutions of (n+1)-dimensional Brans-Dicke theory in the presence of Born-Infeld field and investigated their properties. Because of the coupling between scalar field and curvature, the field equations cannot to be solved directly. Using a new conformal transformation, which transforms the Einstein-dilaton-Born-Infeld gravity Lagrangian to the Brans-Dicke-Born-Infeld gravity one, the field equations are solved. We also compute temperature, charge, mass, electric potential, and entropy; entropy, however, does not obey the area law. These quantities are invariant under conformal transformation and satisfy the first law of thermodynamics.

  10. Dicke Coherent Narrowing in Two-Photon and Raman Spectroscopy of Thin Vapour Cells

    CERN Document Server

    Dutier, G; Hamdi, I; Maurin, I; Saltiel, S; Bloch, D; Ducloy, M; Dutier, Gabriel; Todorov, Petko; Hamdi, Ismah\\`{e}ne; Maurin, Isabelle; Saltiel, Solomon; Bloch, Daniel; Ducloy, Martial

    2005-01-01

    The principle of coherent Dicke narrowing in a thin vapour cell, in which sub-Doppler spectral lineshapes are observed under a normal irradiation for a l/2 thickness, is generalized to two-photon spectroscopy. Only the sum of the two wave vectors must be normal to the cell, making the two-photon scheme highly versatile. A comparison is provided between the Dicke narrowing with copropagating fields, and the residual Doppler-broadening occurring with counterpropagating geometries. The experimental feasibility is discussed on the basis of a first observation of a two-photon resonance in a 300 nm-thick Cs cell. Extension to the Raman situation is finally considered.

  11. Final Environmental Assessment for Proposed Multi-Purpose Machine Gun Range at Joint Base McGuire-Dix-Lakehurst (JB MDL), New Jersey

    Science.gov (United States)

    2015-09-01

    I resources. This letter and the attached cultura I resources review serves as our response to the request. JB MDL Cultural Resources stall’ has...of potential cultura l resource impacts of the proposed MPMGR. We request concurrence on the above determina£ion. Please call Joe Rhyner at 609-562...attached cultura l resources rev iew serves as our response to the request. JB MDL Cultural Resources staff has determined that there are no historic

  12. Applicability of Henry's Law to helium solubility in olivine

    Science.gov (United States)

    Jackson, C.; Parman, S. W.; Kelley, S. P.; Cooper, R. F.

    2013-12-01

    Applicability of Henry's Law to helium solubility in olivine We have experimentally determined helium solubility in San Carlos olivine across a range of helium partial pressures (PHe) with the goal of quantifying how noble gases behave during partial melting of peridotite. Helium solubility in olivine correlates linearly with PHe between 55 and 1680 bar. This linear relationship suggests Henry's Law is applicable to helium dissolution into olivine up to 1680 bar PHe, providing a basis for extrapolation of solubility relationships determined at high PHe to natural systems. This is the first demonstration of Henry's Law for helium dissolution into olivine. Averaging all the data of the PHe series yields a Henry's coefficient of 3.8(×3.1)×10-12 mol g-1 bar-1. However, the population of Henry's coefficients shows a positive skew (skewness = 1.17), i.e. the data are skewed to higher values. This skew is reflected in the large standard deviation of the population of Henry's coefficients. Averaging the median values from each experiment yields a lower Henry's coefficient and standard deviation: 3.2(× 2.3)×10-12 mol g-1 bar-1. Combining the presently determined helium Henry's coefficient for olivine with previous determinations of helium Henry's coefficients for basaltic melts (e.g. 1) yields a partition coefficient of ~10-4. This value is similar to previous determinations obtained at higher PHe (2). The applicability of Henry's Law here suggests helium is incorporated onto relatively abundant sites within olivine that are not saturated by 1680 bar PHe or ~5×10-9 mol g-1. Large radius vacancies, i.e. oxygen vacancies, are energetically favorable sites for noble gas dissolution (3). However, oxygen vacancies are not abundant enough in San Carlos olivine to account for this solubility (e.g. 4), suggesting the 3x10-12 mol g-1 bar-1 Henry's coefficient is associated with interstitial dissolution of helium. Helium was dissolved into olivine using an externally heated

  13. In memoriam Otto J.B. Hübschle, Chief Veterinary Officer, Namibia

    Directory of Open Access Journals (Sweden)

    Anon.

    2008-09-01

    Full Text Available Otto J.B. Hübschle passed away in Paris on 16 July 2008.Born on 9 October 1945 in Radolfzell, Germany, Otto qualified as a veterinarian from the universities of Munich and Zurich. In 1970, he received a scholarship from the German student exchange programme to study at the Onderstepoort Veterinary Institute where he was awarded the degree of M Med Vet having majored in virology.Otto Hübschle worked in the Virology section at Onderstepoort for several years. In 1976, he joined the Federal Research Institute for Virus Animal Diseases in Tübingen where he worked on foot and mouth disease and other airborne viral diseases. During this period he obtained the Dr Med Vet and Fachtierarzt qualifications (specialist microbiology/ serology. He also worked on different developmental projects in Madagascar and Kenya as was a consultant to the European Union.In 1983, he was appointed Deputy Director responsible for the Central Veterinary Laboratory (CVL in Windhoek. Under his guidance, the laboratory was entirely renovated and new sections were introduced, such as the rabies diagnostic and molecular biology sections. He was a prolific researcher who authored or co-authored over 60 scientific papers.In 2006, Otto Hübschle was appointed Chief Veterinary Officer, a position he held until his untimely death. During this time, he strived to achieve freedom for the communal areas of Namibia from foot and mouth disease and contagious bovine pleuropneumonia to provide farmers with greater access to local, regional and international markets for animals and animal products. Otto Hübschle was a man of science who faithfully served his country of adoption and its livestock industry for many years. As Head of the CVL in Windhoek and then Chief Veterinary Officer, he succeeded in elevating the Namibian Veterinary Services to the status of an internationally recognised institution. He will be missed not only by his family, his Namibian colleagues and friends but also

  14. Classical and quantum solutions in Brans-Dicke cosmology with a perfect fluid

    Science.gov (United States)

    Paliathanasis, Andronikos; Tsamparlis, Michael; Basilakos, Spyros; Barrow, John D.

    2016-02-01

    We consider the application of group invariant transformations in order to constrain a flat isotropic and homogeneous cosmological model, containing a Brans-Dicke scalar field and a perfect fluid with a constant equation of state parameter w , where the latter is not interacting with the scalar field in the gravitational action integral. The requirement that the Wheeler-DeWitt equation be invariant under one-parameter point transformations provides us with two families of power-law potentials for the Brans-Dicke field, in which the powers are functions of the Brans-Dicke parameter ωBD and the parameter w . The existence of the Lie symmetry in the Wheeler-DeWitt equation is equivalent to the existence of a conserved quantity in field equations and with oscillatory terms in the wave function of the Universe. This enables us to solve the field equations. For a specific value of the conserved quantity, we find a closed-form solution for the Hubble factor, which is equivalent to a cosmological model in general relativity containing two perfect fluids. This provides us with different models for specific values of the parameters ωBD , and w . Finally, the results hold for the specific case where the Brans-Dicke parameter ωBD is zero, that is, for the O'Hanlon massive dilaton theory and, consequently, for f (R ) gravity in the metric formalism.

  15. Can Brans-Dicke scalar field account for dark energy and dark matter?

    CERN Document Server

    Calik, M A M C

    2005-01-01

    By using a linearized non-vacuum late time solution in Brans-Dicke cosmology we account for the seventy five percent dark energy contribution but not for approximately twenty-three percent dark matter contribution to the present day energy density of the universe.

  16. Can a Hyperbolic Phase of the Brans-Dicke Field Account for Dark Matter?

    Science.gov (United States)

    Arik, M.; Çalik, M.; Çifter, F.

    We show that the introduction of a hyperbolic phase of the Brans-Dicke (BD) field results in a flat vacuum cosmological solution of the Hubble parameter H and a fractional rate of change of the BD scalar field F, which asymptotically approach constant values. At later stages, the hyperbolic phase of the BD field behaves like dark matter.

  17. Can hyperbolic phase of Brans-Dicke field account for Dark Matter?

    CERN Document Server

    Arik, M; Cifter, F

    2008-01-01

    We show that the introduction of a hyperbolic phase for Brans-Dicke (BD) field results in a flat vacuum cosmological solution of Hubble parameter H and fractional rate of change of BD scalar field, F which asymptotically approach constant values. At late stages, hyperbolic phase of BD field behaves like dark matter.

  18. Combined Brans-Dicke-Einstein-Cartan Inflationary Solution with Lambda-Term

    CERN Document Server

    Berman, M S

    2006-01-01

    A combined BCDE (Brans-Dicke and Einstein-Cartan) theory is developed through Raychaudhuri's equation, for inflationary scenario. It involves a variable cosmological constant, which decreases with time, jointly with energy density, cosmic pressure, shear and Hubble's parameter, while the scale factor, scalar field and spin increase exponentially. Except for the spin component, the fluid goes in the limit, into a perfect fluid.

  19. Pursuing "Moby-Dick" in the Classroom, the Museum, Back in the Classroom, and Beyond.

    Science.gov (United States)

    Wallace, Robert K.; Zlatkin, Aaron; Hixson, Lindsay; Kallmeyer, Robert J.; Sekowski, Kristen; Brock, Gina R.; Gallagher, Michael; Fletcher, William Ryan

    1997-01-01

    Describes a university course that explored the novel "Moby Dick" by Herman Melville and its relation to art highlighting the two student initiatives. Provides the opening statements from each of the 12 students at the National Association for Humanities Education Convention from their presentation on the course where they each related their…

  20. Gravity in a stabilized brane world model in five-dimensional Brans-Dicke theory

    CERN Document Server

    Mikhailov, A S; Smolyakov, M N; Volobuev, I P

    2008-01-01

    Linearized equations of motion for gravitational and scalar fields are found and solved in a stabilized brane world model in five-dimensional Brans-Dicke theory. The physical degrees of freedom are isolated, the mass spectrum of Kaluza-Klein excitations is found and the coupling constants of these excitations to matter on the negative tension brane are calculated.

  1. Teaching Psychology and Literature: Melancholia as Motivation in the Novels of Dick Francis

    Science.gov (United States)

    Wagner, Elaine

    2010-01-01

    Teaching literature from a psychological perspective provides a basis for the study and analysis of human motivation and behavior, as psychology and literature make mutual contributions to the study of both disciplines. Melancholia is a recurring theme in the novels of Dick Francis, and the first-person accounts of despair and depression are…

  2. Frame transformations in Brans-Dicke theory from the viewpoint of Weyl geometry

    CERN Document Server

    Lobo, Iarley P

    2016-01-01

    Brans-Dicke theory is described by an action that allows the so called frame transformation, which removes the non-minimal coupling between the scalar field and the curvature by a coupling between the metric tensor and matter fields. In this paper, we describe how the viewpoint that they are physically equivalent has a geometrical counterpart in the framework of Weyl integrable geometry.

  3. Christa McAuliffe and Dick Scobee in Shuttle mission simulator

    Science.gov (United States)

    1985-01-01

    Astronaut Francis R. (Dick) Scobee, STS 51-L commander, briefs Payload specialist Sharon Christa McAuliffe about some of the flight systems of the Space Shuttle during a training session in JSC's Shuttle mission simulator. They are on the flight deck with McAuliffe seated at the pilot's station and Scobee at the commander's station.

  4. Quantum Logic Operation with Single Trapped Ion Without Limitation of Lamb-Dicke Parameter

    Institute of Scientific and Technical Information of China (English)

    ZHANG Rong; ZHU Shi-Qun

    2003-01-01

    By applying the nonlinear interaction between internal and external degrees of a trapped ion with theassistance of two pairs or three pairs of laser beams that are perpendicular to each other, the realization of quantumlogic operation without the limitation on the Lamb-Dicke parameter can be achieved when the lasers are tuned to thecarrier.

  5. Conciliar politics and administration in the reign of Henry VII

    OpenAIRE

    Ford, Lisa L.

    2001-01-01

    Since Elton's commentary on the absence of critical study of the early Tudor council in 1964, some progress has been made towards a wider, fuller, more detailed understanding of Henry VII's council and where it fits-or does not-into the development of council under the Tudors. However, the early Tudor council remains something of an enigma. Added to that is recent interest by late medieval historians in just how much power Henry VII exercised in the operation of his councils. W...

  6. The function of three indigenous plasmids in Mesorhizobium huakuii 2020 and its symbiotic inter-action with Sym pJB5JI of Rhizobium leguminosarum

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    A Mesorhizobium huakuii strain 2020, isolated from a rice-growing field in southern China, contains three indigenous plasmids named p2020a, p2020b and p2020c, respectively. The plasmids were deleted via Tn5-sacB insertion, and two cured derivatives were obtained. Interestingly, the mutant 2020D29 curing of p2020c could significantly enhance the capacity of symbiotic nitrogen fixation. But the mutant 2020D8 curing of p2020b lost the ability to nodulate Astragalus sinicus. Furthermore, the third plasmid p2020a could be hardly eliminated, suggesting that some house-keeping genes necessary for strain growth located on this plasmid. Then the Sym plasmid pJB5JI of R. leguminosarum bv. viciae was transferred into 2020 and its cured derivatives. The pot plant test showed that the ability of competition and symbiotic nitrogen fixation of transconjugant 2020-137 (pJB5JI) was increased evidently in con-trast to 2020. pJB5JI could not restore the ability of 2020D8 to nodulate Astragalus sinicus. 2020D8-8 (pJB5JI) could form ineffective nodules on peas, which implied that the symbiotic plasmid pJB5JI could express its function at the chromosomal background of Mesorhizobium huakuii 2020. The plas-mid stability was checked in transconjugants under free-living and during symbiosis. The results indi-cated that pJB5JI failed to be detected in some nodule isolates. That Km resistance gene could be am-plified from all transconjugants and nodule isolates suggested that pJB5JI was fully or partially inte-grated into the chromosome of recipients.

  7. Henry Giroux on Democracy Unsettled: From Critical Pedagogy to the War on Youth--An Interview

    Science.gov (United States)

    Peters, Michael A.

    2012-01-01

    This interview conducted with Henry Giroux begins by probing Henry's childhood, upbringing and undergraduate years to discover where his sense of social justice took hold. It also questions Henry about his working-class background and the major influences on his thought, including his relationships with Paulo Freire and Howard Zinn. The interview…

  8. Comparison of the insulin reaction of peripheral blood T cells between healthy Holstein dairy cows and JB during the periparturient period.

    Science.gov (United States)

    Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi

    2006-11-01

    To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.

  9. Human J-protein DnaJB6b Cures a Subset of Saccharomyces cerevisiae Prions and Selectively Blocks Assembly of Structurally Related Amyloids.

    Science.gov (United States)

    Reidy, Michael; Sharma, Ruchika; Roberts, Brittany-Lee; Masison, Daniel C

    2016-02-19

    Human chaperone DnaJB6, an Hsp70 co-chaperone whose defects cause myopathies, protects cells from polyglutamine toxicity and prevents purified polyglutamine and Aβ peptides from forming amyloid. Yeast prions [URE3] and [PSI(+)] propagate as amyloid forms of Ure2 and Sup35 proteins, respectively. Here we find DnaJB6-protected yeast cells from polyglutamine toxicity and cured yeast of both [URE3] prions and weak variants of [PSI(+)] prions but not strong [PSI(+)] prions. Weak and strong variants of [PSI(+)] differ only in the structural conformation of their amyloid cores. In line with its anti-prion effects, DnaJB6 prevented purified Sup35NM from forming amyloids at 37 °C, which produce predominantly weak [PSI(+)] variants when used to infect yeast, but not at 4 °C, which produces mostly strong [PSI(+)] variants. Thus, structurally distinct amyloids composed of the same protein were differentially sensitive to the anti-amyloid activity of DnaJB6 both in vitro and in vivo. These findings have important implications for strategies using DnaJB6 as a target for therapy in amyloid disorders.

  10. The Transformative Intellectual: An Examination of Henry Giroux's Ethics

    Science.gov (United States)

    Kashani, Tony

    2012-01-01

    This article explores Henry Giroux's contributions to critical pedagogy. The author demonstrates how Giroux, as a public intellectual, has found his Ethics in the right place. The author further argues that Giroux's Ethics of virtue are present not only in the public person but also in his transformative writing.

  11. Challenging Texts: Teaching Deliberately--Reading Henry David Thoreau's "Walden"

    Science.gov (United States)

    Davis, Andrea

    2011-01-01

    One of the more difficult 19th-century American texts for high school students to read is undoubtedly Henry David Thoreau's "Walden." His erudite allusions, often page-long sentences, and sophisticated sense of the ironic initially leave many students cold. Still, the author encourages them to read amid the din of a cultural cacophony that shouts…

  12. Kesknoored tegid visiidi Šveitsi / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    Keskerakonna noorte esindus külastas 20.-25. aprillini 2005 Šveitsi, et osaleda sealsete noorte liberaalide Jungfreisinnige Schweizi kongressil. Delegatsiooni kuulusid esimees Tarmo Lausing, välissekretär Olga Sõtnik, endine pressisekretär Raimond Kaljulaid ja noortekogu esimees Henri Kaselo

  13. A special issue for Henri Poincaré

    NARCIS (Netherlands)

    Verhulst, Ferdinand; Wepster, S.A.

    2012-01-01

    One hundred years ago, on 17 July 1912, Henri Poincare died at the age of only 58 years. He had been unusually productive with fundamental results in mathematics, physics and astronomy, and he can be regarded as one of the most important mathematical physicists of all times; his work had a major imp

  14. The Failed Educations of John Stuart Mill and Henry Adams.

    Science.gov (United States)

    Crossley, Robert

    1979-01-01

    Analyzes and contrasts Mill's "Autobiography" and Adams'"The Education of Henry Adams" in order to present two approaches to the nature of education and of failure. Maintains that their perspectives may serve as catalysts and cautions for contemporary theories of education and its utility and relevance. (CAM)

  15. Kesknoored tegid visiidi Šveitsi / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    Keskerakonna noorte esindus külastas 20.-25. aprillini 2005 Šveitsi, et osaleda sealsete noorte liberaalide Jungfreisinnige Schweizi kongressil. Delegatsiooni kuulusid esimees Tarmo Lausing, välissekretär Olga Sõtnik, endine pressisekretär Raimond Kaljulaid ja noortekogu esimees Henri Kaselo

  16. Creating Authenticity: Banal nationalism in Henri Coand\\[acaron] Airport

    OpenAIRE

    Alexandra Coţofan\\[acaron

    2011-01-01

    Alexandra Coţofan\\[acaron] analyzes the retail spaces of the Henri Coand\\[acaron] International Airport in Bucharest, Romania's largest international airport. She looks at how authenticity is created through the interactions among the company, staff and passengers in the production of ‘banal nationalism’.

  17. Works by Henry Wiss. Collegiate Legacy: Emeritus Faculty Exhibition.

    OpenAIRE

    Wiss, Henry H.

    2014-01-01

    Exhibition of works by College of Architecture and Urban Studies emeritus faculty, celebrating the 50th anniversary of the college. Curated by Truman Capone and Deb Sim. Moss Arts Center, Virginia Tech. HENRY WISS. (left)Mountains. 1950-60. (right) Cowboy. 1950-60. Watercolor on paper. Miller Off Main Gallery/Collection of Robert Miller.

  18. Henry the Seventh and Italy, an historiographical account

    Directory of Open Access Journals (Sweden)

    Gian Maria Varanini

    2014-06-01

    Full Text Available The article represents an introduction to the contributions published in the monographic section dedicated to the expedition of Henry VII of Luxembourg in Italy (1310-1313. It provides an historiographic overview and some insightful clues.

  19. In praise of the literary eponym--Henry V sign.

    LENUS (Irish Health Repository)

    Shanahan, F

    2013-01-01

    The use of eponyms in medicine is often discouraged. However, the literary eponym should be an exception as it is not linked with many of the difficulties associated with conventional eponyms and offers descriptive brevity and accuracy. Here, we illustrate the point with Henry V sign, which will be familiar to many who have cared for patients in the terminal stage of illness.

  20. Henri Poincaré en het ontstaan van de topologie

    NARCIS (Netherlands)

    Verhulst, Ferdinand

    2013-01-01

    Het ontstaan van de moderne topologie is onlosmakelijk verbonden met Henri Poincare (1854-1912). Hij werd geboren in Nancy, de hoofdstad van Lotharingen, in een familie van ingenieurs, apothekers, medici en juristen. In Nancy bracht hij een gelukkige jeugd door, hij had geen problemen met school

  1. A Conservation with...Henry Louis Gates, Jr.

    Science.gov (United States)

    Cheney, Lynne V.

    1991-01-01

    Presents an interview between National Endowment for the Humanities chairman, Lynne V. Cheney, and Harvard professor, Henry Louis Gates, Jr. Includes discussion of multiculturalism as it relates to free speech, sexism, racism, hate speech, and ethnocentrism. Emphasizes both the open tradition of Western culture and the recent pressure for…

  2. A Re-examination of Henry Grady's New South.

    Science.gov (United States)

    Mixon, Harold

    Historian Henry Grady's speeches, particularly one delivered to the New England Club of New York City in 1886, are credited with persuading the North of the South's continued domination of blacks, its need for increased industrialization, and its broadened agriculture. Grady's term "The New South" is defined as a racially conservative,…

  3. The Failed Educations of John Stuart Mill and Henry Adams.

    Science.gov (United States)

    Crossley, Robert

    1979-01-01

    Analyzes and contrasts Mill's "Autobiography" and Adams'"The Education of Henry Adams" in order to present two approaches to the nature of education and of failure. Maintains that their perspectives may serve as catalysts and cautions for contemporary theories of education and its utility and relevance. (CAM)

  4. Henry David Thoreau and Martin Luther King, Jr. Lesson Plan.

    Science.gov (United States)

    Powell, Brent

    1995-01-01

    Presents a five-lesson, high school instructional unit on the ideas and activities of Henry David Thoreau and Martin Luther King, Jr. Includes student objectives, step-by-step instructional procedures, and discussion questions. Provides quotations by Thoreau and King. (CFR)

  5. The Transformative Intellectual: An Examination of Henry Giroux's Ethics

    Science.gov (United States)

    Kashani, Tony

    2012-01-01

    This article explores Henry Giroux's contributions to critical pedagogy. The author demonstrates how Giroux, as a public intellectual, has found his Ethics in the right place. The author further argues that Giroux's Ethics of virtue are present not only in the public person but also in his transformative writing.

  6. 解读JB/T 4333.2-2005《厢式压滤机和板框压滤机技术条件》%Interpretation of JB/T 4333.2-2005."Van Filter and Frame Filter Technical Conditions"

    Institute of Scientific and Technical Information of China (English)

    王书博

    2007-01-01

    @@ 《厢式压滤机和板框压滤机》系列标准均为机械行业推荐性标准,它包括四部分:JB/T 4333.1-2005《厢式压滤机和板框压滤机第一部分型式与基本参数》、JB/T 4333.2-2005《厢式压滤机和板框压滤机第二部分技术条件》,JB/T 4333.3-2005《厢式压滤机和板框压滤机第三部分滤板》、JB/T 4333.4-2005《厢式压滤机和板框压滤机第四部分隔膜滤板》.

  7. The Dicke model phase transition in the quantum motion of a Bose-Einstein condensate in an optical cavity

    CERN Document Server

    Nagy, D; Szirmai, G; Domokos, P

    2009-01-01

    We show that the motion of a laser-driven Bose-Einstein condensate in a high-finesse optical cavity realizes the spin-boson Dicke-model. The quantum phase transition of the Dicke-model from the normal to the superradiant phase corresponds to the self-organization of atoms from the homogeneous into a periodically patterned distribution above a critical driving strength. The fragility of the ground state due to photon measurement induced back action is calculated.

  8. Obituary: Roy Henry Garstang (1925-2009)

    Science.gov (United States)

    Malville, J.

    2011-12-01

    Roy Henry Garstang 84 passed away on November 1, 2009 in Boulder Colorado. He was born in Southport, England in September of 1925 to Percy Brocklehurst and Eunice (Gledhill) Garstang. He won a scholarship to Caius College in Cambridge University. Because it was wartime, he could spend only two years at his studies. However, he managed to complete three years of required work during that time, and then spent 1945-46 as a Junior Scientific Officer at the Royal Aircraft Establishment at Farnborough. He received his BA in 1946 from Cambridge, his MA in 1950, and his PhD in Mathematics in 1954, with a thesis: "Atomic Transitions in Astrophysics," working under D. R. Hartree. He also received a ScD from Cambridge in Physics and Chemistry in 1983. He married Ann in August 1959. She and two daughters, Jennifer and Susan, survive him. While still pursuing his PhD, Roy Garstang served as a Research Associate at the Yerkes Observatory, from 1951-1952, working under Subrahmanyan Chandrasekhar. During that time he continued with his own calculations of atomic structure and transition probabilities, although these were not part of Chandra's research interests. After earning his PhD, he went to teach at the University of London, where he also served as the Assistant Director of the University of London Observatory (1959-1964). He was editor of "The Observatory" Magazine form 1953-1960. The continuing theme of this research was to help meet the needs of astrophysicists for atomic data. In 1964, he left England for the United States, where he joined the faculty at the University of Colorado, Boulder, where he would remain for the rest of his professional career. It was entirely fitting, considering his interest in performing calculations of interest to astrophysicists, that soon after arriving in Boulder he was appointed Chairman of JILA - Joint Institute for Laboratory Astrophysics (1966-1967). He was Director of the Division of Physics and AstroGeophysics (1979-80), acting

  9. Phase transition of charged Black Holes in Brans-Dicke theory through geometrical thermodynamics

    CERN Document Server

    Hendi, S H; Panah, B Eslam; Armanfard, Z

    2015-01-01

    In this paper, we take into account black hole solutions of Brans-Dicke-Maxwell theory and investigate their stability and phase transition points. We apply the concept of geometry in thermodynamics to obtain phase transition points and compare its results with those of calculated in canonical ensemble through heat capacity. We show that these black holes enjoy second order phase transitions. We also show that there is a lower bound for the horizon radius of physical charged black holes in Brans-Dicke theory which is originated from restrictions of positivity of temperature. In addition, we find that employing specific thermodynamical metric in the context of geometrical thermodynamics yields divergencies for thermodynamical Ricci scalar in places of phase transitions. It will be pointed out that due to characteristics behavior of thermodynamical Ricci scalar around its divergence points, one is able to distinguish the physical limitation point from the phase transitions.

  10. An stellar explosion in the weak field approximation of the Brans-Dicke theory

    CERN Document Server

    Hamity, V H; Hamity, Victor H.; Barraco, Daniel E.

    2005-01-01

    We treat a very crude model of an exploding star, in the weak field approximation of the Brans-Dicke theory, that shows aspects that resembles some characteristics data of a Type Ia Supernova. The most noticeable result in the electromagnetic component, is the relationship between the absolute magnitude at maximum brightness of the star and the decline rate in one magnitude from that maximum. This characteristic has become one of the most accurate method to measure luminosity distances to objects at cosmological distances. Another interesting result is that the active mass associated with the scalar field is totally radiated to infinity, representing a mass loss in the ratio of the "tensor" component to the scalar component of 1 to $(2\\omega + 3)$ ($\\omega$ is the Brans-Dicke parameter), in agreement with a general result of Hawking. Then, this model shows explicitly, in a dynamical case, the mechanism of radiation of scalar field, which is necessary to understand the Hawking result.

  11. Exact solutions of Brans-Dicke cosmology with decaying vacuum density

    CERN Document Server

    Montenegro, A E

    2007-01-01

    We investigate cosmological solutions of Brans-Dicke theory with both the vacuum energy density and the gravitational constant decaying linearly with the Hubble parameter. A particular class of them, with constant deceleration factor, sheds light on the cosmological constant problems, leading to a presently small vacuum term, and to a constant ratio between the vacuum and matter energy densities. By fixing the only free parameter of these solutions, we obtain cosmological parameters in accordance with observations of both the relative matter density and the universe age. In addition, we have three other solutions, with Brans-Dicke parameter w = -1 and negative cosmological term, two of them with a future singularity of big-rip type. Although interesting from the theoretical point of view, two of them are not in agreement with the observed universe. The third one leads, in the limit of large times, to a constant relative matter density, being also a possible solution to the cosmic coincidence problem.

  12. "Brans-Dicke" with $\\Lambda>0$: Black holes and large scale structures

    CERN Document Server

    Bhattacharya, Sourav; Romano, Antonio E; Tomaras, Theodore N

    2015-01-01

    The no-hair theorem is generalized to stationary axisymmetric black-holes in scalar tensor theories of the Brans-Dicke type with positive cosmological constant, general $\\omega(\\phi)$ and potential $V(\\phi)$. For finite constant $\\omega$ the Brans-Dicke field $\\phi$ is shown to blow-up logarithmically at the horizons. Perturbative solutions of the theory are analyzed relevant to astrophysical applications, where either one or both horizons are "hidden". It is shown that when the stationary cosmological horizon is hidden, the black hole horizon supports non-trivial "$\\phi-$hair". On the other hand, when the black hole horizon is hidden, the presence of the cosmological one leads to an upper bound on $\\omega$.

  13. Dick Pastor:A Life Devoted to US-China Friendship

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Three old men happily got together again Chatting about what happened last sixty years There are still great expectations before them Don’t forget to meet again in Beijing in 2008! The above lines were written on a scroll by then 90-year-old famous Chinese writer and calligrapher Ma Shitu for Dick Pastor,an American ex-soldier fighting with China against Japanese aggression during the Second World War,who came to have a grand reunion with Ma and myself in Kunming in the fall of 2004.In the early hours of January 20 of 2008,while the Beijing Olympics are approaching,Dick Pastor passed away peacefully,but with a great regret,in New York at the age of almost 90.

  14. Static and rotating electrically charged black holes in three-dimensional Brans-Dicke gravity theories

    CERN Document Server

    Dias, O J C; Dias, Oscar J. C.; Lemos, Jose' P. S.

    2001-01-01

    We obtain static and rotating electrically charged black holes of a Einstein-Maxwell-Dilaton theory of the Brans-Dicke type in (2+1)-dimensions. The theory is specified by three fields, the dilaton, the graviton and the electromagnetic field, and two parameters, the cosmological constant and the Brans-Dicke parameter. It contains eight different cases, of which one distinguishes as special cases, string theory, general relativity and a theory equivalent to four dimensional general relativity with one Killing vector. We find the ADM mass, angular momentum, electric charge and dilaton charge and compute the Hawking temperature of the solutions. Causal structure and geodesic motion of null and timelike particles in the black hole geometries are studied in detail.

  15. Observation of Dicke superradiance for two artificial atoms in a cavity with high decay rate.

    Science.gov (United States)

    Mlynek, J A; Abdumalikov, A A; Eichler, C; Wallraff, A

    2014-11-04

    An individual excited two-level system decays to its ground state in a process known as spontaneous emission. The probability of detecting the emitted photon decreases exponentially with the time passed since its excitation. In 1954, Dicke first considered the more subtle situation in which two emitters decay in close proximity to each other. He argued that the emission dynamics of a single two-level system is altered by the presence of a second one, even if it is in its ground state. Here, we present a close to ideal realization of Dicke's original two-spin Gedankenexperiment, using a system of two individually controllable superconducting qubits weakly coupled to a fast decaying microwave cavity. The two-emitter case of superradiance is explicitly demonstrated both in time-resolved measurements of the emitted power and by fully reconstructing the density matrix of the emitted field in the photon number basis.

  16. Spherically symmetric Jordan-Brans-Dicke quantum gravity with de Broglie Bohm pilot wave perspective

    CERN Document Server

    Ghaffarnejad, Hossein

    2013-01-01

    We obtain two dimensional analogue of the Jordan-Brans-Dicke (JBD) gravity action described in four dimensional spherically symmetric curved space time metric. There will be two scalar fields, namely, the Brans Dicke (BD) $\\phi$ and scale factor of 2-sphere part of the space time $\\psi.$ There is obtained a suitable duality transformation between $(\\psi,\\phi)$ and $(\\rho,S)$ where $\\rho$ and $S$ are respectively amplitude and phase part of the corresponding de Broglie pilot wave function $\\Psi(\\rho,S)=\\sqrt{\\rho}e^{iS}.$ There is established covariant conservation of mass-energy current density of particles ensemble $J_a=\\rho\\partial_aS,$ in a particular dynamical conformal frame described by $(\\rho,S).$

  17. Uniqueness of the Machian Solution in the Brans-Dicke Theory

    CERN Document Server

    Miyazaki, A

    2001-01-01

    Machian solutions of which the scalar field exhibits the asymptotic behavior $\\phi =O(\\rho /\\omega)$ are generally explored for the homogeneous and isotropic universe in the Brans-Dicke theory. It is shown that the Machian solution is unique for the closed and the open space. Such a solution is restricted to one that satisfies the relation $GM/c^{2}a=const$, which is fixed to $\\pi $ in the theory for the closed model. Another type of solution satisfying $\\phi =O(\\rho /\\omega)$ with the arbitrary coupling constant $% \\omega $ is obtained for the flat space. This solution has the scalar field $% \\phi \\propto \\rho t^{2}$ and also keeps the relation $GM/c^{2}R=const$ all the time. This Machian relation and the asymptotic behavior $\\phi =O(\\rho /\\omega)$ is equivalent to each other in the Brans-Dicke theory.

  18. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  19. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Directory of Open Access Journals (Sweden)

    Patrycja Konieczna

    Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  20. Analysis of the"Sea"in Robinson Crusoe and Moby Dick

    Institute of Scientific and Technical Information of China (English)

    魏丽萍

    2016-01-01

    This paper employs a comparative analysis to study Daniel Defoe's Robinson Crusoe and Herman Melville's Moby Dick. The author compares them from both quantitative and qualitative aspects. As for the quantitative aspect, a corpus-based study was carried out to research on the word"sea". As for the qualitative study, the author mainly focuses on the implications of the seas, the images of two protagonists based on the interaction between man and the sea.

  1. Brans-Dicke-type theories and avoidance of the cosmological singularity

    CERN Document Server

    Quirós, I; Cardenas, R; Quiros, Israel; Bonal, Rolando; Cardenas, Rolando

    2000-01-01

    A point of view, based on a postulate about the physical equivalence of conformal representations of a given physical situation in Brans-Dicke-type theories of gravitation is presented, that automatically solves the discussion about the physical equivalence of Jordan frame and Einstein frame formulations of scalar-tensor theory. The cosmological consequences of this viewpoint for general relativity are studied, and its implications for the low-energy limit of string theory outlined.

  2. Five dimensional minimally interacting holographic dark energy model in Brans-Dicke theory of gravitation

    Science.gov (United States)

    Reddy, D. R. K.; Anitha, S.; Umadevi, S.

    2016-11-01

    In this paper, we investigate five dimensional space-time filled with minimally interacting dark matter and holographic dark energy in Brans-Dicke (Phys. Rev. 124:925, 1961) scalar-tensor theory of gravitation. The exact solutions of the field equations are obtained using (i) special law of variation for Hubble's parameter that yields constant value of deceleration parameter and (ii) a relation between metric potentials. The physical and geometrical aspects of the model are also discussed.

  3. Anisotropic Dark Energy Bianchi Type III Cosmological Models in Brans Dicke Theory of Gravity

    CERN Document Server

    Shamir, M Farasat; 10.1139/P2012-007

    2012-01-01

    The main purpose of this paper is to explore the solutions of Bianchi type $III$ cosmological model in Brans Dicke theory of gravity in the background of anisotropic dark energy. We use the assumption of constant deceleration parameter and power law relation between scalar field $\\phi$ and scale factor $a$ to find the solutions. The physical behavior of the solutions has been discussed using some physical quantities.

  4. Accelerated Dilatonic-Brans-Dicke cyclic and non-singular universe from string theory

    Institute of Scientific and Technical Information of China (English)

    Ahmad Rami El-Nabulsi

    2011-01-01

    We discuss the late-time dynamics of a particular four-dimensional BransDicke cosmology with a dilaton field motivated by string theories (solitonic p-branes or D-branes) in which the dilaton field and the scale factor of the flat,homogeneous spacetime are correlated.We examine the late-time-evolution of the equations of motion where various attractive consequences are revealed and discussed in some detail.

  5. Production of an X-band horn after a design of Dick Turrin, W2IMU

    Science.gov (United States)

    Monstein, Christian

    2015-08-01

    While looking for a nice, easy to perform and cheap students' project in 2009, we investigated X-band (8 to 12 GHz) microwave devices. A 5 m parabolic dish antenna and an X-band down-converter were already available, but we had no antenna feed in our tool box. A web search yielded a simple feed horn design and found sketches and descriptions by Dick Turrin (W2IMU) from 1991.

  6. Inflation Cosmological Solutions in Two-Dimensional Brans-Dicke Gravity Model

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The purpose of this paper is to study cosmological properties of two-dimensional Brans-Dicke gravity model. For massless scalar field, the new cosmological solutions are found by integration of field equation, these solutions correspond to the inflation solutions with positive cosmological constant. The result of this paper show that the inflation process of universe is controlled by the classical and quantum effect of the scalar field.

  7. An Archetypal Approach to Dick Diver in Tender Is the Night

    Institute of Scientific and Technical Information of China (English)

    ZHANG Dan

    2016-01-01

    Dick Diver, originally a young and promising doctor and psychoanalyst, is on his way to a glamorous future, but he gradually reduces himself to drinking, cursing and drifting away in the society. Following his life journey—his love, his mar-riage, his fall and ruin, we readers can easily associate him with some important characters taken from Greek mythology:Apol-lo, Dionysus and Daedalus.

  8. G\\"odel and G\\"odel-type universes in Brans-Dicke theory

    CERN Document Server

    Agudelo, J A; Petrov, A Yu; Porfírio, P J; Santos, A F

    2016-01-01

    In this paper, conditions for existence of G\\"{o}del and G\\"{o}del-type solutions in Brans-Dicke (BD) scalar-tensor theory and their main features are studied. The special attention is paid to consistency of equations of motion, causality, existence of CTCs (closed time-like curves) and to the role which cosmological constant and Mach principle play to achieve the consistency of this model.

  9. Cosmological constant in the Bianchi type-I-modified Brans–Dicke cosmology

    Indian Academy of Sciences (India)

    A K Azad; J N Islam

    2003-01-01

    In 1961, Brans and Dicke [1] provided an interesting alternative to general relativity based on Mach’s principle. To understand the reasons leading to their field equations, we first consider homogeneous and isotropic cosmological models in the Brans–Dicke theory. Accordingly we start with the Robertson–Walker line element and the energy tensor of a perfect fluid. The scalar field is now a function of the cosmic time only. Then we consider spatially homogeneous and anisotropic Bianchi type-I-cosmological solutions of modified Brans–Dicke theory containing barotropic fluid. These have been obtained by imposing a condition on the cosmological parameter (). Again we try to focus the meaning of this cosmological term and to relate it to the time coordinate which gives us a collapse singularity or the initial singularity. On the other hand, our solution is a generalization of the solution found by Singh and Singh [2]. As far as we are aware, such solution has not been given earlier.

  10. The Chameleon Effect in the Jordan Frame of the Brans--Dicke Theory

    CERN Document Server

    Quiros, Israel; Gonzalez, Tame; Horta-Rangel, F Antonio

    2015-01-01

    In this paper we investigate the chameleon effect in the different conformal frames of the Brans--Dicke theory. Given that, in the standard literature on the subject, the chameleon is described in the Einstein frame almost exclusively, here we pay special attention to the description of this effect in the Jordan and in the string frames. It is shown that, in general, terrestrial and solar system bounds on the mass of the BD scalar field, and bounds of cosmological origin, are difficult to reconcile at once through a single chameleon potential. We point out that, in a cosmological context, provided that the effective chameleon potential has a minimum within a region of constant density of matter, the Brans--Dicke theory transmutes into general relativity with a cosmological constant, in that region. This result, however, can be only locally valid. In cosmological settings de Sitter--general relativity is a global attractor of the Brans--Dicke theory only for the quadratic potential $V(\\phi)=M^2\\phi^2$, or for ...

  11. Regular Solutions in Vacuum Brans-Dicke Theory Compared to Vacuum Einstein Theory

    Directory of Open Access Journals (Sweden)

    Alina Khaybullina

    2013-01-01

    Full Text Available We will confront some static spherically symmetric vacuum Brans-Dicke solutions in the Jordan and Einstein Frames with the Robertson parameters. While the regular solution in the vacuum Einstein theory is just the Schwarzschild black hole, the same in the Jordan frame Brans-Dicke theory is shown to represent not a black hole but a traversable wormhole. But, in this case, the valid range of ω becomes too narrow to yield the observed weak field Robertson parameters at the positive mass mouth. The corresponding solution in the Einstein frame also provides a regular wormhole, and it yields the correct parametric values but only up to “one and half order.” We argue that a second-order contribution can in principle distinguish between the signatures of the regular wormhole and the singular Buchdahl solution in the Einstein frame. Thus, at the level of regular solutions, Brans-Dicke theory in each frame predicts effects very different from those of Einstein's theory. To our knowledge, these theoretical distinctions seem not to have received adequate attention so far.

  12. Brans-Dicke Theory with Λ>0: Black Holes and Large Scale Structures.

    Science.gov (United States)

    Bhattacharya, Sourav; Dialektopoulos, Konstantinos F; Romano, Antonio Enea; Tomaras, Theodore N

    2015-10-30

    A step-by-step approach is followed to study cosmic structures in the context of Brans-Dicke theory with positive cosmological constant Λ and parameter ω. First, it is shown that regular stationary black-hole solutions not only have constant Brans-Dicke field ϕ, but can exist only for ω=∞, which forces the theory to coincide with the general relativity. Generalizations of the theory in order to evade this black-hole no-hair theorem are presented. It is also shown that in the absence of a stationary cosmological event horizon in the asymptotic region, a stationary black-hole horizon can support a nontrivial Brans-Dicke hair. Even more importantly, it is shown next that the presence of a stationary cosmological event horizon rules out any regular stationary solution, appropriate for the description of a star. Thus, to describe a star one has to assume that there is no such stationary horizon in the faraway asymptotic region. Under this implicit assumption generic spherical cosmic structures are studied perturbatively and it is shown that only for ω>0 or ω≲-5 their predicted maximum sizes are consistent with observations. We also point out how, many of the conclusions of this work differ qualitatively from the Λ=0 spacetimes.

  13. Classical and Quantum Solutions in Brans-Dicke Cosmology with a Perfect Fluid

    CERN Document Server

    Paliathanasis, Andronikos; Basilakos, Spyros; Barrow, John D

    2015-01-01

    We consider the application of group invariant transformations in order to constrain a flat isotropic and homogeneous cosmological model, containing of a Brans-Dicke scalar field and a perfect fluid with a constant equation of state parameter $w$, where the latter is not interacting with the scalar field in the gravitational action integral. The requirement that the Wheeler-DeWitt equation be invariant under one-parameter point transformations provides us with two families of power-law potentials for the Brans-Dicke field, in which the powers are functions of the Brans-Dicke parameter $\\omega_{BD}$ and the parameter $w$. The existence of the Lie symmetry in the Wheeler-DeWitt equation is equivalent to the existence of a conserved quantity in field equations and with oscillatory terms in the wavefunction of the universe. This enables us to solve the field equations. For a specific value of the conserved quantity, we find a closed-form solution for the Hubble factor, which is equivalent to a cosmological model ...

  14. 改良Dick器械(Dick-Hou器械)治疗腰椎滑脱症

    Institute of Scientific and Technical Information of China (English)

    徐久祥; 冷辉; 赵吉连; 巴树桐

    2001-01-01

    目的 探讨改良Dick器械(Dick-Hou器械)后路治疗腰椎滑脱症内固定的力学特点及临床价值、方法 通过对腰椎滑脱症发病机理的探讨,总结33例应用改良Dick器械(Dick-Hou器械)治疗腰椎滑脱症的治疗经验。结果 平均随访1.5年,优良率93.9%,无差者。结论 改良Dick器械(Dick-Hou器械)不仅具有Dick器械的纵向撑开功能,同时又具有横向提拉功能,完全可以满足椎体复位的要求,效果满意,是一种比较理想的治疗腰椎滑脱症的内固定器。

  15. Holographic dark energy in Brans-Dicke theory with logarithmic form of scalar field

    CERN Document Server

    Singh, C P

    2016-01-01

    In this paper, an interacting holographic dark energy model with Hubble horizon as an infra-red cut-off is considered in the framework of Brans-Dicke theory. We propose a logarithmic form $\\phi \\propto ln(\\alpha+\\beta a)$ of the Brans-Dicke scalar field to alleviate the problems of interacting holographic dark energy models in Brans-Dicke theory. We find that the equation of state parameter $w_h$ and deceleration parameter $q$ are negative in the early time which shows the early time inflation. During the evolution the sign of parameter $q$ changes from negative to positive which means that the Universe expands with decelerated rate whereas the sign of $w_h$ may change or remain negative throughout the evolution depending on the values of parameters. It is also observed that $w_h$ may cross the phantom divide line in the late time evolution. The sign of $q$ changes from positive to negative during late time of evolution which explains the late time accelerated expansion of the Universe. Thus, we present a uni...

  16. Henri de La Tour et ses réseaux

    OpenAIRE

    Marchand, Romain

    2016-01-01

    Henri de La Tour est un personnage méconnu de l’historiographie actuelle des guerres de religion et de la Régence. Né en 1555, le fils de François III de La Tour, vicomte de Turenne, et d’Éléonore de Montmorency, perdit très vite ses parents et fut pour cette raison élevé par son grand-père le connétable Anne de Montmorency. Après avoir passé de longues années à la Cour, il partit dans le sud-ouest du royaume pour soutenir Henri de Navarre en pleines guerres de religion. Il y révéla des talen...

  17. Les jeux de l’injure dans Henry IV

    OpenAIRE

    Vienne-Guerrin, Nathalie

    2006-01-01

    International audience; Il s’agit d’analyser les mécanismes ludiques qui président aux « joutes de jactance » qui sont si caractéristiques d’Henry iv et à l’aune desquelles on peut mesurer l’ambiguïté et l’évolution de la relation entre Falstaff et Hal / Henry. Nous examinons comment ces tournois d’injures se manifestent sur la scène shakespearienne. Il ne s’agit pas d’une étude rhétorique et lexicale de l’injure mais de l’examen d’un rituel verbal paradoxal au cours duquel on s’insulte sans ...

  18. Vida y subjetividad: Los Descartes de Michel Henry

    Directory of Open Access Journals (Sweden)

    Mario Lipsitz

    2006-12-01

    Full Text Available Con el ego cogito sum, Descartes ha buscado ofrecer un suelo seguro para la edificación del conocimiento científico. Sin embargo, la problemática así instaurada ha olvidado totalmente, como señala Heidegger, elucidar el sentido de ser de ese sum. Puede decirse que toda la obra de Michel Henry constituye una tentativa profundamente original de plantear la cuestión del ego sum sobre un contexto verdaderamente ontológico. Es en esta medida que su meditación sobre la obra y el proyecto cartesiano ocupa un lugar central y permanente. Henry nos descubre en L´essence de la Manifestation (1964 y en Phénoménologie du Corps un Descartes cuyo proyecto, basado irreflexivamente sobre un procedimiento intuicionista identifica verdad con evidencia y predetermina así su investigación como una imposible tentativa de exhibir el fundamento bajo la luz. Imposible, pues el fundamento, afirma Henry, el ser del ego, es invisible. Esto es lo que ha comprendido el Descartes al que nos abre Henry en su "Généalogie de la Psychanalyse" (1985: el ser del sum no es un "qué" susceptible de ser dado por un ver sino un "como" que se revela sin mediación a sí mismo como pathos: el aparecerse a si de la vida en la inmanencia de su afectividad.With the cogito ergo sum, Descartes has intended to offer a safe ground for the construction of scientific knowledge. Nevertheless, the problematic thus posed has totally forgotten, as Heidegger points out, to elucidate the sense of the being of this sum. It can be said that the whole work of Michel Henry constitutes a deeply original attempt to raise the question of the ego sum on a truthfully ontological context. Hence, his meditation on Descartes work and project takes up a central and permanent place in his work. Henry discovers to us in L´essence de la Manifestation (1964 and in Phénoménologie du Corps (1965 a Descartes whose project, based unreflectively on an intuitionist procedure, identifies truth with evidence

  19. INOVATION AND ANTREPRENEURIAL CREATIVITY BUSINESS DURING HENRY FORD

    Directory of Open Access Journals (Sweden)

    GHICAJANU MIHAELA

    2015-03-01

    Full Text Available In this paper I presented the innovation and entrepeneurial creativity as a basis in the process of business redesign. I chose as a case study the the Ford brand products, because it is considered that Henry Ford is one of the greatest innovators and entrepreneurs of all time and I decided to present and to analyze these things. The first part of the paper will include theoretical approaches on the innovation and creativity business concepts and premises, and then I showed the ways in which four types of economic innovation under the leadership of Henry Ford (innovation in product, in process, market and organizational were achieved, with the purpose to recognize them in other companies, nowadays .

  20. Iraagi olukorral on poliitiline lahendus / Henry A. Kissinger

    Index Scriptorium Estoniae

    Kissinger, Henry, 1923-

    2007-01-01

    USA endine riigisekretär Henry Kissinger kirjutab, et Ameerika Ühendriikide eesmärgiks peaks olema riikidevaheline kokkulepe, mis tunnistaks Iraagi rahvusvahelist staatust. See oleks vägivalla lõpetamiseks hea alus ja eeltingimuseks vägede väljaviimisele. Vt. samas: Ameerika Ühendriikide vahekokkuvõte Iraagi sõja kohta oli suhteliselt pessimistlik

  1. Henry Mayhew: journalist, social investigator, and foreshadower of qualitative research.

    Science.gov (United States)

    Nunes, Everardo Duarte

    2012-09-01

    As a journalist, Henry Mayhew recorded daily life in London in the latter half of the nineteenth century. His approach remains of interest to historians and social scientists today in that it foreshadowed qualitative research. The article highlights methodological aspects of Mayhew's investigations and analyzes two of his reports, one on a cholera outbreak and the other on a female street vendor. It also addresses some analyses that have critiqued his work.

  2. Sarcophilia, cremation and Sir Henry Thompson (1820-1904).

    Science.gov (United States)

    Jellinek, E H

    2009-11-01

    Sarcophilia, a neologism for an attachment to human remains, is set in a review of the history of the disposal of the dead. The ancient practice of cremation was relaunched late in the 19th century by the urological surgeon cum social reformer Sir Henry Thompson. He was stimulated by Edwin Chadwick and Charles Dickens, and by Charles Darwin's observations on the earthworm. Sarcophilia is the reason for the controversial Human Tissue Act of 2004.

  3. Iraagi olukorral on poliitiline lahendus / Henry A. Kissinger

    Index Scriptorium Estoniae

    Kissinger, Henry, 1923-

    2007-01-01

    USA endine riigisekretär Henry Kissinger kirjutab, et Ameerika Ühendriikide eesmärgiks peaks olema riikidevaheline kokkulepe, mis tunnistaks Iraagi rahvusvahelist staatust. See oleks vägivalla lõpetamiseks hea alus ja eeltingimuseks vägede väljaviimisele. Vt. samas: Ameerika Ühendriikide vahekokkuvõte Iraagi sõja kohta oli suhteliselt pessimistlik

  4. BOOK REVIEW: Joseph Henry: The Rise of an American Scientist

    Science.gov (United States)

    Crawford, Elspeth

    1998-09-01

    Albert Moyer has clearly done his research into the events of Joseph Henry's life. The personal, professional, sociological and scientific aspects have been meticulously detailed throughout and the ordering, as in the chapter headings, is chronological, so that there is some element of each of these aspects in each chapter. This is unfortunately both the strength and the weakness of the biography, as the detail seemed to me to be the most remarkable characteristic of the writing. But, the bigger stories, or the themes, which might have been possible, seemed to get lost. Hence, I found this a book for those who are seriously interested in Joseph Henry; but for those whose interest might be more general, say having an interest in nineteenth century growth of scientific institutions, or wanting to understand the conceptual development of electromagnetism, there seemed to be too much which came from the Henry point of view, rather than locating Henry within his time and context. This is a remark about style, rather than omission of content, as the myriad of details in each paragraph certainly inform the reader about the context. For instance, some sociology of the USA in the nineteenth century could be inferred, say showing how a young man from a modest background might make his way into a professional life, but the information is so particularly a description of Henry's experience that one has to rely on prior knowledge or make assumptions in order to create a sociological perspective. That is, I now know, what happened to Henry, but I do not know if his case was in any sense typical or atypical. Similarly there is information about education in general at that time, and scientific education, research and its publication, as it applied to Henry. The relationships between science in the USA and in Europe have a place, and there is quite a bit of information about the institutions in which Henry worked, particularly Albany Academy, Princeton and the Smithsonian. Henry

  5. JB/MS murine melanoma: a new model for studies on the modulation of differentiation and of tumorigenic and metastatic potential.

    Science.gov (United States)

    Hearing, V J; Cannon, G B; Vieira, W D; Jiménez-Atiénzar, M; Kameyama, K; Law, L W

    1988-02-15

    The recently obtained JB/MS melanoma (induced by DMBA in C57Bl/6 mice) has been successfully established in culture, and characterization of various parameters of these cells, as they have been serially passaged in vivo and in vitro, has begun. The culture lines were initially highly dendritic and melanotic, growing slowly in vitro and extremely slowly in vivo. During serial passage in vivo and in vitro the cell lines have gradually evolved into less melanotic, but more proliferative, tumorigenic and metastatic cells. We have been able to demonstrate that the JB/MS melanoma shares the common melanoma TSTA previously reported for B16, K1735 and JB/RH melanomas, but does not cross-react with the S91 melanoma or with other non-melanoma cell lines used as specificity controls. The JB/MS cells can be induced to differentiate in vitro by alpha-melanocyte stimulating hormone, a physiologically relevant agent, and studies have been initiated to detail the level at which this induction occurs. These sublines should prove to be excellent models for study of the progression of transformed cells from non-tumorigenic to tumorigenic phenotypes, and for progression through stages of varying metastatic potential, immunogenicity and differentiation.

  6. Stable high-titer n-butanol production from sucrose and sugarcane juice by Clostridium acetobutylicum JB200 in repeated batch fermentations.

    Science.gov (United States)

    Jiang, Wenyan; Zhao, Jingbo; Wang, Zhongqiang; Yang, Shang-Tian

    2014-07-01

    The production of n-butanol, a widely used industrial chemical and promising transportation fuel, from abundant, low-cost substrates, such as sugarcane juice, in acetone-butanol-ethanol (ABE) fermentation was studied with Clostridium acetobutylicum JB200, a mutant with high butanol tolerance and capable of producing high-titer (>20 g/L) n-butanol from glucose. Although JB200 is a favorable host for industrial bio-butanol production, its fermentation performance with sucrose and sugarcane juice as substrates has not been well studied. In this study, the long-term n-butanol production from sucrose by JB200 was evaluated with cells immobilized in a fibrous-bed bioreactor (FBB), showing stable performance with high titer (16-20 g/L), yield (∼ 0.21 g/g sucrose) and productivity (∼ 0.32 g/Lh) for 16 consecutive batches over 800 h. Sugarcane thick juice as low-cost substrate was then tested in 3 consecutive batches, which gave similar n-butanol production, demonstrating that JB200 is a robust and promising strain for industrial ABE fermentation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. The structure, rearrangement, and ontogenic expression of DB and JB gene segments of the Mexican axolotl T-cell antigen receptor beta chain (TCRB).

    Science.gov (United States)

    Kerfourn, F; Charlemagne, J; Fellah, J S

    1996-01-01

    We sequenced a total of 189 independent rearrangements in which the VB7.1 element is associated with CB1 (99 clones) or CB2 (90 clones) isotypes of the T-cell receptor (TCR) beta chain in the Mexican axolotl. Three stages of development were analyzed: 2.5 months, 10 months, and 25 months. Three JB1 segments were associated with the VB-CB1 rearrangements and six JB2 segments with VB-CB2. As in other vertebrates, some amino acid positions were conserved in all Jbetas (e. g., Phe-108, Gly-109, Gly-111, Thr-112, and Val-116). Two 11 nucleotides DB-like sequences, differed by one (A or T) central residue and could be productively read in the three putative reading frames. Most of the DB1 and JB1 segments were in the VB-CB1 clones, and most of the DB2 and JB2 segments were in the VB-CB2 clones, suggesting that the TCRB locus is organized into independent DB-JB-CB clusters that used the same collection of VB segments. About 40% of the beta-chain VDJ junctions in 2.5-month-old larvae had N nucleotides, compared with about 73% in 10 - 25-month old animals. The beta-chain VDJ junctions had about 30% of defective rearrangements at all stages of development, which could be due to the slow rate of cell division in the axolotl lymphoid organs, and the large genome in this urodele. Many of the axolotl CDRbeta3 sequences deduced for in frame VDJ rearrangements are the same in animals of different origins. Such redundancy could be a statistical effect due to the small number of thymocytes in the developing axolotl, rather than to some bias due to junctional preferences.

  8. Rahvaliit : Henri Kaselo süüdistus on idiootsus / Jüri Saar

    Index Scriptorium Estoniae

    Saar, Jüri, 1946-

    2008-01-01

    Keskerakonna Tartumaa piirkonna esimeheks valitud Tartu linnavolinik Henri Kaselo kritiseeris teravalt Rahvaliitu kuuluvaid Tartumaa vallajuhte, kelle juhtimisstiil ja korruptiivne poliitika polevat nõukogude ajast muutunud

  9. Elliptic solutions of generalized Brans-Dicke gravity with a non-universal coupling

    Energy Technology Data Exchange (ETDEWEB)

    Alimi, J.M.; Reverdy, V. [Observatoire de Paris, Laboratoire Univers et Theories (LUTh), Meudon (France); Golubtsova, A.A. [Observatoire de Paris, Laboratoire Univers et Theories (LUTh), Meudon (France); Peoples' Friendship University of Russia, Institute of Gravitation and Cosmology, Moscow (Russian Federation)

    2014-10-15

    We study a model of the generalized Brans-Dicke gravity presented in both the Jordan and in the Einstein frames, which are conformally related. We show that the scalar field equations in the Einstein frame are reduced to the geodesics equations on the target space of the nonlinear sigma model. The analytical solutions in elliptical functions are obtained when the conformal couplings are given by reciprocal exponential functions. The behavior of the scale factor in the Jordan frame is studied using numerical computations. For certain parameters the solutions can describe an accelerated expansion. We also derive an analytical approximation in exponential functions. (orig.)

  10. Ultrathin atomic vapor film transmission spectroscopy: analysis of Dicke narrowing structure

    Institute of Scientific and Technical Information of China (English)

    Yuanyuan Li; Yanpeng Zhang; Chenli Gan

    2005-01-01

    Transmission sub-Doppler spectroscopy with confined atomic vapor film between two dielectric walls is theoretically studied. Because of atoms flying from wall to wall, where they get de-excited, the atomfield interaction time is anisotropic so that the contribution of slow atoms is enhanced, a sub-Doppler transmission spectroscopy (Dicke narrowing effect) can be obtained when the thickness of the film is much small or comparable with the wavelength even at small angle oblique incidence. It is feasible to get a sub-Doppler structure in a new region (L <λ/4) in experiments.

  11. 2PN/RM gauge invariance in Brans-Dicke-like scalar-tensor theories

    CERN Document Server

    Minazzoli, Olivier

    2012-01-01

    In this note we study the 2PN/RM gauge invariance structure of a \\textit{Brans-Dicke-like} Scalar-Tensor Theories (STT) without potential. Since the spherical isotropic metric plays an important role in the literature, its 2PN/RM STT version is deduced from the general equations given in \\cite{moiCQG11}, by using the invariance structure properties. It is found that the second order Eddington parameter $\\epsilon$ can be written in terms of the usual post-Newtonian parameter $\\gamma$ and $\\beta$ as $ \\epsilon=4/3 \\gamma^2 + 4/3 \\beta - 1/6 \\gamma -3/2$

  12. Sub-Doppler Cavity Cooling Beyond The Lamb-Dicke Limit

    CERN Document Server

    Chuah, Boon Leng; Cazan, Radu; Barrett, Murray D

    2013-01-01

    We investigate the dynamics of cavity cooling of a single ion beyond the Lamb-Dicke regime and demonstrate a cooling limit of approximately 50% of the Doppler temperature using a high finesse cavity for the first time. We also study the statistical properties of the ion-cavity emission and present a model that maps the phonon states to the photon states. With this model, we explain the super-Poissonian photon distribution observed in our experiments and propose a method to estimate the ion temperature in a real-time manner based on the statistical behavior of the photon emission from the cavity.

  13. The Open-System Dicke-Model Quantum Phase Transition with a Sub-Ohmic Bath

    CERN Document Server

    Nagy, D

    2015-01-01

    We show that the critical exponent of a quantum phase transition in a damped-driven open system is determined by the spectral density function of the reservoir. We consider the open-system variant of the Dicke model, where the driven boson mode and also the large N-spin couple to independent reservoirs at zero temperature. The critical exponent, which is $1$ if there is no spin-bath coupling, decreases below 1 when the spin couples to a sub-Ohmic reservoir.

  14. Controlled Dicke Subradiance from a Large Cloud of Two-Level Systems

    CERN Document Server

    Bienaime, Tom; Kaiser, Robin

    2012-01-01

    Dicke superradiance has been observed in many systems and is based on constructive interferences between many scattered waves. The counterpart of this enhanced dynamics, subradiance, is a destructive interference effect leading to the partial trapping of light in the system. In contrast to the robust superradiance, subradiant states are fragile and spurious decoherence phenomena hitherto obstructed the observation of such metastable states. We show that a dilute cloud of cold atoms is an ideal system to look for subradiance in free space and study various mechanisms to control this subradiance.

  15. String cosmological models in the Brans-Dicke theory for five-dimensional space-time

    Institute of Scientific and Technical Information of China (English)

    Koijam Manihar Singh; Kangujam Priyokumar Singh

    2012-01-01

    Five-dimensional space-time string cosmological models generated by a cloud of strings with particles attached to them are studied in the Brans-Dicke theory.We obtain two types of interesting models by taking up the cases of geometric strings (or Nambu strings) and p-strings (Takabayasi strings),and study their different physical and dynamical properties.The roles of the scalar field in getting different phases,such as the inflationary phase and the string-dominated phase,are discussed.An interesting feature obtained here is that in one of the models there is a "bounce" at a particular instant of its evolution.

  16. Inflationary phase in Brans-Dicke cosmology with a cosmological constant

    Science.gov (United States)

    Berman, Marcelo Samuel

    1989-12-01

    It has been shown earlier that, for a perfect fluid, a perfect gas law of state, and the Robertson-Walker metric, an exponential phase in Brans-Dicke cosmology is possible, with both positive pressure and density, but not with the violated energy condition p = -ρ. We demonstrate in this paper that the inclusion of a cosmological constant into the theory does not change that picture. Permanent address: Departamento de Ciencias Exatas da Faculdade de Filosofia, Ceincias e Letras da FURJ, Joinville, SC 89200, Brazil.

  17. Uniqueness of the Machian Solution in the Brans-Dicke Theory

    OpenAIRE

    Miyazaki, A

    2001-01-01

    Machian solutions of which the scalar field exhibits the asymptotic behavior $\\phi =O(\\rho /\\omega)$ are generally explored for the homogeneous and isotropic universe in the Brans-Dicke theory. It is shown that the Machian solution is unique for the closed and the open space. Such a solution is restricted to one that satisfies the relation $GM/c^{2}a=const$, which is fixed to $\\pi $ in the theory for the closed model. Another type of solution satisfying $\\phi =O(\\rho /\\omega)$ with the arbitr...

  18. Deterministic distribution of four-photon Dicke state over an arbitrary collective-noise channel with cross-Kerr nonlinearity

    Science.gov (United States)

    Wang, Mei-Yu; Yan, Feng-Li; Gao, Ting

    2016-07-01

    We present two deterministic quantum entanglement distribution protocols for a four-photon Dicke polarization entangled state resorting to the frequency and spatial degrees of freedom, which are immune to an arbitrary collective-noise channel. Both of the protocols adopt the X homodyne measurement based on the cross-Kerr nonlinearity to complete the task of the single-photon detection with nearly unit probability in principle. After the four receivers share the photons, they add some local unitary operations to obtain a standard four-photon Dicke polarization entangled state.

  19. Simple Approach to the Solution of a Trapped and Radiated Cold Ion Beyond the Lamb-Dicke Limit

    Institute of Scientific and Technical Information of China (English)

    FENG Mang; SHI Lei; GAO Ke-Lin; ZHU Xi-Wen

    2002-01-01

    Trapping ions outside the Lamb-Dicke limit have been proven to be useful for the laser-cooling and quantum computing.Under the supposition of the Rabi frequency much smaller than the Lamb Dicke parameter,we can use a simple method to analytically solve the system with a single cold ion trapped and radiated beyond the Lamb Dickc limit,in the absence of the rotating-wave approximation (RWA).Discussion has been made for the limitation of our approach and the comparison of our results with the solutions under the RWA.

  20. A scheme for detecting the atom-field coupling constant in the Dicke superradiation regime using hybrid cavity optomechanical system.

    Science.gov (United States)

    Wang, Yueming; Liu, Bin; Lian, Jinling; Liang, Jiuqing

    2012-04-23

    We proposed a scheme for detecting the atom-field coupling constant in the Dicke superradiation regime based on a hybrid cavity optomechanical system assisted by an atomic gas. The critical behavior of the Dicke model was obtained analytically using the spin-coherent-state representation. Without regard to the dynamics of cavity field an analytical formula of one-to-one correspondence between movable mirror's steady position and atom-field coupling constant for a given number of atoms is obtained. Thus the atom-field coupling constant can be probed by measuring the movable mirror's steady position, which is another effect of the cavity optomechanics. © 2012 Optical Society of America

  1. [From apprenticeship to Nobel Prize: Henri Moissan's fabulous destiny].

    Science.gov (United States)

    Lafont, O

    2008-01-01

    Born in Paris on September 28, 1852, son of an eastern railways' employee and of a dressmaker, Henri Moissan's secondary schooling in Meaux did not allow him to get access to the sesame diploma "baccalauréat" (GCE). In 1869, he did obtain a special certificate of secondary schooling so that he could become an apprentice in watch making. That could have been the end of the story, but dreadful event for France appeared to have beneficial effects for Moissan. Under the threat of the Prussian army, Moissan's family took refuge near Paris. This gave the young Henri the opportunity to register as a student for the second-class pharmacy diploma, which did not need, at the time, the GCE. Moissan became then a trainee in pharmacy in 1871. Meanwhile, he followed the special schooling of "Ecole de chimie" founded by E. Frémy, and then joined the laboratory of Dehérain at the Museum, where he worked in plant physiology. He finally obtained the famous "baccalauréat" (GCE) and could register as a student in first-class pharmacy. He became a pharmacist as well as a doctor in sciences. In 1883, Moissan was named professor at the school of pharmacy in Paris. In 1886, he isolated fluorine by electrolysis of fluorhydric acid, in the presence of potassium fluoride, at a low temperature. He then studied diamond synthesis and gave a start to high temperature chemistry, designing his famous furnace. These findings and many others allowed Moissan to rise to membership in many learned academies around the world. Crowning achievement, Moissan won the Nobel Prize in 1906. A man of culture, collector of autographs and paintings, he died in 1907. Nothing of that would have been possible if there had not been a second-class pharmacist diploma. The history of Henri Moissan is one of a rise from apprenticeship to the Nobel Prize.

  2. Performance of an alkalophilic and halotolerant laccase from gamma-proteobacterium JB in the presence of industrial pollutants.

    Science.gov (United States)

    Singh, Gursharan; Sharma, Prince; Capalash, Neena

    2009-08-01

    An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.

  3. Henry Matthew: the father of modern clinical toxicology.

    Science.gov (United States)

    Proudfoot, A T; Prescott, L F

    2009-12-01

    Henry Matthew was appointed a consultant in the Royal Infirmary of Edinburgh in 1955, by which time he was a highly regarded general physician with an interest in cardiology. In 1964 he agreed, almost certainly reluctantly, to head the recently designated Regional Poisoning Treatment Centre, which he did until his retirement ten years later. Matthew quickly established himself as an authority in clinical toxicology, mainly from an unrivalled experience of treating poisoned patients, day-in and day-out, but also by publishing original research, letters and books. Such were his contributions that he is regarded as the father of clinical toxicology.

  4. Teoria das representações em Henri Lefebvre

    Directory of Open Access Journals (Sweden)

    Angelo Serpa

    2014-12-01

    Full Text Available This article looks for to clear one theory of representations in Henri Lefebvre’s work, taking his seminal book on the thematic: The presence and the absence as support. It is aimed to clear one theory and one concept of representation that can support one cultural and multidimensional boarding for Geography, with the articulation of the fields of dialectic and phenome- nology. The articulation between phenomenology and dialectic is justified in this context as a method necessity for understanding the processes of pro- duction of the space in the contemporary times, as basis for a Geography of the Lived Spaces. 

  5. Editing Cavendish: Maxwell and The Electrical Researches of Henry Cavendish

    CERN Document Server

    Falconer, Isobel

    2015-01-01

    During the last five years of his life, 1874-79, James Clerk Maxwell was absorbed in editing the electrical researches of Henry Cavendish, performed 100 years earlier. This endeavour is often assumed to be a work of duty to the Cavendish family, and an unfortunate waste of Maxwell's time. By looking at the history of Cavendish's papers, and the editorial choices that Maxwell made, this paper questions this assumption, considering the importance of Cavendish's experiments in Maxwell's electrical programme, and the implications that he may have derived for developing a doctrine of experimental method.

  6. Henri Ey's neojacksonism and the psychopathology of disintegrated mind.

    Science.gov (United States)

    Farina, Benedetto; Ceccarelli, Maurizio; Di Giannantonio, Massimo

    2005-01-01

    The French psychiatrist Henri Ey developed his organo-dynamic theory of the mind function and consciousness 50 years ago incorporating Hughling Jackson's thinking, along with psychiatric and philosophical theorizations by Janet and Bergson. This model has not received the attention it deserved, but recent advances in neuroscience rekindled interest for Ey's theory. By overcoming the Cartesian mind-body dualism and treating the mind-body unit as an inseparable whole, this model opens the way for the integrated treatment of mental disorders. Ey's conceptualization of consciousness as being simultaneously both synchronous and diachronic anticipates current theories of consciousness (Damasio, Edelman, Mesulam).

  7. Henri Frankfort, Aby Warburg and “Mythopoeic Thought”

    Directory of Open Access Journals (Sweden)

    Paul Taylor

    2011-12-01

    Full Text Available This is the text of a lunchtime lecture given at the Warburg Institute in the spring of 2004. It formed part of a series concerned with past Warburg scholars, and was devoted to the work of Henri Frankfort, Director of the Institute from 1949 to 1954. The first third of the lecture was a rapid account of his career; the remainder of the lecture was an analysis and criticism of the concept of ‘primitive thinking’ in the work of Frankfort and Aby Warburg.

  8. O pensamento crítico de Henri Lefebvre

    Directory of Open Access Journals (Sweden)

    William Gómez Soto

    2012-12-01

    Full Text Available Este trabalho é uma análise da presença de Henri Lefebvre na sociologia brasileira. Lefebvre faz uma leitura crítica de Marx, recuperando o método dialético e propondo uma teoria da vida cotidiana. José de Souza Martins influenciado por Lefebvre e utilizando o método dialético, analisa o processo histórico da constituição do capitalismo brasileiro. Apesar de que há certa presença de Lefebvre na sociologia brasileira, ainda a riqueza de sua obra está para ser descoberta.

  9. Robert Dicke and the naissance of experimental gravity physics, 1957-1967

    Science.gov (United States)

    Edwin Peebles, Phillip James

    2016-10-01

    The experimental study of gravity became much more active in the late 1950s, a change pronounced enough be termed the birth, or naissance, of experimental gravity physics. I present a review of developments in this subject since 1915, through the broad range of new approaches that commenced in the late 1950s, and up to the transition of experimental gravity physics to what might be termed a normal and accepted part of physical science in the late 1960s. This review shows the importance of advances in technology, here as in all branches of natural science. The role of contingency is illustrated by Robert Dicke's decision in the mid-1950s to change directions in mid-career, to lead a research group dedicated to the experimental study of gravity. The review also shows the power of nonempirical evidence. Some in the 1950s felt that general relativity theory is so logically sound as to be scarcely worth the testing. But Dicke and others argued that a poorly tested theory is only that, and that other nonempirical arguments, based on Mach's Principle and Dirac's Large Numbers hypothesis, suggested it would be worth looking for a better theory of gravity. I conclude by offering lessons from this history, some peculiar to the study of gravity physics during the naissance, some of more general relevance. The central lesson, which is familiar but not always well advertised, is that physical theories can be empirically established, sometimes with surprising results.

  10. Gravitational radiation from compact binary systems in the massive Brans-Dicke theory of gravity

    CERN Document Server

    Alsing, Justin; Will, Clifford; Zaglauer, Helmut

    2011-01-01

    We derive the equations of motion, the periastron shift, and the gravitational radiation damping for quasicircular compact binaries in a massive variant of the Brans-Dicke theory of gravity. We also study the Shapiro time delay and the Nordtvedt effect in this theory. By comparing with recent observational data, we put bounds on the two parameters of the theory: the Brans-Dicke coupling parameter \\omega_{BD} and the scalar mass m_s. We find that the most stringent bounds come from Cassini measurements of the Shapiro time delay in the Solar System, that yield a lower bound \\omega_{BD}>40000 for scalar masses m_s1000 for m_s1250 for m_s<10^{-20} eV. A first estimate suggests that bounds comparable to the Shapiro time delay may come from observations of radiation damping in the eccentric white dwarf-neutron star binary PSR J1141-6545, but a quantitative prediction requires the extension of our work to eccentric orbits.

  11. Gravitational Collapse In Husain Space-time For Brans-Dicke Gravity Theory

    CERN Document Server

    Rudra, Prabir; Debnath, Ujjal

    2013-01-01

    The motive of this work is to study gravitational collapse in Husain space-time, in Brans-Dicke gravity theory. Among many scalar-tensor theories of gravity, Brans-Dicke is the simplest and the impact of it can be regulated by two parameters, coupling constant $\\omega$, and the assumed field dependency parameter $n$. V. Husain's work on exact solution for null fluid collapse in 1996 has influenced many authors to follow his way to find the end-state of the homogeneous/inhomogeneous dust cloud collapse using Vaidya's metric. Detecting whether the cosmological singularity is naked or wrapped by an event horizon, by the existence of future directed radial null geodesic emitted in past from the singularity is the basic objective. To point out the existence of positive trajectory tangent solution, both particular parametric cases (through tabular forms) and wide range contouring process have been applied. Precisely, perfect fluid's EoS ($p=k\\rho$) satisfies a wide range of phenomena: from dust to exotic fluid like...

  12. Phase transition of charged Black Holes in Brans-Dicke theory through geometrical thermodynamics

    Science.gov (United States)

    Hendi, S. H.; Panahiyan, S.; Panah, B. Eslam; Armanfard, Z.

    2016-07-01

    In this paper, we take into account black hole solutions of Brans-Dicke-Maxwell theory and investigate their stability and phase transition points. We apply the concept of geometry in thermodynamics to obtain phase transition points and compare its results with those, calculated in the canonical ensemble through heat capacity. We show that these black holes enjoy second order phase transitions. We also show that there is a lower bound for the horizon radius of physical charged black holes in Brans-Dicke theory, which originates from restrictions of positivity of temperature. In addition, we find that employing a specific thermodynamical metric in the context of geometrical thermodynamics yields divergencies for the thermodynamical Ricci scalar in places of the phase transitions. It will be pointed out that due to the characteristic behavior of the thermodynamical Ricci scalar around its divergence points, one is able to distinguish the physical limitation point from the phase transitions. In addition, the free energy of these black holes will be obtained and its behavior will be investigated. It will be shown that the behavior of the free energy in the place where the heat capacity diverges demonstrates second order phase transition characteristics.

  13. Observational constraints of the gravitational waves in the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Freitas, Rodolfo Camargo de; Goncalves, Sergio Vitorino de Borba [Universidade Federal do Espirito Santo (UFES), ES (Brazil). Dept. de Fisica. Grupo de Gravitacao e Cosmologia

    2011-07-01

    Full text: The cosmic inflation, which is the hypotheses that the early Universe has passed by a period of exponential expansion, is currently the most accepted and studied theory to explain the early fluctuations which evolved to the large scales structures which we observe today. The gravitational waves, when detected, can give us important information about inflation. In this work we investigate the quantum origin of the primordial cosmological gravitational waves in the Brans-Dicke theory. We compute the number of gravitons N{sub k} produced during the extended inflation and the three observables: the power spectrum P{sub T}, the spectral index n{sub T} and the energy density of the gravitational waves {Omega}{sub k}. By comparison with general relativity we see that the results for both theories are the same for the case of the particles number N{sub k} and for the case of the power spectrum P{sub T} and the energy density {Omega}{sub k} only when the Brans-Dicke coupling parameter {omega} has a value less than 10. For the spectral index n{sub T} we found that when {omega} is bigger than unity the spectral index approximates the expression found in the General Relativity. This may awake us to the possibility that {omega} varies with the cosmological scale. (author)

  14. Non-equilibrium dynamical phases of the two-atom Dicke model

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacherjee, Aranya B.

    2014-09-12

    In this paper, we investigate the non-equilibrium dynamical phases of the two-atom Dicke model, which can be realized in a two species Bose–Einstein condensate interacting with a single light mode in an optical cavity. Apart from the usual non-equilibrium normal and inverted phases, a non-equilibrium mixed phase is possible which is a combination of normal and inverted phase. A new kind of dynamical phase transition is predicted from non-superradiant mixed phase to the superradiant phase which can be achieved by tuning the two different atom–photon couplings. We also show that a dynamical phase transition from the non-superradiant mixed phase to the superradiant phase is forbidden for certain values of the two atom–photon coupling strengths. - Highlights: • We investigate the non-equilibrium dynamical phases of the two-atom Dicke model. • The dynamical phase diagram reveals a new kind of non-equilibrium mixed phase. • A new kind of dynamical phase transition is predicted from mixed phase to the superradiant phase. • In the dynamical phase diagram of the mixed phase, there are regions where the superradiant phase cannot exist.

  15. Stellar explosion in the weak field approximation of the Brans-Dicke theory

    Energy Technology Data Exchange (ETDEWEB)

    Hamity, Victor H; Barraco, Daniel E [FaMAF, Universidad Nacional de Cordoba, Ciudad Universitaria, Cordoba 5000 (Argentina)

    2005-10-07

    We treat a very crude model of an exploding star, in the weak field approximation of the Brans-Dicke theory, in a scenario that resembles some characteristic data of a type Ia supernova. The most noticeable feature, in the electromagnetic component, is the relationship between the absolute magnitude at maximum brightness of the star and the decline rate in one magnitude from that maximum. This characteristic has become one of the most accurate methods to measure luminosity distances to objects at cosmological distances (Phillips M M 1993 Astrophys. J. 413 L105; see www.all-science-fair-projects.com/ science{sub f}air{sub p}rojects{sub e}ncyclopedia/Supernova, for a brief description of supernovae types). An interesting result is that the active mass associated with the scalar field is totally radiated to infinity, representing a mass loss in the ratio of the 'tensor' component to the scalar component of 1 to (2{omega} + 3) ({omega} is the Brans-Dicke parameter), in agreement with a general result of Hawking (1972 Commun. Math. Phys. 25 167). Then, this model shows explicitly, in a dynamical case, the mechanism of the radiation of a scalar field, which is necessary to understand the Hawking result.

  16. Digital-analog quantum simulation of generalized Dicke models with superconducting circuits

    Science.gov (United States)

    Lamata, Lucas

    2017-01-01

    We propose a digital-analog quantum simulation of generalized Dicke models with superconducting circuits, including Fermi- Bose condensates, biased and pulsed Dicke models, for all regimes of light-matter coupling. We encode these classes of problems in a set of superconducting qubits coupled with a bosonic mode implemented by a transmission line resonator. Via digital-analog techniques, an efficient quantum simulation can be performed in state-of-the-art circuit quantum electrodynamics platforms, by suitable decomposition into analog qubit-bosonic blocks and collective single-qubit pulses through digital steps. Moreover, just a single global analog block would be needed during the whole protocol in most of the cases, superimposed with fast periodic pulses to rotate and detune the qubits. Therefore, a large number of digital steps may be attained with this approach, providing a reduced digital error. Additionally, the number of gates per digital step does not grow with the number of qubits, rendering the simulation efficient. This strategy paves the way for the scalable digital-analog quantum simulation of many-body dynamics involving bosonic modes and spin degrees of freedom with superconducting circuits. PMID:28256559

  17. Effects of anisotropy on interacting ghost dark energy in Brans-Dicke theories

    Science.gov (United States)

    Hossienkhani, H.; Fayaz, V.; Azimi, N.

    2017-03-01

    In this work we concentrate on the ghost dark energy model within the framework of the Brans-Dicke theory in an anisotropic Universe. Within this framework we discuss the behavior of equation of state, deceleration and dark energy density parameters of the model. We consider the squared sound speed and quest for signs of stability of the model. We also probe observational constraints by using the latest observational data on the ghost dark energy models as the unification of dark matter and dark energy. In order to do so, we focus on observational determinations of the Hubble expansion rate (namely, the expansion history) H(z). Then we evaluate the evolution of the growth of perturbations in the linear regime for both ghost DE and Brans-Dicke theory and compare the results with standard FRW and ΛCDM models. We display the effects of the anisotropy on the evolutionary behavior the ghost DE models where the growth rate is higher in this models. Eventually the growth factor for the ΛCDM Universe will always fall behind the ghost DE models in an anisotropic Universe.

  18. Digital-analog quantum simulation of generalized Dicke models with superconducting circuits

    Science.gov (United States)

    Lamata, Lucas

    2017-03-01

    We propose a digital-analog quantum simulation of generalized Dicke models with superconducting circuits, including Fermi- Bose condensates, biased and pulsed Dicke models, for all regimes of light-matter coupling. We encode these classes of problems in a set of superconducting qubits coupled with a bosonic mode implemented by a transmission line resonator. Via digital-analog techniques, an efficient quantum simulation can be performed in state-of-the-art circuit quantum electrodynamics platforms, by suitable decomposition into analog qubit-bosonic blocks and collective single-qubit pulses through digital steps. Moreover, just a single global analog block would be needed during the whole protocol in most of the cases, superimposed with fast periodic pulses to rotate and detune the qubits. Therefore, a large number of digital steps may be attained with this approach, providing a reduced digital error. Additionally, the number of gates per digital step does not grow with the number of qubits, rendering the simulation efficient. This strategy paves the way for the scalable digital-analog quantum simulation of many-body dynamics involving bosonic modes and spin degrees of freedom with superconducting circuits.

  19. Brans-Dicke inflation in light of the Planck 2015 data

    CERN Document Server

    Tahmasebzadeh, B; Karami, K

    2016-01-01

    We study inflation in the Brans-Dicke gravity as a special model of the scalar-tensor gravity. We obtain the inflationary observables containing the scalar spectral index, the tensor-to-scalar ratio, the running of the scalar spectral index and the equilateral non-Gaussianity parameter in terms of the general form of the potential in the Jordan frame. Then, we compare the results for various inflationary potentials in light of the Planck 2015 data. Our study shows that in the Brans-Dicke gravity, the power-law, inverse power-law and exponential potentials are ruled out by the Planck 2015 data. But, the hilltop, Higgs, Coleman-Weinberg and natural potentials can be compatible with Planck 2015 TT,TE,EE+lowP data at 95\\% CL. Moreover, the D-brane, SB SUSY and displaced quadratic potentials can be in well agreement with the observational data since their results can lie inside the 68\\% CL region of Planck 2015 TT,TE,EE+lowP data.

  20. Bianchi type I anisotropic universe and stability interacting ghost dark energy in Brans-Dicke theories

    CERN Document Server

    Hossienkhani, Hossien

    2016-01-01

    A spatially homogeneous and anisotropic Bianchi type I universe has been studied with the ghost dark energy (GDE) in the framework of Brans-Dicke theory. For this purpose, we use the squared sound speed $v_s^2$ whose sign determines the stability of the model. At first, we obtain the equation of state parameter, $\\omega_\\Lambda$, the deceleration parameter $q$ and the evolution equation of the ghost dark energy. Then, we extend our study to the case of ghost dark energy in a non-isotropic and Brans-Dicke framework and find out that the transition of $\\omega_\\Lambda$ to the phantom regime can be more easily accounted for than when it is restored into the Einstein field equations. Our numerical result show the effects of the interaction and anisotropic on the evolutionary behaviour the ghost dark energy models. In conclusion, we find evidence that the ghost dark energy in BD theory can lead to a stable universe favored by observations at the present time.

  1. Exploring Co-Authorship in 2 Henry VI

    Directory of Open Access Journals (Sweden)

    Darren Freebury-Jones

    2016-03-01

    Full Text Available The article explores the possibility extended by Hugh Craig and Arthur Kinney that 2 Henry VI is a collaborative play. Passages attributed to Peele and Shakespeare in Titus Andronicus were tested for ‘rare’ tetragrams (i.e. instances which occur less than five times in plays first performed between 1580-1600 in order to gain an insight into authorial borrowing and self-borrowing. In this respect, the article combines Martin Mueller’s work on tetragrams plus (four plus word sequences in ‘Shakespeare His Contemporaries’, with that of Ian Lancashire’s studies on authors’ working memories. The same methodology was also applied to passages attributed to Shakespeare and his co-author in Edward III. In particular, this study tests Act 3 of 2 Henry VI, which is considered Shakespeare’s primary contribution by Craig and Kinney, against the remainder of the play, in order to examine whether shared verbal parallels signify associative groupings at the forefront of Shakespeare’s mind as he composed the play, or whether these parallels indicate separate authorial cognitive processes.

  2. Evaluation of confinement effects in zeolites under Henry's adsorption regime

    Science.gov (United States)

    Pera-Titus, Marc; Llorens, Joan

    2010-06-01

    This paper provides a detailed thermodynamic analysis of gas/vapour adsorption in zeolites at low pressures. At these conditions, we show first that Henry's isotherm can be conveniently rewritten using the thermodynamic isotherm model developed in a previous study [J. Llorens, M. Pera-Titus, Description of gas adsorption on microporous materials: evaluation of energy heterogeneity, J. Colloid Interface Sci. 331, 2009, 302-311], linking the integral free energy of adsorption relative to saturation, Ψ/ RT, expressed as a Kiselev integral, with the variable Z = 1/-ln( Π), being Π the relative pressure. Relevant information about sorbate confinement effects in zeolites can be inferred using strong sorbates under Henry's adsorption regime using the thermodynamic formulation provided here. The confining level of zeolites can be characterized by a parameter ( m1), whose value depends on the zeolite framework, but remains essentially unchanged with the sorbate probe molecule and temperature. We illustrate the application of these concepts using a collection of MFI and MTW-type zeolites as model systems.

  3. Involvement of the antioxidative property of morusin in blocking phorbol ester-induced malignant transformation of JB6 P(+) mouse epidermal cells.

    Science.gov (United States)

    Cheng, Pai-Shan; Hu, Chao-Chin; Wang, Chau-Jong; Lee, Yean-Jang; Chung, Wei-Chia; Tseng, Tsui-Hwa

    2017-02-25

    Chemoprevention has been acknowledged as an important and practical strategy for managing cancer. We have previously synthesized morusin, a prenylated flavonoid that exhibits anti-cancer progression activity. In the present study, we evaluated the anti-cancer promotion potential of morusin by using the mouse epidermal JB6 P(+) cell model. Extensive evidence shows that tumor promotion by phorbol esters is due to the stimulation of reactive oxygen species (ROS). Therefore, the effect of morusin on 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced ROS production was assessed. Noncytotoxic concentrations of morusin were found to dose-dependently reduce TPA-induced ROS production. Moreover, morusin inhibited TPA-induced activator protein-1 (AP-1) and nuclear factor-kappa B (NF-κB) activation, which can mediate cell proliferation and malignant transformation. Furthermore, morusin inhibited the TPA upregulation of cyclooxygenase 2 (COX-2), which may be regulated by AP-1 and NF-κB. In addition, noncytotoxic concentrations of morusin reduced the TPA-promoted cell growth of JB6 P(+) cells and inhibited TPA-induced malignant properties, such as cytoskeletal rearrangement and cell migration of JB6 P(+) cells. Similar to the effects of glutathione (GSH) pretreatment, morusin inhibited TPA-induced expression of N-cadeherin and vimentin, which are malignant cell surface proteins. Finally, morusin treatment dose-dependently suppressed the TPA-induced anchorage-independent cell transformation of JB6 P(+) cells. In conclusion, our results evidence that morusin possesses anti-cancer promotion potential because of its antioxidant property, which mediates multiple transformation-associated gene expression.

  4. An Exploration of the Theme in “Paste” by Henry James

    Institute of Scientific and Technical Information of China (English)

    Guo Liqun

    2016-01-01

    “Paste” is a 5,800-word short story by Henry James which attracts many critics’ attention. However, many people hold misunderstanding towards it because of he cumbersome style of Henry James and his misplaced illustration. After settling down the main mysteries in the story, the theme revealed as a critique about the sex trade.

  5. USA asepresident: Venemaa kahjustas tõsiselt oma usaldusväärsust ja mainet / Dick Cheney

    Index Scriptorium Estoniae

    Cheney, Dick

    2008-01-01

    USA asepresident Dick Cheney ütles Itaalias Ambrosetti foorumil peetud kõnes, et Venemaa agressiivsed sammud on õõnestanud suhteid Ühendriikidega ja tugevdanud muret, mida paljud tunnevad Venemaa üldisemate eesmärkide pärast

  6. USA asepresident: Venemaa kahjustas tõsiselt oma usaldusväärsust ja mainet / Dick Cheney

    Index Scriptorium Estoniae

    Cheney, Dick

    2008-01-01

    USA asepresident Dick Cheney ütles Itaalias Ambrosetti foorumil peetud kõnes, et Venemaa agressiivsed sammud on õõnestanud suhteid Ühendriikidega ja tugevdanud muret, mida paljud tunnevad Venemaa üldisemate eesmärkide pärast

  7. PKM2 inhibitor shikonin suppresses TPA-induced mitochondrial malfunction and proliferation of skin epidermal JB6 cells.

    Science.gov (United States)

    Li, Wenjuan; Liu, Joan; Zhao, Yunfeng

    2014-05-01

    Chemoprevention has been a pivotal and effective strategy during the skin cancer treatment. Using human skin normal and tumor samples, we demonstrated that both the expression and activity levels of pyruvate kinase M2 (PKM2) were higher in skin tumor tissues than normal tissues, suggesting that PKM2, one of important metabolic enzyme, might serve as a target for skin cancer prevention and/or therapy. Shikonin, a small-molecule active chemical, has been studied as an anti-cancer drug candidate in human cancer models. However, the mechanism of action and the chemopreventive potential of shikonin are unclear. Herein, we used the skin epidermal JB6 P+ cells and demonstrated that shikonin suppressed the tumor promoter 12-O-tetradecanoylphorbol 13-acetate (TPA) induced neoplastic cell transformation and PKM2 activation in the early stage of carcinogenesis. Mitochondrial functions were inhibited by TPA treatment, as indicated by reduced mitochondrial membrane potential and mitochondrial respiration, which were restored by shikonin. We also examined the levels of lactate as a glycolysis marker, and shikonin suppressed its increase caused by tumor promoter treatment. Modulation of cell metabolism by shikonin was associated with G2-M phase accumulation, and Fra-1 (a major subunit of activator protein 1 in skin tumorigenesis) downregulation. In addition, we demonstrated that AMP-activated protein kinase (AMPK), an energy sensor, which is inactivated by TPA, shikonin could reverse AMPK activity. These results suggest that shikonin bears chemopreventive potential for human skin cancers in which PKM2 is upregulated, which might be mediated by inhibiting oncogenic activation, PKM2 activation, and mitochondrial dysfunction.

  8. Henry Mayhew: jornalista, investigador social e precursor da pesquisa qualitativa Henry Mayhew: journalist, social investigator, and foreshadower of qualitative research

    Directory of Open Access Journals (Sweden)

    Everardo Duarte Nunes

    2012-09-01

    Full Text Available Henry Mayhew serviu-se de sua profissão, o jornalismo, para registrar o dia a dia da Londres da segunda metade do século XIX de uma forma que até hoje interessa historiadores e cientistas sociais, como obra precursora da pesquisa qualitativa. Este artigo destaca aspectos metodológicos das investigações de Mayhew e analisa dois de seus relatos: sobre o surto de cólera e sobre uma vendedora de rua. Aborda também trabalhos críticos que tomam sua obra como referência.As a journalist, Henry Mayhew recorded daily life in London in the latter half of the nineteenth century. His approach remains of interest to historians and social scientists today in that it foreshadowed qualitative research. The article highlights methodological aspects of Mayhew's investigations and analyzes two of his reports, one on a cholera outbreak and the other on a female street vendor. It also addresses some analyses that have critiqued his work.

  9. Gravitational Collapse in Husain space-time for Brans-Dicke Gravity Theory with Power-law Potential.

    Science.gov (United States)

    Rudra, Prabir

    2016-07-01

    The motive of this work is to study gravitational collapse in Husain space-time in Brans-Dicke gravity theory. Among many scalar-tensor theories of gravity, Brans-Dicke is the simplest and the impact of it can be regulated by two parameters associated with it, namely, the Brans-Dicke parameter, ω, and the potential-scalar field dependency parameter 'n' respectively. V. Husain's work on exact solution for null fluid collapse in 1996 has influenced many authors to follow his way to find the end-state of the homogeneous/inhomogeneous dust cloud. Vaidya's metric is used all over to follow the nature of future outgoing radial null geodesics. Detecting whether the central singularity is naked or wrapped by an event horizon, by the existence of future directed radial null geodesic emitted in past from the singularity is the basic objective. To point out the existence of positive trajectory tangent solution, both particular parametric cases(through tabular forms) and wide range contouring process have been applied. Precisely, perfect fluid's equation of state satisfies a wide range of phenomena : from dust to exotic fluid like dark energy. We have used the equation of state parameter 'k' to determine the end state of collapse in different cosmological era. Our main target is to check low ω (more deviations from Einstein gravity-more Brans Dicke effect) and negative 'k' zones. This particularly throws light on the nature of the end-state of collapse in accelerated expansion in Brans Dicke gravity. It is seen that for positive values of EoS parameter 'k', the collapse results in a black hole, whereas for negative values of 'k', naked singularity is the only outcome. It is also to be noted that "low ω" leads to the possibility of getting more naked singularities even for a non-accelerating universe.

  10. Henri Pirenne: Historian and Man of the World

    Directory of Open Access Journals (Sweden)

    Sarah Keymeulen

    2016-12-01

    Full Text Available Henri Pirenne (1862-1935 is generally recognised as one of the most influential European historians of the late nineteenth- and early twentieth-century. The combination of his scholarly activity with the social mission that he set himself earned him an extraordinarily successful career and a double reputation: at least in Belgium, he was regarded not only as a ‘father of history’, but also as great citizen. Although his influence was unmistakably large, there is no consensus about the existence or the nature of a ‘Pirennian persona’. He combined the ideal collection of skills, values and standards required of historians with very specific personal characteristics. At the same time he was inextricably linked to a certain era and a certain Belgium that died with him. Pirenne therefore, did not so much represent a new type of scientific persona as the prestige of an idealised, long-vanished Belgium and its corresponding academic culture. Henri Pirenne. Historicus en man van de wereldHenri Pirenne (1862-1935 wordt beschouwd als één van de meest invloedrijke Europese geschiedschrijvers van de laatnegentiende en vroegtwintigste eeuw. Het verband tussen zijn wetenschappelijke activiteit en de maatschappelijke taak die hij voor zichzelf zag weggelegd, leverde hem een uitzonderlijk succesvolle carrière en een dubbele reputatie op. Pirenne staat, althans in België, immers niet alleen geboekstaafd als een ‘vader van de geschiedenis’, maar ook als een groot staatsburger. Hoewel de invloed van Pirenne onmiskenbaar groot is geweest, is er geen consensus over het bestaan of de aard van een ‘pirenniaanse persona’. Hij combineerde het ideaalpakket van vaardigheden, normen en waarden die historici werden geacht te bezitten met zeer specifieke karaktereigenschappen. Tegelijk was hij onlosmakelijk verknoopt met een zeker tijdsgewricht en een zeker België, dat samen met hem ter ziele ging. Pirenne stond dan ook niet zozeer model voor een nieuw

  11. Henri Pirenne: Historian and Man of the World.

    Directory of Open Access Journals (Sweden)

    S. Keymeulen

    2016-12-01

    Full Text Available Henri Pirenne (1862-1935 is generally recognised as one of the most influential European historians of the late nineteenth- and early twentieth-century. The combination of his scholarly activity with the social mission that he set himself earned him an extraordinarily successful career and a double reputation: at least in Belgium, he was regarded not only as a ‘father of history’, but also as great citizen. Although his influence was unmistakably large, there is no consensus about the existence or the nature of a ‘Pirennian persona’. He combined the ideal collection of skills, values and standards required of historians with very specific personal characteristics. At the same time he was inextricably linked to a certain era and a certain Belgium that died with him. Pirenne therefore, did not so much represent a new type of scientific persona as the prestige of an idealised, long-vanished Belgium and its corresponding academic culture. Henri Pirenne. Historicus en man van de wereld. Henri Pirenne (1862-1935 wordt beschouwd als één van de meest invloedrijke Europese geschiedschrijvers van de laatnegentiende en vroegtwintigste eeuw. Het verband tussen zijn wetenschappelijke activiteit en de maatschappelijke taak die hij voor zichzelf zag weggelegd, leverde hem een uitzonderlijk succesvolle carrière en een dubbele reputatie op. Pirenne staat, althans in België, immers niet alleen geboekstaafd als een ‘vader van de geschiedenis’, maar ook als een groot staatsburger. Hoewel de invloed van Pirenne onmiskenbaar groot is geweest, is er geen consensus over het bestaan of de aard van een ‘pirenniaanse persona’. Hij combineerde het ideaalpakket van vaardigheden, normen en waarden die historici werden geacht te bezitten met zeer specifieke karaktereigenschappen. Tegelijk was hij onlosmakelijk verknoopt met een zeker tijdsgewricht en een zeker België, dat samen met hem ter ziele ging. Pirenne stond dan ook niet zozeer model voor een nieuw

  12. The spirit of Henry Norman Bethune and gastroenterology

    Institute of Scientific and Technical Information of China (English)

    Hugh J Freeman

    2008-01-01

    Henry Norman Bethune was a physician and surgeon from Canada. He had a highly impressive medical career in Montreal but did his most important work in China where he cared for soldiers on the battlefield. He died in 1939 and was recognized as a hero, but only much later received recognition in Canada. He was a skilled doctor, both as a physician and as a surgeon. However, he was much more and will serve as an inspiration for this series. He was an innovator, an idealist and a perfectionist. It is hoped that this series will gather expert commentades on a range of issues critical to the subspecialty from fundamental science to dinical care so that future directions can be defined.

  13. Dante, l’Aviso piacevole et Henri de Navarre

    OpenAIRE

    Balsamo, Jean

    2009-01-01

    Balthazar Grangier fut l’auteur de la première traduction française de la Commedia, publiée en 1596. Cette édition, dédiée au roi Henri IV par un de ses aumôniers, venait après la réconciliation du roi avec Rome et célébrait ses retrouvailles avec son royaume. Elle ne confirmait pas, au contraire, l’accueil et la reconnaissance de Dante par les lettres françaises. Grangier était conscient de la difficulté de l’œuvre du poète florentin, au «stile concis, difficile et particulier à un seul», co...

  14. People in the News: Henry Owino and Katarzyna Dudek

    Directory of Open Access Journals (Sweden)

    Lorraine Estelle

    2017-03-01

    Full Text Available At the Charleston Library Conference your Insights Editors were intrigued to read a presentation abstract which stated: ‘“A library collection should fit the mission for which it is created. The number of books it holds does not determine its worth.” (E J Loveland, 2000. If so, how do we create a national library and how do we build its collection from scratch without making many mistakes?’ We went along to the presentation and were privileged to meet Henry Owino and Katarzyna Dudek, who talked about their involvement in the project to develop a collection for the Qatar National Library (QNL, which is due to be opened shortly. Their presentation focused on their three years’ experience of selection, acquisition and processing of library materials in order to achieve the Opening Day Collection.

  15. Thinking in time an introduction to Henri Bergson

    CERN Document Server

    Guerlac, Suzanne

    2006-01-01

    "In recent years, we have grown accustomed to philosophical language that is intensely self-conscious and rhetorically thick, often tragic in tone. It is enlivening to read Bergson, who exerts so little rhetorical pressure while exacting such a substantial effort of thought. . . . Bergson's texts teach the reader to let go of entrenched intellectual habits and to begin to think differently—to think in time. . . . Too much and too little have been said about Bergson. Too much, because of the various appropriations of his thought. Too little, because the work itself has not been carefully studied in recent decades."—from Thinking in TimeHenri Bergson (1859–1941), whose philosophical works emphasized motion, time, and change, won the Nobel Prize for Literature in 1927. His work remains influential, particularly in the realms of philosophy, cultural studies, and new media studies. In Thinking in Time, Suzanne Guerlac provides readers with the conceptual and contextual tools necessary for informed appreciati...

  16. Emily Dickinson's ophthalmic consultation with Henry Willard Williams, MD.

    Science.gov (United States)

    Blanchard, Donald L

    2012-12-01

    Emily Dickinson is one of America's premier poets of the 19th century. Henry Willard Williams, MD, was one of the very first physicians to limit his practice to ophthalmology and was the established leader in his field in Boston, Massachusetts. They met during the time of the Civil War, when Emily consulted him about her ophthalmic disorder. No records of the diagnosis survive. Photophobia, aching eyes, and a restriction in her ability to work up close were her main symptoms. Iritis, exotropia, or psychiatric problems are the most frequent diagnoses offered to explain her difficulties. Rather than attempt a definitive conclusion, this article will offer an additional possibility that Dr Williams likely considered (ie, hysterical hyperaesthesia of the retina). This was a common diagnosis at that time, although it has currently faded from use.

  17. Transcriptomic Response to Nitric Oxide Treatment in Larix olgensis Henry

    Directory of Open Access Journals (Sweden)

    Xiaoqing Hu

    2015-12-01

    Full Text Available Larix olgensis Henry is an important coniferous species found in plantation forests in northeastern China, but it is vulnerable to pathogens. Nitric oxide (NO is an important molecule involved in plant resistance to pathogens. To study the regulatory role of NO at the transcriptional level, we characterized the transcriptomic response of L. olgensis seedlings to sodium nitroprusside (SNP, NO donor using Illumina sequencing and de novo transcriptome assembly. A significant number of putative metabolic pathways and functions associated with the unique sequences were identified. Genes related to plant pathogen infection (FLS2, WRKY33, MAPKKK, and PR1 were upregulated with SNP treatment. This report describes the potential contribution of NO to disease resistance in L. olgensis as induced by biotic stress. Our results provide a substantial contribution to the genomic and transcriptomic resources for L. olgensis, as well as expanding our understanding of the involvement of NO in defense responses at the transcriptional level.

  18. Transcriptomic Response to Nitric Oxide Treatment in Larix olgensis Henry.

    Science.gov (United States)

    Hu, Xiaoqing; Yang, Jingli; Li, Chenghao

    2015-12-02

    Larix olgensis Henry is an important coniferous species found in plantation forests in northeastern China, but it is vulnerable to pathogens. Nitric oxide (NO) is an important molecule involved in plant resistance to pathogens. To study the regulatory role of NO at the transcriptional level, we characterized the transcriptomic response of L. olgensis seedlings to sodium nitroprusside (SNP, NO donor) using Illumina sequencing and de novo transcriptome assembly. A significant number of putative metabolic pathways and functions associated with the unique sequences were identified. Genes related to plant pathogen infection (FLS2, WRKY33, MAPKKK, and PR1) were upregulated with SNP treatment. This report describes the potential contribution of NO to disease resistance in L. olgensis as induced by biotic stress. Our results provide a substantial contribution to the genomic and transcriptomic resources for L. olgensis, as well as expanding our understanding of the involvement of NO in defense responses at the transcriptional level.

  19. Dilatonic Brans-Dicke Anisotropic Collapsing Fluid Sphere And de Broglie Quantum Wave Motion

    Science.gov (United States)

    Ghaffarnejad, Hossein

    2016-08-01

    Two dimensional (2D) analogue of vacuum sector of the Brans Dicke (BD) gravity [1] is studied to obtain dynamics of anisotropic spherically symmetric perfect fluid. Our obtained static solutions behave as dark matter with state equation but in non-static regimes behave as regular perfect fluid with barotropic index ϒ > 0. Positivity property of total mass of the fluid causes that the BD parameter to be ω >2/3 and/or ω 0 the apparent horizon is covered by event horizon where the cosmic censorship hypothesis is still valid. According to the model [1], we obtain de Broglie pilot wave of our metric solution which describes particles ensemble which become distinguishable via different values of ω. Incident current density of particles ensemble on the horizons is evaluated which describe the ‘Hawking radiation’. The de Brogle-Bohm quantum potential effect is calculated also on the event (apparent) horizon which is independent (dependent) to values of ω.

  20. Dynamics of axial symmetric system in self-interacting Brans-Dicke gravity

    Energy Technology Data Exchange (ETDEWEB)

    Sharif, M. [University of the Punjab, Department of Mathematics, Lahore (Pakistan); Manzoor, Rubab [University of Management and Technology, Department of Mathematics, Lahore (Pakistan)

    2016-06-15

    This paper investigates the dynamics of an axial reflection symmetric model in self-interacting Brans-Dicke gravity for anisotropic fluid. We formulate hydrodynamical equations and discuss oscillations using a time-dependent perturbation for both spin-dependent and spin-independent cases. The expressions of the frequency, the total energy density, and the equation of motion of the oscillating model are obtained. We study the instability of the oscillating models in weak approximations. It is found that the oscillations and stability of the model depend upon the dark energy source along with anisotropy and reflection effects. We conclude that the axial reflection system remains stable for stiffness parameter Γ = 1, collapses for Γ > 1, and becomes unstable for 0 < Γ < 1. (orig.)

  1. Long-lived mesoscopic entanglement outside the Lamb-Dicke regime

    CERN Document Server

    McDonnell, M J; Lucas, D M; Imreh, G; Keitch, B C; Szwer, D J; Thomas, N R; Webster, S C; Stacey, D N; Steane, A M

    2006-01-01

    We create entangled states of the spin and motion of a single $^{40}$Ca$^+$ ion in a linear ion trap. The motional part consists of coherent states of large separation and long coherence time. The states are created by driving the motion using a laser standing wave. We theoretically study and experimentally observe the behaviour outside the Lamb-Dicke regime, where the trajectory in phase space is modified and the coherent states become squeezed. We directly observe the modification of the return time of the trajectory, and infer the squeezing. The mesoscopic entanglement is observed up to $\\Delta \\alpha = 5.1$ with coherence time $170 \\mu$s and mean phonon excitation $\

  2. Two-photon spectroscopy of trapped HD$^+$ ions in the Lamb-Dicke regime

    CERN Document Server

    Tran, Vu Quang; Douillet, Albane; Koelemeij, Jeroen C J; Hilico, Laurent

    2013-01-01

    We study the feasibility of nearly-degenerate two-photon rovibrational spectroscopy in ensembles of trapped, sympathetically cooled hydrogen molecular ions using a resonance-enhanced multiphoton dissociation (REMPD) scheme. Taking advantage of quasi-coincidences in the rovibrational spectrum, the excitation lasers are tuned close to an intermediate level to resonantly enhance two-photon absorption. Realistic simulations of the REMPD signal are obtained using a four-level model that takes into account saturation effects, ion trajectories, laser frequency noise and redistribution of population by blackbody radiation. We show that the use of counterpropagating laser beams enables optical excitation in an effective Lamb-Dicke regime. Sub-Doppler lines having widths in the 100 Hz range can be observed with good signal-to-noise ratio for an optimal choice of laser detunings. Our results indicate the feasibility of molecular spectroscopy at the $10^{-14}$ accuracy level for improved tests of molecular QED, a new det...

  3. Varying alpha and cosmic acceleration in Brans-Dicke-BSBM theory: stability analysis and observational tests

    CERN Document Server

    Farajollahi, H

    2012-01-01

    By integration of generalized BSBM and Brans-Dicke cosmological models, in this article, we investigate the theoretical framework of fine structure constant variation and current cosmic acceleration. We first develop a mathematical formalism to analyze the stability of the model. By employing observational data to constrain the model parameters, phase space description is performed and the attractor solutions of the model are detected. We then examine the model against observational data such as Hubble parameter dataset and quasar absorption spectra. The results confirms current universe acceleration and also predicts fine structure constant variation. Furthermore, extrapolation of the best fitted model in high redshift ($z> 15$) shows a significantly larger variation of fine structure constant in earlier epoch of the universe.

  4. Dark energy in five-dimensional Brans-Dicke cosmology with dimensional reduction

    Institute of Scientific and Technical Information of China (English)

    Ahmad Rami E1-Nabulsi

    2011-01-01

    We explore a 5D Brans-Dicke scalar cosmology by conjecturing that the four-dimensional Hubble parameter varies as H =εφs,ε ∈ R and s is some unknown power index and that the extra-dimensions compactify as the visible dimensions expand as b(t) ≈ ax(t),x ∈ R-.We mainly discuss the case x =-1.For critical values of ε close to unity,it was observed that the acceleration of the universe occurs at redshift close to z =0.8 which indicates that in our model,accelerated expansion of the universe began only recently.Several interesting points are revealed and discussed in some detail.

  5. Non-existence of Brans-Dicke theory in higher dimensional FRW universe

    Science.gov (United States)

    Çaǧlar, Halife; Aygün, Sezgin

    2016-06-01

    In this paper, we have studied exact solutions of Brans-Dicke (BD) theory for higher dimensional generalized Friedmann-Robertson-Walker (FRW) universe in the presence of strange quark matter (SQM) attached to the string cloud and domain walls. We have obtained that string tension density does not survive in this model. This result agrees with Kiran and Reddy, Krori et al., Sahoo and Mishra and Reddy. Also we have obtained constant scalar field in the presence of string cloud and domain walls. Then BD theory does not observe for higher dimensional FRW universe with SQM attached to the string cloud and domain walls. Our BD solutions turn into general relativity (GR). Finally, some physical properties are discussed.

  6. Axion-dilaton-modulus gravity theory of Brans-Dicke-type and conformal symmetry

    CERN Document Server

    Quirós, I

    2000-01-01

    Conformal symmetry is investigated within the context of axion-dilaton-modulus theory of gravity of Brans-Dicke-type. A distinction is made between general conformal symmetry and invariance under transformations of the physical units. The conformal degree of symmetry of the theory is studied when quantum fermion (lepton) modes with electromagnetic interaction are considered. Based on the requirement of invariance of the physical laws under general transformations of the units of measure, arguments are given that point at a matter action with non-minimal coupling of the dilaton to the matter fields as the most viable description of the world within the context of the model studied. The geometrical implications of the results obtained are discussed.

  7. Pryce-Hoyle Tensor in a Combined Einstein-Cartan-Brans-Dicke Model

    CERN Document Server

    Berman, Marcelo Samuel

    2008-01-01

    In addition to introducting matter injection through a scalar field determined by Pryce-Hoyle tensor, we also combine with a BCDE (Brans-Dicke and Einstein-Cartan) theory with lambda-term developed through Raychaudhuri's equation, for inflationary scenario. It involves a variable cosmological constant, which decreases with time, jointly with energy density, cosmic pressure, shear, vorticity, and Hubble's parameter, while the scale factor, total spin and scalar field increase exponentially. The post-inflationary fluid resembles a perfect one, though total spin grows, but the angular speed does not (Berman, 2007d). The Pryce-Hoyle tensor, which can measured by the number of injected particles per unit proper volume and time, can be neglected in the aftermath of inflation.

  8. Quantum logic gates with two-level trapped ions beyond Lamb-Dicke limit

    Institute of Scientific and Technical Information of China (English)

    Zheng Xiao-Juan; Luo Yi-Min; Cai Jian-Wu

    2009-01-01

    In the system with two two-level ions confined in a linear trap,this paper presents a simple scheme to realize the quantum phase gate(QPG)and the swap gate beyond the Lamb-Dicke(LD)limit.These two-qubit quantum logic gates only involve the internal states of two trapped ions.The scheme does not use the vibrational mode as the data bus and only requires a single resonant interaction of the ions with the lasers.Neither the LD approximation nor the auxiliary atomic level is needed in the proposed scheme.Thus the scheme is simple and the interaction time is very short,which is important in view of decoherence.The experimental feasibility for achieving this scheme is also discussed.

  9. Modified Holographic Ricci Dark Energy in Chameleon Brans-Dicke Cosmology and Its Thermodynamic Consequence

    Science.gov (United States)

    Jawad, A.; Chattopadhyay, S.; Bhattacharya, S.; Pasqua, A.

    2015-04-01

    The objective of this paper is to discuss the Chameleon Brans-Dicke gravity with non-minimally matter coupling of scalar field. We take modified Holographic Ricci dark energy model in this gravity with its energy density in interaction with energy density of cold dark matter. We assume power-law ansatz for scale factor and scalar field to discuss potential as well as coupling functions in the evolving universe. These reconstructed functions are plotted versus scalar field and time for different values of power component of scale factor n. We observe that potential and coupling functions represent increasing behavior, in particular, consistent results for a specific value of n. Finally, we have examined validity of the generalized second law of thermodynamics and we have observed its validity for all values of n. The financial Supported from Department of Science and Technology, Govt. of India under Project Grant No. SR/FTP/PS-167/2011 is thankfully acknowledged by SC

  10. Metric factorizability and equivalence of brane world models with Brans-Dicke theory

    CERN Document Server

    Chakraborty, Sumanta

    2015-01-01

    In the standard brane world models, the bulk metric ansatz is usually assumed to be factorizable in brane and bulk coordinates. However it is not self evident that it is always possible to factorize the bulk metric. Using gradient expansion scheme, which involves, expansion of bulk quantities in terms of the brane to bulk curvature ratio, as perturbative parameter, we have explicitly shown that upto second order in perturbative expansion, metric factorizability is a valid assumption. We have also argued from our result that the same should be true for all orders in the perturbation scheme. We further establish that the non-local terms present in the bulk gravitational field equation can be replaced by radion field and the effective action on the brane obtained thereof resembles Brans-Dicke theory of gravity.

  11. Modified Brans-Dicke cosmology with matter-scalar field interaction

    CERN Document Server

    Kofinas, Georgios; Saridakis, Emmanuel N

    2016-01-01

    We discuss the cosmological implications of an extended Brans-Dicke theory presented recently, in which there is an energy exchange between the scalar field and ordinary matter, determined by the theory. A new mass scale is generated in the theory which modifies the Friedmann equations with field-dependent corrected kinetic terms. In a radiation universe the general solutions are found and there are branches with complete removal of the initial singularity, while at the same time a transient accelerating period can occur within deceleration. Entropy production is also possible in the early universe. In the dust era, late-times acceleration has been found numerically in agreement with the correct behaviour of the density parameters and the dark energy equation of state, while the gravitational constant has only a slight variation over a large redshift interval in agreement with observational bounds.

  12. Many-Body Quantum Optics with Decaying Atomic Spin States: ($\\gamma$, $\\kappa$) Dicke model

    CERN Document Server

    Gelhausen, Jan; Strack, Philipp

    2016-01-01

    We provide a theory for quantum-optical realizations of the open Dicke model with internal, atomic spin states subject to uncorrelated, single-site spontaneous emission with rate $\\gamma$. This introduces a second decay channel for excitations to irreversibly dissipate into the environment, in addition to the photon loss with rate $\\kappa$. We compute the mean-field non-equilibrium steady states for spin and photon observables in the long-time limit, $t\\rightarrow \\infty$. Although $\\gamma$ does not conserve the total angular momentum of the spin array, we argue that our solution is exact in the thermodynamic limit, for the number of atoms $N\\rightarrow \\infty$. In light of recent and upcoming experiments realizing superradiant phase transitions using internal atomic states with pinned atoms in optical lattices, our work lays the foundation for the pursuit of a new class of open quantum magnets coupled to quantum light.

  13. Dynamics of Axial Symmetric System in Self-Interacting Brans-Dicke Gravity

    CERN Document Server

    Sharif, M

    2016-01-01

    This paper investigates dynamics of axial reflection symmetric model in self-interacting Brans-Dicke gravity for anisotropic fluid. We formulate hydrodynamical equations and discuss oscillations using time-dependent perturbation for both spin as well as spin-independent cases. The expressions of frequency, total energy density and equation of motion of oscillating model are obtained. We study instability of oscillating models in weak approximations. It is found that the oscillations and stability of the model depend upon the dark energy source along with anisotropy and reflection effects. We conclude that the axial reflection system remains stable for stiffness parameter $\\Gamma=1$, collapses for $\\Gamma>1$ and becomes unstable for $0<\\Gamma<1$.

  14. High-order corrections on the laser cooling limit in the Lamb-Dicke regime.

    Science.gov (United States)

    Yi, Zhen; Gu, Wen-Ju

    2017-01-23

    We investigate corrections on the cooling limit of high-order Lamb-Dicke (LD) parameters in the double electromagnetically induced transparency (EIT) cooling scheme. Via utilizing quantum interferences, the single-phonon heating mechanism vanishes and the system evolves to a double dark state, from which we will obtain the mechanical occupation on the single-phonon excitation state. In addition, the further correction induced by two-phonon heating transitions is included to achieve a more accurate cooling limit. There exist two pathways of two-phonon heating transitions: direct two-phonon excitation from the dark state and further excitation from the single-phonon excited state. By adding up these two parts of correction, the obtained analytical predictions show a well consistence with numerical results. Moreover, we find that the two pathways can destructively interfere with each other, leading to the elimination of two-phonon heating transitions and achieving a lower cooling limit.

  15. O absurdo em «Caieira», de Ricardo Guilherme Dicke

    Directory of Open Access Journals (Sweden)

    Hilda Gomes Dutra Magalhães

    2012-08-01

    Full Text Available Resumo: Nosso objetivo neste artigo consiste em analisar o espaço do absurdo no romance Caieira, do escritor matogrossense Ricardo Guilherme Dicke. Como suporte teóricometodológico, utilizamos as ideias sobre o absurdo de Camus. Durante a análise, percebemos que o espaço em que se desenvolvem as ações narradas em Caieira representa uma relação de dominação, em que os personagens são reduzidas a fantasmas ou objetos, presas num mundo de cal, árido de humanidade. Mesmo quando o personagem principal tenta reverter o quadro, acaba se transformando num reverso da mesma moeda, repetindo o modelo de dominação contra o qual se insurge, reeditando um ciclo de poder e dominação. Palavras-chave: Literatura brasileira; análise literária; absurdo; espaço.Abstract: Our aim in this paper is to analyze the space of the absurd at the novel Caieira, by Ricardo Guilherme Dicke, writer from Mato Grosso. As a theoretical-methodological support, we use the ideas of on the absurd presented by Camus. During the analysis, we find that the space in which the actions narrated in Caieira develop represents a relationship of domination, in which the characters are reduced to objects or ghosts, trapped in a world of lime, arid of humanity. Even when the main character tries to reverse the situation, eventually becoming a reverse of the same coin, repeating the pattern of domination against which it protests, reissuing a cycle of power and domination. Keywords: Brazilian literature; literary analysis; absurd; space.

  16. W.E. Henry Symposium compendium: The importance of magnetism in physics and material science

    Energy Technology Data Exchange (ETDEWEB)

    Carwell, H.

    1997-09-19

    This compendium contains papers presented at the W. E. Henry Symposium, The Importance of Magnetism in Physics and Material Science. The one-day symposium was conducted to recognize the achievements of Dr. Warren Elliot Henry as educator, scientist, and inventor in a career spanning almost 70 years. Dr. Henry, who is 88 years old, attended the symposium. Nobel Laureate, Dr. Glenn Seaborg, a friend and colleague for over 40 years, attended the event and shared his personal reminiscences. Dr. Seaborg is Associate Director-At-Large at the Lawrence Berkeley National Laboratory. The Compendium begins with three papers which demonstrate the ongoing importance of magnetism in physics and material science. Other contributions cover the highlights of Dr. Henry`s career as a researcher, educator, and inventor. Colleagues and former students share insights on the impact of Dr. Henry`s research in the field of magnetism, low temperature physics, and solid state physics; his influence on students as an educator; and his character, intellect and ingenuity, and passion for learning and teaching. They share a glimpse of the environment and times that molded him as a man, and the circumstances under which he made his great achievements despite the many challenges he faced.

  17. [Henri Moissn, first French Nobel prize winner in chemistry: the man, the picture collector].

    Science.gov (United States)

    Viel, C

    1999-03-01

    Born in Paris in September 1852, Henri Moisson died in February 1907, two months after receiving the Nobel prize for chemistry. After a short schooling at Meaux college, he was destined to be a clock maker. He owes his vocation for chemistry to Jules Plicque, a chemist and friend at the college. Henri Moisson attended Fremy's school of chemistry at the Paris Natural History Museum and undertook pharmaceutical studies. In this presentation, we take a look at Henri Moissan's child-hood and teenage years, his scientific education and offer a glimpse of the man and the picture collector.

  18. Transactions en eaux troubles : résurgences de la voix shakespearienne dans Moby-Dick Defamiliarising the Bard: The Resurgence of Shakespeare in Moby-Dick

    Directory of Open Access Journals (Sweden)

    Ronan Ludot-Vlasak

    2009-06-01

    Full Text Available This article explores the way Herman Melville appropriates William Shakespeare’s work in Moby-Dick. Its argument is that by defamiliarising some of Shakespeare’s lines—a corpus that was both alien and familiar to nineteenth-century writers— Melville turns them into his own idiom. This resurgence of the Shakespearean voice is double: although the dramatic element in the novel is often associated with the figure of Ahab, Ishmael also incorporates Shakespearean lines into his narrative. What characterises these (intertextual transactions is that instead of quoting directly from Shakespeare’s plays, Melville often blurs references in order to appropriate the works of his predecessor. More than the mere imitation of a model, this complex process reveals Shakespeare’s seminal role in Moby-Dick as well as Melville’s poetics of reinvention. Ultimately, it enables the author to explore the dark forces lying beneath the surface of things.

  19. Metallic nickel nano- and fine particles induce JB6 cell apoptosis through a caspase-8/AIF mediated cytochrome c-independent pathway

    Directory of Open Access Journals (Sweden)

    Castranova Vincent

    2009-04-01

    Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death

  20. "Helden in Zeiten eines Völkermords? Armin T. Wegner, Ernst Jäckh, Henry Morgenthau"

    OpenAIRE

    Anderson, ML

    2013-01-01

    This article questions the heroic status commonly ascribed by historians and human rights groups to Armin T. Wegner and Henry Morgenthau (senior), and ascribed by Ernst Jäckh's many writings to himself.

  1. Hiina kompartei pole NLKP-ga võrreldav / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    20.-26. novembril Hiinas Pekingis ja sadamalinnas Tianjinis peetud Euroopa ja Aasia noorte kohtumisest, kus Eestit esindasid Keskerakonna noortekogu esimees Henri Kaselo ja Euroopa Noorte Sotsiaaldemokraatide aseesimees ning Toomas Hendrik Ilvese nõunik Rander Läntsi

  2. Hiina kompartei pole NLKP-ga võrreldav / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    20.-26. novembril Hiinas Pekingis ja sadamalinnas Tianjinis peetud Euroopa ja Aasia noorte kohtumisest, kus Eestit esindasid Keskerakonna noortekogu esimees Henri Kaselo ja Euroopa Noorte Sotsiaaldemokraatide aseesimees ning Toomas Hendrik Ilvese nõunik Rander Läntsi

  3. On Reading, Writing, and Computers: A Conversation with John Martin Henry.

    Science.gov (United States)

    Brandt, Ron, Ed.

    1981-01-01

    With a simplified alphabet and interactive computer programing, John Henry Martin has developed a system by which children can learn to read and write far better than usual. In this interview, he explains his approach. (Author/MLF)

  4. The personality of Henry Cavendish a great scientist with extraordinary peculiarities

    CERN Document Server

    McCormmach, Russell

    2014-01-01

    This book explores the 18th century natural philosopher Henry Cavendish, best known for his work in chemistry and physics. It traces aspects of his personality, views and interpretations of him, and explores notions of eccentricity and autism.

  5. Strelku vsjo ravno perevedut. No v kakuju storonu? / Henry Posner ; interv. Eteri Kekelidze

    Index Scriptorium Estoniae

    Posner, Henry

    2006-01-01

    Eesti Raudtee üks erastajaist, RDC juht Henry Posner III meenutab ER erastamist 2001. a., investeeringutest, reeglite muutmisest, Eesti Raudtee müümise põhjustest, Eesti transiidi tulevikust. Diagramm: Eesti Raudtee kasum 1998-2004

  6. 2008 USGS Lidar: Twelve County, Illinois (Grundy, Kane, McHenry only)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This LiDAR data is within Illinois Department of Transportation districts 1 and 3 covering Grundy, Kane and McHenry counties. The data is updated from its original...

  7. A CRITIC APPROACH OF HENRY JAMES SEEN BY NORTHROP FRYE AND DAVID LODGE

    Directory of Open Access Journals (Sweden)

    Paula-Andreea ONOFREI

    2011-05-01

    Full Text Available The present paper represents our attempt to decipher the literary ideas that Henry James, Northrop Frye and David Lodge brought in criticism, therefore our main focus is on The Art of Fiction and The Art of the Novel, both belonging to Henry James, The Anatomy of Criticism -by Northrop Frye and The Art of Fiction of David Lodge. Particular attention is going to be given to Henry James and the concepts that he introduced in narratology, we will refer to the distinct features of Modernism, the literary current which has H. James as its representative and to the way Frye and Lodge regard „The Master’s” work from a critic point of view. The purpose is to familiarize the readers with the American author Henry James and to understand the complexity of his work.

  8. NOAA Ship Henry B. Bigelow Underway Meteorological Data, Near Real Time

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Henry B. Bigelow Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System...

  9. Strelku vsjo ravno perevedut. No v kakuju storonu? / Henry Posner ; interv. Eteri Kekelidze

    Index Scriptorium Estoniae

    Posner, Henry

    2006-01-01

    Eesti Raudtee üks erastajaist, RDC juht Henry Posner III meenutab ER erastamist 2001. a., investeeringutest, reeglite muutmisest, Eesti Raudtee müümise põhjustest, Eesti transiidi tulevikust. Diagramm: Eesti Raudtee kasum 1998-2004

  10. Thermodynamics of topological black holes in Brans-Dicke gravity with a power-law Maxwell field

    CERN Document Server

    Zangeneh, M Kord; Sheykhi, A

    2015-01-01

    In this paper, we present a new class of higher dimensional exact topological black hole solutions of the Brans-Dicke theory in the presence of a power-law Maxwell field as the matter source. For this aim, we introduce a conformal transformation which transforms the Einstein-dilaton-power-law Maxwell gravity Lagrangian to the Brans-Dicke-power-law Maxwell theory one. Then, by using this conformal transformation, we obtain the desired solutions. Next, we study the properties of the solutions and conditions under which we have black holes. Interestingly enough, we show that there is a cosmological horizon in the presence of a negative cosmological constant. Finally, we calculate the temperature and charge and then by calculating the Euclidean action, we obtain the mass, the entropy and the electromagnetic potential energy. We find that the entropy does not respect the area law, and also the conserved and thermodynamic quantities are invariant under conformal transformation. Using these thermodynamic and conserv...

  11. Study of Antigravity in an F(R Model and in Brans-Dicke Theory with Cosmological Constant

    Directory of Open Access Journals (Sweden)

    V. K. Oikonomou

    2014-01-01

    Full Text Available We study antigravity, that is, having an effective gravitational constant with a negative sign, in scalar-tensor theories originating from F(R theory and in a Brans-Dicke model with cosmological constant. For the F(R theory case, we obtain the antigravity scalar-tensor theory in the Jordan frame by using a variant of the Lagrange multipliers method and we numerically study the time dependent effective gravitational constant. As we will demonstrate by using a specific F(R model, although there is no antigravity in the initial model, it might occur or not in the scalar-tensor counterpart, mainly depending on the parameter that characterizes antigravity. Similar results hold true in the Brans-Dicke model.

  12. Study of Antigravity in an F(R) Model and in Brans-Dicke Theory with Cosmological Constant

    CERN Document Server

    Oikonomou, V K

    2014-01-01

    We study antigravity, that is having an effective gravitational constant with a negative sign, in scalar-tensor theories originating from $F(R)$-theory and in a Brans-Dicke model with cosmological constant. For the $F(R)$ theory case, we obtain the antigravity scalar-tensor theory in the Jordan frame by using a variant of the Lagrange multipliers method and we numerically study the time dependent effective gravitational constant. As we shall demonstrate by using a specific $F(R)$ model, although there is no antigravity in the initial model, it might occur or not in the scalar-tensor counterpart, mainly depending on the parameter that characterizes antigravity. Similar results hold true in the Brans-Dicke model.

  13. Exact solution for the inhomogeneous Dicke model in the canonical ensemble: Thermodynamical limit and finite-size corrections

    Energy Technology Data Exchange (ETDEWEB)

    Pogosov, W.V., E-mail: walter.pogosov@gmail.com [N.L. Dukhov All-Russia Research Institute of Automatics, Moscow (Russian Federation); Institute for Theoretical and Applied Electrodynamics, Russian Academy of Sciences, Moscow (Russian Federation); Moscow Institute of Physics and Technology, Dolgoprudny (Russian Federation); Shapiro, D.S. [N.L. Dukhov All-Russia Research Institute of Automatics, Moscow (Russian Federation); Moscow Institute of Physics and Technology, Dolgoprudny (Russian Federation); V.A. Kotel' nikov Institute of Radio Engineering and Electronics, Russian Academy of Sciences, Moscow (Russian Federation); National University of Science and Technology MISIS, Moscow (Russian Federation); Bork, L.V. [N.L. Dukhov All-Russia Research Institute of Automatics, Moscow (Russian Federation); Institute for Theoretical and Experimental Physics, Moscow (Russian Federation); Onishchenko, A.I. [Bogoliubov Laboratory of Theoretical Physics, Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow Institute of Physics and Technology, Dolgoprudny (Russian Federation); Skobeltsyn Institute of Nuclear Physics, Moscow State University, Moscow (Russian Federation)

    2017-06-15

    We consider an exactly solvable inhomogeneous Dicke model which describes an interaction between a disordered ensemble of two-level systems with single mode boson field. The existing method for evaluation of Richardson–Gaudin equations in the thermodynamical limit is extended to the case of Bethe equations in Dicke model. Using this extension, we present expressions both for the ground state and lowest excited states energies as well as leading-order finite-size corrections to these quantities for an arbitrary distribution of individual spin energies. We then evaluate these quantities for an equally-spaced distribution (constant density of states). In particular, we study evolution of the spectral gap and other related quantities. We also reveal regions on the phase diagram, where finite-size corrections are of particular importance.

  14. Exact solution for the inhomogeneous Dicke model in the canonical ensemble: Thermodynamical limit and finite-size corrections

    Directory of Open Access Journals (Sweden)

    W.V. Pogosov

    2017-06-01

    Full Text Available We consider an exactly solvable inhomogeneous Dicke model which describes an interaction between a disordered ensemble of two-level systems with single mode boson field. The existing method for evaluation of Richardson–Gaudin equations in the thermodynamical limit is extended to the case of Bethe equations in Dicke model. Using this extension, we present expressions both for the ground state and lowest excited states energies as well as leading-order finite-size corrections to these quantities for an arbitrary distribution of individual spin energies. We then evaluate these quantities for an equally-spaced distribution (constant density of states. In particular, we study evolution of the spectral gap and other related quantities. We also reveal regions on the phase diagram, where finite-size corrections are of particular importance.

  15. Anisotropic string cosmological model in Brans–Dicke theory of gravitation with time-dependent deceleration parameter

    Energy Technology Data Exchange (ETDEWEB)

    Maurya, D. Ch., E-mail: dcmaurya563@gmail.com; Zia, R., E-mail: rashidzya@gmail.com; Pradhan, A., E-mail: pradhan.anirudh@gmail.com [GLA University, Department of Mathematics, Institute of Applied Sciences and Humanities (India)

    2016-10-15

    We discuss a spatially homogeneous and anisotropic string cosmological models in the Brans–Dicke theory of gravitation. For a spatially homogeneous metric, it is assumed that the expansion scalar θ is proportional to the shear scalar σ. This condition leads to A = kB{sup m}, where k and m are constants. With these assumptions and also assuming a variable scale factor a = a(t), we find solutions of the Brans–Dicke field equations. Various phenomena like the Big Bang, expanding universe, and shift from anisotropy to isotropy are observed in the model. It can also be seen that in early stage of the evolution of the universe, strings dominate over particles, whereas the universe is dominated by massive strings at the late time. Some physical and geometrical behaviors of the models are also discussed and observed to be in good agreement with the recent observations of SNe la supernovae.

  16. Evaluation of the frequency instability limited by Dick effect in the microwave 199Hg+ trapped-ion clock

    Science.gov (United States)

    Chen, Yi-He; She, Lei; Wang, Man; Yang, Zhi-Hui; Liu, Hao; Li, Jiao-Mei

    2016-12-01

    In the microwave 199Hg+ trapped-ion clock, the frequency instability degradation caused by the Dick effect is unavoidable because of the periodical interrogating field. In this paper, the general expression of the sensitivity function g(t) to the frequency fluctuation of the interrogating field with Nπ-pulse (N is odd) is derived. According to the measured phase noise of the 40.5-GHz microwave synthesizer, the Dick-effect limited Allan deviation of our 199Hg+ trapped-ion clock is worked out. The results indicate that the limited Allan deviations are about and respectively in the linear ion trap and in the two-segment extended linear ion trap under our present experimental parameters. Project supported by the National Natural Science Foundation of China (Grant Nos. 11074248 and 11474320).

  17. Restauration de la statue de Henri IV

    Directory of Open Access Journals (Sweden)

    Stéphanie Celle

    2012-04-01

    Full Text Available Cette intervention de conservation du bronze de la statue de Henri IV était la première depuis sa création en 1818 : on héritait de la surface originale de l’œuvre altérée par les vicissitudes du temps et les événements historiques traversés. Le protocole de conservation se voulait respectueux de cette authenticité de la patine et a cherché à en laisser les marques tout en apportant une réponse pour contrer la corrosion active de l’alliage. C’est en conformité aux principes de conservation établis par Cesare Brandi, qu’ont été définis le nettoyage sélectif des surfaces et l’application de couches protectives sur le bronze. Par ailleurs, le moment du chantier est un moment privilégié pour observer un monument et mieux connaître son histoire particulière. Ce chantier nous a permis de redécouvrir deux ensembles de boîtes déposées dans l’antre du cheval dans des situations parfois surprenantes.This conservation treatment for the bronze statue of Henri IV is the first since its creation in 1818. While the original surface of the work remains, it has been altered by natural and human forces; including the weathering of the material from exposure to the elements and damage caused by historic events. The conservation protocol is respectful of this authenticity of the surface patina and the marks of damage due to historical events, while developing a treatment plan to counter the active corrosion of the alloy. In keeping with the principles of conservation established by Cesare Brandi, the treatment program defines the selective cleaning of the surface and the application of several layers of a protective coating on the bronze. In addition, the conservation project is an opportunity to carefully study a monument to better understand its unique history. This project allowed us to rediscover two sets of boxes placed inside the cavity of the horse; an unxpected discovery.

  18. JB 4730标准中无损检测仪器设备校准或核查要求的修改建议%The Modification Suggestions for the Requirements of Calibration or Check of Non-Destructive Testing Instruments in JB 4730 Standard

    Institute of Scientific and Technical Information of China (English)

    谢常欢

    2012-01-01

    This article compares the requirements of calibration or check for nondestructive testing instruments with EN-04/15,HOKLAS Supplementary etc.,and gives the modification suggestions for the requirements of calibration or check of non-destructive testing instruments for new JB 4730 standard.%借鉴欧盟EN-04/15、香港HOKLAS增补准则第15等标准中对无损检测仪器设备校准或核查的要求,对今后新版JB 4730标准中有关无损检测仪器设备校准或核查的要求提出了修改建议。

  19. 46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

  20. Preparation of Schr\\"odinger cat states with cold ions in a cavity beyond the Lamb-Dicke limit

    CERN Document Server

    Freitas, Dagoberto S

    2010-01-01

    We investigate the dynamics of a cold trapped ion coupled to the quantized field inside a high-finesse cavity. We have used an approach for preparing the SC states of motion of ion. This approach, based on unitary transformating the Hamiltonian, allows its exact diagonalization without performing the Lamb-Dicke aproximation. We show that is possible to generate a SC states having rather simple initial state preparation, e.g., the vacuum sate for both cavity field and the ion motion.

  1. Hierarchy problem and the cosmological constant in a five-dimensional Brans-Dicke brane world model

    CERN Document Server

    Smolyakov, Mikhail N

    2010-01-01

    We discuss a new solution, admitting the existence of dS_{4} branes, in five-dimensional Brans-Dicke theory. It is shown that, due to a special form of a bulk scalar field potential, for certain values of the model parameters the effective cosmological constant can be made small on the brane, where the hierarchy problem of gravitational interaction is solved. We also discuss new stabilization mechanism which is based on the use of auxiliary fields.

  2. The relationship of Nature and Man in Turner’s sea-scenes and Melville’s Moby-Dick

    Directory of Open Access Journals (Sweden)

    Réka Takacs Toth

    2010-07-01

    Full Text Available L´objectif de cette analyse est de révéler les parallèles entre les paysages maritimes du peintre anglais Joseph Mallord William Turner et le roman de Herman Melville intitulé Moby-Dick. L´analyse se concentre sur la représentation de la relation entre l´Homme et la Nature chez les deux artistes ; une relation qui est devenue assez problématique à la suite de l´industrialisation rapide du XIXe siècle. Bien que Melville connût à peine les oeuvres de Turner lorsqu´il écrivait Moby-Dick, la représentation de la relation de l´homme face à la nature chez l´écrivain américain est très semblable à celle présente dans les oeuvres du peintre anglais.The study aims to analyze parallels between the sea-scenes of the English painter, Joseph Mallord William Turner and the American writer, Herman Melville’s Moby-Dick with an eye on how the two artists conceived the relationship of Man and Nature which became quite problematic as the result of a rapid industrialization that characterized the nineteenth century. Although Melville was only vaguely familiar with Turner’s art at the time when he wrote Moby-Dick, the American writer represented man in relation to nature in quite the same way as the English painter did a few years before him.

  3. A Derivation of the Dick Effect from Control-Loop Models for Periodically Interrogated Passive Frequency Standards

    Science.gov (United States)

    Greenhall, Charles A.

    1996-01-01

    The phase of a frequency standard that uses periodic interrogation and control of a local oscillator (LO) is degraded by a long-term random-walk component induced by downconversion of LO noise into the loop passband. The Dick formula for the noise level of this degradation can be derived from explicit solotions of two LO control-loop models. A summary of the derivations is given here.

  4. Resonances of the confined hydrogen atom and the Lamb-Dicke effect in non-relativistic qed

    DEFF Research Database (Denmark)

    Faupin, Jeremy

    2008-01-01

    We study a model describing a system of one dynamical nucleus and one electron confined by their center of mass and interacting with the quantized electromagnetic field. We impose an ultraviolet cutoff and assume that the fine-structure constant is sufficiently small. Using a renormalization grou...... method (based on [3, 4]), we prove that the unperturbed eigenvalues turn into resonances when the nucleus and the electron are coupled to the radiation field. This analysis is related to the Lamb–Dicke effect....

  5. Electrostatic Potential of a Point Charge in a Brans-Dicke Reissner-Nordstr\\"{o}m Field

    CERN Document Server

    Watanabe, Maya

    2013-01-01

    We consider the Brans-Dicke Reissner-Nordstr\\"{o}m spacetime in isotropic coordinates and the electrostatic field of an electric point charge placed outside its surface of inversion. We treat the static electric point charge as a linear perturbation on the Brans-Dicke Reissner-Nordstr\\"{o}m background. We develop a method based upon the Copson method to convert the governing Maxwell equation on the electrostatic potential generated by the static electric point charge into a solvable linear second order ordinary differential equation. We obtain a closed form fundamental solution of the curved space Laplace equation arising from the background metric, which is shown to be regular everywhere except at the point charge and its image point inside the surface of inversion. We also develop a method that demonstrates that the solution does not contain any other charge that may creep into the region that lies beyond the surface of inversion and which is not covered by the isotropic coordinates. The Brans-Dicke Reissne...

  6. New holographic reconstruction of scalar-field dark-energy models in the framework of chameleon Brans-Dicke cosmology

    Energy Technology Data Exchange (ETDEWEB)

    Chattopadhyay, Surajit [Pailan College of Management and Technology, Kolkata (India); Pasqua, Antonio [University of Trieste, Department of Physics, Trieste (Italy); Khurshudyan, Martiros [Yerevan State University, Department of Theoretical Physics, Yerevan (Armenia); Potsdam-Golm Science Park, Max Planck Institute of Colloids and Interfaces, Potsdam (Germany)

    2014-09-15

    Motivated by the work of Yang et al. (Mod. Phys. Lett. A 26:191, 2011), we report on a study of the new holographic dark energy (NHDE) model with energy density given by ρ{sub D} = (3φ{sup 2})/(4ω)(μH{sup 2} + νH) in the framework of chameleon Brans-Dicke cosmology. We have studied the correspondence between the quintessence, the DBI-essence, and the tachyon scalar-field models with the NHDE model in the framework of chameleon Brans-Dicke cosmology. Deriving an expression of the Hubble parameter H and, accordingly, ρ{sub D} in the context of chameleon Brans-Dicke chameleon cosmology, we have reconstructed the potentials and dynamics for these scalar-field models. Furthermore, we have examined the stability for the obtained solutions of the crossing of the phantom divide under a quantum correction of massless conformally invariant fields, and we have seen that the quantum correction could be small when the phantom crossing occurs and the obtained solutions of the phantom crossing could be stable under the quantum correction. It has also been noted that the potential increases as the matter. chameleon coupling gets stronger with the evolution of the universe. (orig.)

  7. Effects of surfactants and salt on Henry's constant of n-hexane.

    Science.gov (United States)

    Yang, Chunping; Chen, Fayuan; Luo, Shenglian; Xie, Gengxin; Zeng, Guangming; Fan, Changzheng

    2010-03-15

    n-Hexane biological removal is intrinsically limited by its hydrophobic nature and low bioavailability. The addition of surfactants could enhance the transport of volatile organic compounds (VOCs) and change the gas-liquid equilibrium of VOCs. In this paper, the effects of four surfactants, sodium dodecyl sulfate (SDS), cetyltrimethylammonium bromide (CTAB), tert-octylphenoxypoly-ethoxyethanol (Triton X-100), polyoxyethylene (20) sorbitan monooleate (Tween 80), and sodium nitrate on apparent Henry's constant of n-hexane in surfactant solutions were investigated. The apparent Henry's constants were significantly reduced when surfactants concentrations exceeded their critical micelle concentrations (cmc's). On a cmc basis, the anionic surfactant SDS was found to have the greatest effect on the apparent Henry's constant with CTAB succeeding, then followed by Triton X-100 and Tween 80. However, the apparent Henry's constant of n-hexane decreased even more rapidly when Triton X-100, a nonionic surfactant, was added than when the ionic surfactant of SDS or CTAB was applied under identical mass concentration and other conditions. These results suggest that Triton X-100 have the biggest solubilization of n-hexane among the four surfactants. Sodium nitrate slightly decreased the apparent Henry's constant of n-hexane in surfactant solutions, and could be considered as a cosolvent in the surfactant-(n-hexane) solution. In addition, the relationship between apparent Henry's constant and surfactant concentration was further developed.

  8. Genetic Analysis of the Henry Mountains Bison Herd.

    Directory of Open Access Journals (Sweden)

    Dustin H Ranglack

    Full Text Available Wild American plains bison (Bison bison populations virtually disappeared in the late 1800s, with some remnant animals retained in what would become Yellowstone National Park and on private ranches. Some of these private bison were intentionally crossbred with cattle for commercial purposes. This forced hybridization resulted in both mitochondrial and nuclear introgression of cattle genes into some of the extant bison genome. As the private populations grew, excess animals, along with their history of cattle genetics, provided founders for newly established public bison populations. Of the US public bison herds, only those in Yellowstone and Wind Cave National Parks (YNP and WCNP appear to be free of detectable levels of cattle introgression. However, a small free-ranging population (~350 animals exists on public land, along with domestic cattle, in the Henry Mountains (HM of southern Utah. This isolated bison herd originated from a founder group translocated from YNP in the 1940s. Using genetic samples from 129 individuals, we examined the genetic status of the HM population and found no evidence of mitochondrial or nuclear introgression of cattle genes. This new information confirms it is highly unlikely for free-living bison to crossbreed with cattle, and this disease-free HM bison herd is valuable for the long-term conservation of the species. This bison herd is a subpopulation of the YNP/WCNP/HM metapopulation, within which it can contribute significantly to national efforts to restore the American plains bison to more of its native range.

  9. James Henry Marriott: New Zealand's first professional telescope-maker

    Science.gov (United States)

    Orchiston, Wayne; Romick, Carl; Brown, Pendreigh.

    2015-11-01

    James Henry Marriott was born in London in 1799 and trained as an optician and scientific instrument- maker. In 1842 he emigrated to New Zealand and in January 1843 settled in the newly-established town of Wellington. He was New Zealand's first professional telescope-maker, but we have only been able to locate one telescope made by him while in New Zealand, a brass 1-draw marine telescope with a 44-mm objective, which was manufactured in 1844. In 2004 this marine telescope was purchased in Hawaii by the second author of this paper. In this paper we provide biographical information about Marriott, describe his 1844 marine telescope and speculate on its provenance. We conclude that although he may have been New Zealand's first professional telescope-maker Marriot actually made very few telescopes or other scientific instruments. As such, rather than being recognised as a pioneer of telescope-making in New Zealand he should be remembered as the founder of New Zealand theatre.

  10. A citation analysis of Henri Tajfel's work on intergroup relations.

    Science.gov (United States)

    Dumont, Kitty; Louw, Johann

    2009-02-01

    The late Henri Tajfel (1919-1982) is one of the central figures who shaped the development of post-war European social psychology. His contributions range from the establishment of an infrastructure for a European social psychology, and the start of a new intellectual movement within social psychology, to the formulation of a set of concepts addressing intergroup relations that were finally integrated into Social Identity Theory. The present study provides an empirical examination of Tajfel's contribution to intergroup research over the last 30 years via a citation analysis of five journals: the Journal of Personality and Social Psychology, the British Journal of Social Psychology, the European Journal of Social Psychology, the South African Journal of Psychology, and the German Journal of Social Psychology (Zeitschrift für Sozialpsychologie). The results indicate that Tajfel's work on intergroup relations is increasingly cited, especially since the 1990s, and the international recognition of his work is substantial. Three possible reasons for the recognition his work still enjoys are proposed: its potential to generate theoretical and empirical controversies; its explanatory power; and the extent to which his work is used as a referential framework.

  11. Percevoir Dieu ? Henri Bergson et William P. Alston

    Directory of Open Access Journals (Sweden)

    Anthony Feneuil

    2012-07-01

    Full Text Available William Alston (1921-2009 et Henri Bergson (1859-1941 semblent défendre une même thèse : celle de la valeur de l’expérience mystique pour la connaissance (valeur épistémique. L’étude comparée de la manière dont chacun d’entre eux la formule et la défend constitue un bon angle pour envisager la différence entre tradition « analytique » et tradition « continentale » en philosophie de la religion. Cet article vise à montrer les divergences et les convergences entre les deux auteurs, mais surtout à situer le point d’origine des divergences. Il apparaît que celui-ci n’est pas à chercher dans deux conceptions irréductibles de la philosophie ou de la rationalité, dans une différence de compréhension de la mystique.

  12. Henry Laurens: “Me dedico a predecir el pasado”

    Directory of Open Access Journals (Sweden)

    Jimena Larroque Aranguren

    2016-05-01

    Full Text Available Henry Laurens (1954, es catedrático de historia y titulado en árabe literario en el Instituto Nacional de Lenguas y Civilización Oriental (INALCO y profesor en el Collège de France desde 2004 en la Cátedra “Historia Contemporánea del mundo árabe”. Su último libro publicado es el quinto tomo de La Question de Palestine 1982-2001. La paix impossible (Fayard, 2015. Hace un mes participó en una mesa redonda en el Instituto Francés de Madrid para hablar sobre “Los últimos acontecimientos en Oriente Medio y sus consecuencias en Europa” (16 de marzo. Esta entrevista con el historidador francés y especialista del mundo arabe-musulmán, versa sobre el papel del historiador como “profeta del pasado”, sobre la maraña de términos que se emplean para designar la realidad, y sobre los lindes y puentes entre ciencia y política.

  13. Analyzing the Figure of Henry of A Farewell to Arms

    Institute of Scientific and Technical Information of China (English)

    汤宁; 朱卫敏

    2008-01-01

    A Farewell to Arms is a representative work of Ernest Hemingway.Henry.The hero of the novel is a "shadow" of the author.He joins the army with good wills but finally he finds himself cheated by the capitalist class.When he gets a clear understanding of the true features of the war,he begins to fight against it.But he can' t resist the war and the society.He loses the aim of life and is at a loss.He is a representative figure of" the lost generation".Ernest Hemingway combines austere realism and poetic language to present a powerful argument against war and to tell a touching love story at the same time.Possessed of the most remarkable time sense of the period between wars,his disillusioned temperament and technical skill have influenced a whole generation of writers.In spite of its hard-boiled realism of detail and its tragic ending,A Farewell to Arms is nevertheless an idealistic book.The novel was dramatized by Laurence Stallings and was made into a motion picture.

  14. The enigmatic figure of Dr Henry Maudsley (1835-1918).

    Science.gov (United States)

    Pantelidou, Maria; Demetriades, Andreas K

    2014-08-01

    In spite of his contribution to psychiatry in 19th century Britain, Henry Maudsley remains a mysterious figure, a man mostly known for his donation to the London County Council for the building of the Maudsley Hospital and for The Maudsley Annual Lecture created in honour of his benevolence. Besides Sir Aubrey Lewis' article in 1951 and Michael Collie's attempt in 1988 to construct a biographical study on Maudsley, there does not seem to be any current endeavour to tell the story of his life, whereas Trevor Turner's contribution to the 2004 Oxford Dictionary of National Biography gives a somewhat scathing but unattributed account of Maudsley's personality. This essay attempts to explore his contributions to the Medico-Psychological Association (MPA), the current Royal College of Psychiatrists, his editorship of the Journal of Mental Health (currently named the British Journal of Psychiatry), his literary contributions and his vision for a psychiatric hospital. This essay is an attempt to demystify his figure and to explore some of the rumours and criticisms surrounding his name and the reasons why so little has been written about him. It is also a venture to unravel his complex personality and his intricate philosophy.

  15. A highly thermostable alkaline cellulase-free xylanase from thermoalkalophilic Bacillus sp. JB 99 suitable for paper and pulp industry: purification and characterization.

    Science.gov (United States)

    Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra

    2010-11-01

    A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.

  16. Exposure of JB-6 mouse epidermal cells to 12-O-tetradecanoyl-phorbol-13-acetate is not accompanied by a significant change in total DNA-cytosine methylation.

    Science.gov (United States)

    Bondy, G P; Denhardt, D T

    1983-12-01

    The extent of methylation of the cytosine bases in DNA is believed to be a major factor influencing gene expression in eukaryotic cells. We have asked whether the tumor promoter 12-O-tetradecanoylphorbol-13-acetate (TPA) alters the amount of 5-methylcytosine in DNA. The amount and relative distribution of 5-methylcytosine in the DNA of two subclones of the JB-6 mouse epidermal cell line were determined respectively by high performance liquid chromatography and digestion with the restriction enzymes MspI and HpaII. Exposure to TPA for up to several cell generations had no detectable effect on the degree of DNA methylation (3.9% of the total cytosine) in the two JB-6 lines or Friend erythroleukemia cells. Reduced methylation was readily detected in DNA extracted from cells exposed to 5-azacytidine. The data suggest that tumor promotion (at least that induced by TPA) is likely not the consequence of a generalized elevation or reduction in the amount of 5-methyl-cytosine in the DNA.

  17. Tumour cell recruitment of the JB-1 and L 1210 ascites tumour determined directly by double labelling with [14C]- and [3H]-thymidine.

    Science.gov (United States)

    Maurer-Schultze, B; Kondziella, U; Böswald, M

    1988-07-01

    Tumour cell recruitment of the JB-1 and L 1210 ascites tumour has been demonstrated directly by a double-labelling method with [14C]- and [3H]-thymidine (TdR). After [14C]-labelling of all proliferating tumour cells by multiple injections of [14C]TdR, recruitment of resting cells was stimulated by removal of the majority of tumour cells, i.e. by maximum aspiration of ascitic fluid. The number of recruited resting cells in the remaining tumour that re-enter the cell cycle after stimulation was demonstrated directly by a single injection of [3H]TdR given at different times after stimulation. The increase in the percentage of purely [3H]-labelled cells, i.e. recruited cells, with increasing time after stimulation, shows that recruitment is not a synchronous but a continuous process, the maximum of which occurs earlier in the case of the L 1210 than the JB-1 tumour. This suggests that there seems to be a relationship between the time required for maximum recruitment and the corresponding cell cycle parameters of the unperturbed tumour. There is a transitory increase of the growth fraction to about 100% and a considerable shortening of the cycle time at the maximum of recruitment.

  18. Sous l’empire de la folie : Moby-Dick, Shakespeare & compagnie

    Directory of Open Access Journals (Sweden)

    Michel Imbert

    2010-10-01

    Full Text Available This article aims at translating Moby-Dick back into Shakespeare’s ornate lingo, and back again into a Swiftian or Sternian brand of “jabberwocky,” in order to expose the sheer nonsense that underlies lame attempts at standing for the Body Politic called Leviathan, understanding it, or making sense of the whale as a whole.Melville emprunte à Shakespeare le motif de la volonté de puissance, du rêve d’empire sous l’emprise de la folie du pouvoir. Le drame d’Achab est de s’ériger en maître absolu face au Leviathan et de s’ignorer possédé par la folle du logis, l’hysterica passio qui habite Lear et qui lui souffle, dans tous les sens du terme, son rêve dément de domination. L’histoire cherche à se répéter sur le modèle des tragédies de Shakespeare mais finit par dégénérer en farce. Le délire de Pip achève de la faire sombrer dans le non-sens.

  19. Dilatonic Brans-Dicke Anisotropic Collapsing Fluid Sphere And de Broglie Quantum Wave Motion

    CERN Document Server

    Ghaffarnejad, Hossein

    2014-01-01

    Two dimensional analogue of vacuum sector of the Brans Dicke gravity is used to study dynamics of anisotropic spherical symmetric perfect fluid. We solve dynamical equations and obtain internal metric of the fluid describing a stellar collapse with equation of state as $\\rho(p)=2(p-p_0^3/p^3)$ for $\\omega>>1$. We determine time dependence oscillations of particles ensemble, apparent and event horizons location where the particles same as the event horizon are trapped by the apparent horizon and they are located on back of the apparent horizon. We determine radial accelerating velocity of the particles ensemble from the phase part of the corresponding de Broglie quantum wave of the fluid sphere. A good correspondence between our classical and de Broglie quantum wave solutions are obtained by overlapping diagram of the classical solutions of relative distance of the particles, apparent and event horizons with particles ensemble density where finally the particles together with the event horizon located back of ...

  20. 1/N-expansion for the Dicke model and the decoherence program

    CERN Document Server

    Frasca, M

    2004-01-01

    An analysis of the Dicke model, N two-level atoms interacting with a single radiation mode, is done using the Holstein-Primakoff transformation. The main aim of the paper is to show that, changing the quantization axis with respect to the common usage, it is possible to prove a general result either for N or the coupling constant going to infinity for the exact solution of the model. This completes the analysis, known in the current literature, with respect to the same model in the limit of N and volume going to infinity, keeping the density constant. For the latter the proper axis of quantization is given by the Hamiltonian of the two-level atoms and for the former the proper axis of quantization is defined by the interaction. The relevance of this result relies on the observation that a general measurement apparatus acts using electromagnetic interaction and so, one can states that the thermodynamic limit is enough to grant the appearance of classical effects. Indeed, recent experimental results give first ...

  1. Shear-free axial model in massive Brans-Dicke gravity

    Science.gov (United States)

    Sharif, M.; Manzoor, Rubab

    2017-01-01

    This paper explores the influences of dark energy on the shear-free axially symmetric evolution by considering self-interacting Brans-Dicke gravity as a dark energy candidate. We describe energy source of the model and derive all the effective dynamical variables as well as effective structure scalars. It is found that scalar field is one of the sources of anisotropy and dissipation. The resulting effective structure scalars help to study the dynamics associated with dark energy in any axial configuration. In order to investigate shear-free evolution, we formulate a set of governing equations along with heat transport equation. We discuss consequences of shear-free condition upon different SBD fluid models like dissipative non-geodesic and geodesic models. For dissipative non-geodesic case, the rotational distribution turns out to be the necessary and sufficient condition for radiating model. The dissipation depends upon inhomogeneous expansion. The geodesic model is found to be irrotational and non-radiating. The non-dissipative geodesic model leads to FRW model for positive values of the expansion parameter.

  2. Quantized Brans-Dicke theory: Phase transition, strong coupling limit, and general relativity

    Science.gov (United States)

    Pal, Sridip

    2016-10-01

    We show that Friedmann-Robertson-Walker geometry with a flat spatial section in quantized (Wheeler deWitt quantization) Brans-Dicke (BD) theory reveals a rich phase structure owing to anomalous breaking of a classical symmetry, which maps the scale factor a ↦λ a for some constant λ . In the weak coupling (ω ) limit, the theory goes from a symmetry preserving phase to a broken phase. The existence of a phase boundary is an obstruction to another classical symmetry [see V. Faraoni, Phys. Rev. D 59, 084021 (1999).] (which relates two BD theories with different couplings) admitted by BD theory with scale invariant matter content, i.e., Tμμ=0 . Classically, this prohibits the BD theory from reducing to general relativity (GR) for scale invariant matter content. We show that a strong coupling limit of both BD and GR preserves the symmetry involving the scale factor. We also show that with scale invariant matter content (radiation, i.e., P =1/3 ρ ), the quantized BD theory does reduce to GR as ω →∞ , which is in sharp contrast to classical behavior. This is a first known illustration of a scenario where quantized BD theory provides an example of anomalous symmetry breaking and resulting binary phase structure. We make a conjecture regarding the strong coupling limit of the BD theory in a generic scenario.

  3. Shear-free axial model in massive Brans–Dicke gravity

    Energy Technology Data Exchange (ETDEWEB)

    Sharif, M., E-mail: msharif.math@pu.edu.pk [Department of Mathematics, University of the Punjab, Quaid-e-Azam Campus, Lahore-54590 (Pakistan); Manzoor, Rubab, E-mail: rubab.manzoor@umt.edu.pk [Department of Mathematics, University of the Punjab, Quaid-e-Azam Campus, Lahore-54590 (Pakistan); Department of Mathematics, University of Management and Technology, Johar Town Campus, Lahore-54782 (Pakistan)

    2017-01-15

    This paper explores the influences of dark energy on the shear-free axially symmetric evolution by considering self-interacting Brans–Dicke gravity as a dark energy candidate. We describe energy source of the model and derive all the effective dynamical variables as well as effective structure scalars. It is found that scalar field is one of the sources of anisotropy and dissipation. The resulting effective structure scalars help to study the dynamics associated with dark energy in any axial configuration. In order to investigate shear-free evolution, we formulate a set of governing equations along with heat transport equation. We discuss consequences of shear-free condition upon different SBD fluid models like dissipative non-geodesic and geodesic models. For dissipative non-geodesic case, the rotational distribution turns out to be the necessary and sufficient condition for radiating model. The dissipation depends upon inhomogeneous expansion. The geodesic model is found to be irrotational and non-radiating. The non-dissipative geodesic model leads to FRW model for positive values of the expansion parameter.

  4. Non-singular Brans–Dicke collapse in deformed phase space

    Energy Technology Data Exchange (ETDEWEB)

    Rasouli, S.M.M., E-mail: mrasouli@ubi.pt [Departamento de Física, Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal); Centro de Matemática e Aplicações (CMA - UBI), Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal); Physics Group, Qazvin Branch, Islamic Azad University, Qazvin (Iran, Islamic Republic of); Ziaie, A.H., E-mail: ah_ziaie@sbu.ac.ir [Department of Physics, Shahid Beheshti University, G. C., Evin, 19839 Tehran (Iran, Islamic Republic of); Department of Physics, Shahid Bahonar University, PO Box 76175, Kerman (Iran, Islamic Republic of); Jalalzadeh, S., E-mail: shahram.jalalzadeh@unila.edu.br [Federal University of Latin-American Integration, Technological Park of Itaipu PO box 2123, Foz do Iguaçu-PR, 85867-670 (Brazil); Moniz, P.V., E-mail: pmoniz@ubi.pt [Departamento de Física, Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal); Centro de Matemática e Aplicações (CMA - UBI), Universidade da Beira Interior, Rua Marquês d’Avila e Bolama, 6200 Covilhã (Portugal)

    2016-12-15

    We study the collapse process of a homogeneous perfect fluid (in FLRW background) with a barotropic equation of state in Brans–Dicke (BD) theory in the presence of phase space deformation effects. Such a deformation is introduced as a particular type of non-commutativity between phase space coordinates. For the commutative case, it has been shown in the literature (Scheel, 1995), that the dust collapse in BD theory leads to the formation of a spacetime singularity which is covered by an event horizon. In comparison to general relativity (GR), the authors concluded that the final state of black holes in BD theory is identical to the GR case but differs from GR during the dynamical evolution of the collapse process. However, the presence of non-commutative effects influences the dynamics of the collapse scenario and consequently a non-singular evolution is developed in the sense that a bounce emerges at a minimum radius, after which an expanding phase begins. Such a behavior is observed for positive values of the BD coupling parameter. For large positive values of the BD coupling parameter, when non-commutative effects are present, the dynamics of collapse process differs from the GR case. Finally, we show that for negative values of the BD coupling parameter, the singularity is replaced by an oscillatory bounce occurring at a finite time, with the frequency of oscillation and amplitude being damped at late times.

  5. Quantum signature of chaos and thermalization in the kicked Dicke model

    Science.gov (United States)

    Ray, S.; Ghosh, A.; Sinha, S.

    2016-09-01

    We study the quantum dynamics of the kicked Dicke model (KDM) in terms of the Floquet operator, and we analyze the connection between chaos and thermalization in this context. The Hamiltonian map is constructed by suitably taking the classical limit of the Heisenberg equation of motion to study the corresponding phase-space dynamics, which shows a crossover from regular to chaotic motion by tuning the kicking strength. The fixed-point analysis and calculation of the Lyapunov exponent (LE) provide us with a complete picture of the onset of chaos in phase-space dynamics. We carry out a spectral analysis of the Floquet operator, which includes a calculation of the quasienergy spacing distribution and structural entropy to show the correspondence to the random matrix theory in the chaotic regime. Finally, we analyze the thermodynamics and statistical properties of the bosonic sector as well as the spin sector, and we discuss how such a periodically kicked system relaxes to a thermalized state in accordance with the laws of statistical mechanics.

  6. Non-singular Brans-Dicke collapse in deformed phase space

    CERN Document Server

    Rasouli, S M M; Jalalzadeh, S; Moniz, P V

    2016-01-01

    We study the collapse process of a homogeneous perfect fluid (in FLRW background) with a barotropic equation of state in Brans-Dicke (BD) theory in the presence of phase space deformation effects. Such a deformation is introduced as a particular type of non-commutativity between phase space coordinates. For the commutative case, it has been shown in the literature [M.A. Scheel, S.L. Shapiro and S.A. Teukolsky, Phys. Rev. D. 51, 4236 (1995)], that the dust collapse in BD theory leads to the formation of a spacetime singularity which is covered by an event horizon. In comparison to general relativity (GR), the authors concluded that the final state of black holes in BD theory is identical to the GR case but differs from GR during the dynamical evolution of the collapse process. However, the presence of non-commutative effects influences the dynamics of the collapse scenario and consequently a non-singular evolution is developed in the sense that a bounce emerges at a minimum radius, after which an expanding pha...

  7. Gravity-Driven Acceleration and Kinetic Inflation in Noncommutative Brans-Dicke Setting

    CERN Document Server

    Rasouli, S M M

    2016-01-01

    By assuming the spatially flat~FLRW line-element and employing the Hamiltonian formalism, a noncommutative (NC) setting of the Brans-Dicke (BD) theory is introduced. We investigate gravity-driven acceleration and kinetic inflation in this NC BD cosmology. Despite to the commutative case, in which both the scale factor and BD scalar field are obtained in power-law forms (in terms of the cosmic time), in our herein NC model, we see that the power-law scalar factor is multiplied by a dynamical exponential warp factor. This warp factor depends on not only the NC parameter but also the momentum conjugate associated to the BD scalar field. For very small values of this parameter, we obtain an appropriate inflationary solution, which can overcome the problems within the standard BD cosmology in a more efficient manner. Moreover, we see that a graceful exit from an early acceleration epoch towards a decelerating radiation epoch is provided. For late times, due to the presence of the NC parameter, we obtain a zero acc...

  8. D-class of dark energy against $\\Lambda$CDM in Brans-Dicke cosmology

    CERN Document Server

    Khodam-Mohammadi, A

    2016-01-01

    Three general models of dynamical interacting dark energy (D-class) are investigated in the context of Brans-Dicke cosmology. All cosmological quantities such as equation of state parameters, deceleration parameters, Hubble function, and the density ratio are calculated as a function of redshift parameter. The most important part of this paper is fitting of models to the observational data (SNIa+BAO$_A$+$Omh^{2}$). We obtain a table of best fit value of parameters and report $\\chi_{tot}^2/dof$ and Akaike Information Criterion (AIC) for each model. By these diagnostic tools, we find that some models have no chance against $\\Lambda$CDM and some (e.g. $\\mathcal{BD-D}C2$ and $\\mathcal{BD-D}A^*$) render the best fit quality. Specially, the value of AIC analysis and figures show that the interacting $\\mathcal{BD-D}C2$ model fit perfectly with overall data and reveals a strong evidence in favor of this model, against $\\Lambda$CDM.

  9. Henry Daniel Cogswell, DDS (1819-1900): a temperance advocate, philanthropist and builder of ice-water fountains.

    Science.gov (United States)

    Christen, A G; Theobald, M S; Christen, J A

    1999-07-01

    Henry Daniel Cogswell (Fig. 1), the second of five children, was born in Tolland, Connecticut on March 3, 1819. His father, George Washington Cogswell, was a general carpenter, architect and builder of moderate circumstances. In 1827, when Henry was eight, his mother died. The following year, Henry's father moved to Orwell, (Oswego County) New York, in hopes of improving his financial condition. Henry was left behind in the care of his paternal grandfather, who died several months later, leaving the 10-year old boy, stranded and forced to rely upon his own resources. (In those times, when families were separated, individual members had limited means of locating one another.)

  10. Solute and heat transport model of the Henry and hilleke laboratory experiment.

    Science.gov (United States)

    Langevin, Christian D; Dausman, Alyssa M; Sukop, Michael C

    2010-01-01

    SEAWAT is a coupled version of MODFLOW and MT3DMS designed to simulate variable-density ground water flow and solute transport. The most recent version of SEAWAT, called SEAWAT Version 4, includes new capabilities to represent simultaneous multispecies solute and heat transport. To test the new features in SEAWAT, the laboratory experiment of Henry and Hilleke (1972) was simulated. Henry and Hilleke used warm fresh water to recharge a large sand-filled glass tank. A cold salt water boundary was represented on one side. Adjustable heating pads were used to heat the bottom and left sides of the tank. In the laboratory experiment, Henry and Hilleke observed both salt water and fresh water flow systems separated by a narrow transition zone. After minor tuning of several input parameters with a parameter estimation program, results from the SEAWAT simulation show good agreement with the experiment. SEAWAT results suggest that heat loss to the room was more than expected by Henry and Hilleke, and that multiple thermal convection cells are the likely cause of the widened transition zone near the hot end of the tank. Other computer programs with similar capabilities may benefit from benchmark testing with the Henry and Hilleke laboratory experiment.

  11. Pigeon pea waste as a novel, inexpensive, substrate for production of a thermostable alkaline protease from thermoalkalophilic Bacillus sp. JB-99.

    Science.gov (United States)

    Johnvesly, B; Manjunath, B R; Naik, G R

    2002-03-01

    Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.

  12. The Former Miss Barstow with every Tom, Dick and Harry in a doll's house

    Directory of Open Access Journals (Sweden)

    Richard Newton

    2015-02-01

    Full Text Available Julie Holledge, panel chairperson and member of the International Ibsen Committee, invited myself along with 3 others to participate in the Inaugural Artists’ Keynote Panel: Applied Ibsen on Four Continents: The Artists’ Intentions. My presentation focused on “The Former Miss Barstow with every Tom, Dick and Harry in a doll’s house.” This was an adaptation of Ibsen’s “A Doll’s House” produced and staged in Los Angeles, California, 1987.  For the XIIIth International Ibsen Conference at the University of Tromsø, Norway, I projected images; a few found on the internet, and many from the production itself, as well as a video clip shown streaming live from YouTube. The article describes the social context of the 80s, analyzes the reinterpretation of Ibsen’s characters, and sets out to explain the symbology of the sets and costumes. I also touch on the differences between this production and Ibsen’s original in four important aspects. These would be the macaroons, the Tarantella, the silk stockings and the end of the play. Finally, I explain my decision to upload this version of “A Doll’s House,’ scene by scene, to my page on YouTube. Having shown films and videos for many years at festivals around the globe, I was looking for a way to step outside that box and reach an international audience just beyond my keyboard. In all of these ways, the goal has been to illuminate the ways in which an artist takes Ibsen’s text and applies it to the specific social context of their time and culture.

  13. [Henry Toussaint and Louis Pasteur. Rivalry over a vaccine].

    Science.gov (United States)

    Chevallier-Jussiau, Nadine

    2010-01-01

    Henry Toussaint (1847-1890) is a veterinary who studied in Veterinary School of Lyon with his great master Auguste Chauveau the famous physiologist. This place is the First School founded in Europe at the end of the XVIIIth century and has opened a way of thinking. His carrer brilliant and rich begins first in Lyon and then when he is named Professor of Anatomy and Physiology at the Veterinary School of Toulouse. Doctor of Science and Doctor of Medecine Toussaint applies "the experimental method" to his research in his laboratory and makes a lot of publications. He starts with Anatomy, then Physiology and soon he prioritizes his research to infestious diseases which cause serious damage to cattle in this time. He developes his own methods about anthrax an its "bacteridie", its nature, its way of culture and especially he studies the physiopathology of this disease. Pasteur is a renowned scientist who does study Microbiology at the same time in his laboratory in Paris, and precisely anthrax. He has explained his theories about "microbes" and has predominant advice. Toussaint admires Pasteur; in the year 1879 he finds first and isolates the microbe of "cholera des poules" (now Pasteurella) and gives Pasteur this new germ which will be used by Pasteur for his particular works about reducing of virulence by successive subcultures. In 1880 with his publishing on July 12 at the Academy of Science, Toussaint presents his successful result with an attenuated vaccine against anthrax: he has got protection against anthrax for dogs and sheep by using a vaccine which he has reduced off virulence by chemical manner. Academy congratulates him. Pasteur jealous of one's reputation contests the demonstration of Toussaint because he does not believe in the chemical method too different from his tests but will make use of this method for an experience open to the public in Pouilly-le-Fort in 1881. After this promotional event Pasteur will product and sell vaccines maked in his

  14. Recycling of resting cells in the JB-1 ascites tumour after treatment with 1-beta-D-arabinofuranosylcytosine (ara-C).

    Science.gov (United States)

    Dombernowsky, P; Bichel, P

    1976-01-01

    Resting cells in tumours present a major problem in cancer chemotherapy. In the plateau phase of grwoth of the murine JB-1 ascites tumour (i.e. 10 days after 2-5 X 10(6) cells i.p.) large fractions of non-cycling cells with G1 and G2 DNA content (Q1 and Q2 cells) are present, and the fate of these resting cells was investigated after treatment with 1-beta-D-arabinofuranosylcytosine (Ara-C). The experimental work of growth curves, percentage of labelled mitoses curves after continuous labelling with 3H-TdR, and cytophotometric determination of single-cell DNA content in unlabelled tumour cells. Treatment with an i.p. single injection of Ara-C 200 mg/kg in the plateau JB-1 tumour resulted in a significant reduction in the number of tumour cells 1 and 2 days later as compared with untreated controls, while no difference in the number of tumour cells was observed after 3 days. In tumours prelabelled with 3H-TdR 24 hr before Ara-C treatment, a significant decrease in the percentage of labelled mitoses was observed 6-8 hr later followed by a return to the initial value after 12 hr, and a new pronounced fall from 20 hr after Ara-C. The second fall in the percentage of labelled mitoses disappeared when the labelling with 3H-TdR was continued also after Ara-C treatment. Cytophotometry of unlabelled tumour cells prelabelled for 24 hr with 3H-TdR before Ara-C treatment showed 20 hr after Ara-C a pronounced decrease in the fraction of Q1 cells paralleled by an increase in the fraction of unlabelled cells with S DNA content. The results indicate recycling of resting cells first with G2 and later with G1 DNA content, which contribute to the regrowth of the tumours.

  15. Extracellular signal-regulated kinases 1/2 and Akt contribute to triclosan-stimulated proliferation of JB6 Cl 41-5a cells.

    Science.gov (United States)

    Wu, Yuanfeng; Beland, Frederick A; Chen, Si; Fang, Jia-Long

    2015-08-01

    Triclosan is a broad spectrum anti-bacterial agent widely used in many personal care products, household items, medical devices, and clinical settings. Human exposure to triclosan is mainly through oral and dermal routes. In previous studies, we found that sub-chronic dermal exposure of B6C3F1 mice to triclosan induced epidermal hyperplasia and focal necrosis; however, the mechanisms for these responses remain elusive. In this study, using mouse epidermis-derived JB6 Cl 41-5a cells, we found that triclosan stimulated cell growth in a concentration- and time-dependent manner. Enhanced cell proliferation was demonstrated by a substantial increase in the percentage of BrdU-positive cells, an elevation in the protein levels of cyclin D1 and cyclin A, and a reduction in the protein level of p27(Kip1). Western blotting analysis revealed that triclosan induced the activation of extracellular signal-regulated kinases 1/2 (ERK1/2), c-Jun N-terminal kinases (JNK), p38, and Akt. Pre-treatment of the cells with PD184352, an inhibitor of the upstream kinase MEK1/2, or with wortmannin, an inhibitor of phosphoinositide 3-kinase, blocked triclosan-mediated phosphorylation of ERK1/2 and Akt, respectively, and substantially suppressed triclosan-stimulated cell proliferation, whereas the JNK inhibitor SP600125 or the p38 inhibitor SB203580 had little to no effect on triclosan-stimulated cell proliferation. The phosphorylation activation of ERK1/2 and Akt was further confirmed on the skin of mice dermally administered triclosan. These data suggest that the activation of ERK1/2 and Akt is involved in triclosan-stimulated proliferation of JB6 Cl 41-5a cells.

  16. Gas Bubble Growth Dynamics in a Supersaturated Solution: Henry's and Sievert's Solubility Laws

    CERN Document Server

    Gor, Gennady Yu; Kuni, Fedor M

    2012-01-01

    Theoretical description of diffusion growth of a gas bubble after its nucleation in supersaturated liquid solution is presented. We study the influence of Laplace pressure on the bubble growth. We consider two different solubility laws: Henry's law, which is fulfilled for the systems where no gas molecules dissociation takes place and Sievert's law, which is fulfilled for the systems where gas molecules completely dissociate in the solvent into two parts. We show that the difference between Henry's and Sievert's laws for chemical equilibrium conditions causes the difference in bubble growth dynamics. Assuming that diffusion flux of dissolved gas molecules to the bubble is steady we obtain differential equations on bubble radius for both solubility laws. For the case of homogeneous nucleation of a bubble, which takes place at a significant pressure drop bubble dynamics equations for Henry's and Sievert's laws are solved analytically. For both solubility laws three characteristic stages of bubble growth are mar...

  17. «Ecuador» de Henri Michaux: fazer a viagem é que é a viagem

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Carvalho Casa Nova

    2011-10-01

    Full Text Available Resumo: Uma viagem que pode não ter acontecido, mas que merece o nome de viagem. Uma desconstrução do paradigma desse gênero. Relato que plasma a configuração de um eu imaginário à procura de um ultrapassamento e de estar en dehors de soi-même.Palavras-chave: Henri Michaux; Ecuador; gênero; viagem.Resúmé: Un voyage qui peut n’avoir existé, mais qui mérite le nom de voyage par son caractère de desconstruction d’une littérature de ce genre. Récit de voyage qui  montre une autre configuration d’un sujet imaginaire à la recherche d’être en dehors de soi-même.Mots-clés: Henri Michaux; Ecuador; genre; voyage.Keywords: Henri Michaux; Ecuador; gender; journey.

  18. Henry constants in polymer solutions with the van der Waals equation of state

    DEFF Research Database (Denmark)

    Bithas, Sotiris; Kalospiros, Nikolaos; Kontogeorgis, Georgios

    1996-01-01

    The simple der Waals equation of state, as extended to polymer systems, is applied to the correlation and prediction of Henry constants in polymer solutions comprising five polymers and many nonpolar and polar solvents, including supercritical gases. The correlation achieved with one adjustable...... parameter is satisfactory, with typical errors within the experimental uncertainty and comparable to those with the more complex Perturbed Hard Chain Theory-based equations of state with the same number of adjustable parameters. A predictive scheme for calculating Henry constants is also presented, which...... is a corresponding-states correlation for a dimensionless Henry constant defined based on the van der Waals equation of state. Satisfactory results-often close to the ones from the one-parameter correlation-are obtained for all systems investigated in this work. Compared with literature models that have been applied...

  19. Population structure of the wood-decay fungus Trichaptum abietinum (J. Dicks. Ryvarden in the Carpathian National Nature Park (Ukraine

    Directory of Open Access Journals (Sweden)

    Boiko Sergey M.

    2016-09-01

    Full Text Available This paper provides a list of intracellular isozyme systems of Trichaptum abietinum (J. Dicks. Ryvarden (Basidiomycetes that can be used for population studies. Population structure of the fungus within the Carpathian National Nature Park (CNNP was established. Percent of polymorphic loci in general was 83.3%. Groups of rare alleles were assigned Sod88, Sod138, Sdh191, and Est111. Calculated Wright's fixation index allowed establishing privilege of the heterozygotes on locus Acp and homozygotes on locus Sod. The population of T. abietinum in the CNNP was in equilibrium state.

  20. Study of Antigravity in an F(R) Model and in Brans-Dicke Theory with Cosmological Constant

    OpenAIRE

    2014-01-01

    We study antigravity, that is having an effective gravitational constant with a negative sign, in scalar-tensor theories originating from $F(R)$-theory and in a Brans-Dicke model with cosmological constant. For the $F(R)$ theory case, we obtain the antigravity scalar-tensor theory in the Jordan frame by using a variant of the Lagrange multipliers method and we numerically study the time dependent effective gravitational constant. As we shall demonstrate by using a specific $F(R)$ model, altho...

  1. New exact cosmological solutions to Brans-Dicke gravity with a self-interacting scalar-field

    CERN Document Server

    Arias, O; Arias, Olga; Quiros, Israel

    2002-01-01

    We derive a new parametric class of exact cosmological solutions to Brans-Dicke theory of gravity with a self-interacting scalar field and a barotropic perfect fluid of ordinary matter, by assuming a linear relationship between the Hubble expansion parameter and the time derivative of the scalar field. As a consequence only a class of exponential potentials and their combinations can be treated. The relevance of the solutions found for the description of the cosmic evolution are discussed in detail. We focus our discussion mainly on the possibility to have superquintessence behavior.

  2. The \\gamma\\ parameter in Brans-Dicke-like (light-)Scalar-Tensor theory with a universal scalar/matter coupling

    CERN Document Server

    Minazzoli, Olivier

    2013-01-01

    The post-Newtonian parameter \\gamma\\ resulting from a universal scalar/matter coupling is investigated in Brans-Dicke-like Scalar-Tensor theories where the scalar potential is assumed to be negligible. Conversely to previous studies, we use a perfect fluid formalism in order to get the explicit scalar-field equation. It is shown that the metric can be put in its standard post-Newtonian form. However, it is pointed out that 1-\\gamma\\ could be either positive, null or negative for finite value of \\omega_0, depending on the coupling function; while Scalar-Tensor theories without coupling always predict \\gamma<1 for finite value of \\omega_0.

  3. Fano-Agarwal couplings and non-rotating wave approximation in single-photon timed-Dicke subradiance

    OpenAIRE

    Mirza, Imran M.; Begzjav, Tuguldur

    2016-01-01

    Recently a new class of single-photon timed-Dicke (TD) subradiant states has been introduced with possible applications in single-photon based quantum information storage and on demand ultrafast retrieval [Scully M. O., Phys. Rev. Lett., 115 (2015) 243602]. However, the influence of any kind of virtual processes on the decay of these new kind of subradiant states has been left as an open question. In the present paper, we focus on this problem in detail. In particular, we investigate how pure...

  4. Taxing junk food: applying the logic of the Henry tax review to food.

    Science.gov (United States)

    Bond, Molly E; Williams, Michael J; Crammond, Brad; Loff, Bebe

    2010-10-18

    The recent review of taxation in Australia - the Henry tax review - has recommended that the federal government increase the taxes already levied on tobacco and alcohol. Tobacco and alcohol taxes are put forward as the best way of reducing the social harms caused by the use and misuse of these substances. Junk foods have the same pattern of misuse and the same social costs as tobacco and alcohol. The Henry tax review rejects the idea of taxing fatty foods, and to date the government has not implemented a tax on junk food. We propose that a tax on junk food be implemented as a tool to reduce consumption and address the obesity epidemic.

  5. Prediction of Henry's law constants of triazine derived herbicides from quantum chemical continuum solvation models.

    Science.gov (United States)

    Delgado, Eduardo J; Alderete, Joel B

    2003-01-01

    The Henry's law constants (H) for triazine derived herbicides are calculated using quantum chemical solvation models, SM2, SM3, PCM-DFT, and CPCM-DFT, and their performances are discussed. The results show considerable differences in performance among the different levels of theory. The values of H calculated by the semiempirical methods agree much better with the experimental values than those obtained at the DFT level. The differences are discussed in terms of the different contributions, electrostatic and no-electrostatic, to Gibbs free energy of solvation. In addition, the Henry's law constants of some triazine derived herbicides whose values have not been reported earlier are predicted as well.

  6. García Morente y el entusiasmo generacional por Henri Bergson

    OpenAIRE

    2012-01-01

    El catedrático español Manuel García Morente tuvo, como otros en su generación, una notable influencia de Henri Bergson. En trabajos más o menos espaciados, a lo largo de su vida, se advierte la impronta del pensador francés en su obra a todos los niveles. Si bien, se aprecia en sus últimos años un cierto distanciamiento y decepción. The Spanish professor Manuel García Morente had, as others in his generation, Henri Bergson's notable influence. In more or less spread works, along his life,...

  7. M. Pirgerou on D. Izzo and C. Martinez’s Revisionary Interventions into Henry James

    Directory of Open Access Journals (Sweden)

    2009-07-01

    Full Text Available Donatella Izzo and Carlo Martinez. Revisionary Interventions Into Henry James. Eds. Napoli, 2008. Revisionary Interventions into Henry James is a compilation of a series of papers presented at a colloquium which took place at Università Orientale in Naples, Italy, on October 27, 2006. In her introduction to the volume, Donatella Izzo acknowledges the “rather blatant plagiarism” (7 which lent the book its title.  The borrowing, of course, refers to Donald Pease’s landmark Revisionary Interve...

  8. 76 FR 50171 - Notice of Intent To Prepare an Environmental Impact Statement for the Henrys Fork Salinity...

    Science.gov (United States)

    2011-08-12

    ... the Henrys Fork Salinity Control Project Plan, Sweetwater and Uinta Counties, WY; Daggett and Summit... Statement (EIS) for the Henrys Fork Salinity Control Project Plan (SCPP). The NRCS will be the lead agency... Improvements'' alternative assumes a salinity control project will be implemented. Existing financial...

  9. The Imaginary World of Henri Rousseau. Teacher's Guide. School Arts: Looking/Learning.

    Science.gov (United States)

    Henderson, Anne

    While Henri Rousseau's work was not easily classified into any definitive artistic style of the time--impressionism, post-impressionism, fauvism, or cubism--it has been considered a forerunner of surrealism because of its dreamlike sensibility. This teaching guide provides information about Rousseau and his work, focusing on "Tropical Forest…

  10. A Brief Stylistic Analysis of The Cop and the Anthem Written by O. Henry

    Institute of Scientific and Technical Information of China (English)

    张秋婷

    2016-01-01

    O. Henry owns a particular style in short story writing. With the example of The Cop and the Anthem, this paper is aimed at analyzing the stylistic features from the perspective of lexical, syntactic and semantic in order to have a better understanding of O.Henry’s writing style.

  11. Reduction for Michaelis-Menten-Henri kinetics in the presence of diffusion.

    NARCIS (Netherlands)

    Kalachev, L.V.; Kaper, H.G.; Kaper, T.J.; Popovic, N.; Zagaris, A.

    2007-01-01

    Abstract: The Michaelis-Menten-Henri (MMH) mechanism is one of the paradigm reaction mechanisms in biology and chemistry. In its simplest form, it involves a substrate that reacts (reversibly) with an enzyme, forming a complex which is transformed (irreversibly) into a product and the enzyme. Given

  12. Reduction for Michaelis-Menten-Henri kinetics in the presence of diffusion

    NARCIS (Netherlands)

    A. Zagaris (Antonios); L.V. Kalachev; H.G. Kaper; T.J. Kaper (Tasso Joost); N. Popovic

    2007-01-01

    textabstractThe Michaelis-Menten-Henri (MMH) mechanism is one of the paradigm reaction mechanisms in biology and chemistry. In its simplest form, it involves a substrate that reacts (reversibly) with an enzyme, forming a complex which is transformed (irreversibly) into a product and the enzyme.

  13. The Heuristic Method, Precursor of Guided Inquiry: Henry Armstrong and British Girls' Schools, 1890-1920

    Science.gov (United States)

    Rayner-Canham, Geoff; Rayner-Canham, Marelene

    2015-01-01

    Though guided-inquiry learning, discovery learning, student-centered learning, and problem-based learning are commonly believed to be recent new approaches to the teaching of chemistry, in fact, the concept dates back to the late 19th century. Here, we will show that it was the British chemist, Henry Armstrong, who pioneered this technique,…

  14. Pre-Education Programs: A Comprehensive Project at Henry Ford Community College.

    Science.gov (United States)

    Zopf, Deborah; Smyrski, Larry

    This document presents an overview of a four-year comprehensive pre-education project at Henry Ford Community College (HFCC) in Michigan. To meet the needs of school districts that preferred a 32-credit certificate program as well as districts that preferred a 60-unit associate degree, HFCC employed a career-ladder approach: A 32-credit…

  15. Pornografia e transgressão na obra literária de Henry Miller

    Directory of Open Access Journals (Sweden)

    Raquel Catunda Pereira

    2016-07-01

    Full Text Available The North American writer Henry Miller was marginalized by literary critics since the first publications of his works in the 40s. Accused of being a pornographic text, the book Tropic of Cancer (1934 was forbidden in many countries. This article aims to analyze the obscene in Henry Miller’s work to prove that, beyond the erotic intention, Miller’s books are an expression of freedom and rejection of moral standards. In order to achieve our goal, we will use as theoretical basis the articles Criticismo e sexualidade: uma leitura de Tropico of Capricorn de Henry Miller, by Flávia Andréa Rodrigues Benfatt, and Literatura marginal americana: do épico confessional ao niilismo erótico, by Lainister de Oliveira. The texts mentioned above grant us the argumentation necessary to the analysis of pornographic discourse in Henry Miller’s literary works as the author’s aesthetics choice of taking himself as a transgressor in a decadent society.

  16. Community Arts Programs: Cohesion and Difference Case Studies. Henry Street Settlement and El Museo del Barrio

    Science.gov (United States)

    Kiebert-Gruen, Cathleen

    2009-01-01

    A comparative case study of two cultural institutions, Henry Street Settlement and El Museo del Barrio, founded almost eighty years apart, were involved in social justice causes and community arts. Although both of these institutions participated in the political activism of their time, they also demonstrated an important adaptability. They were…

  17. A Study of O.Henry s Writing Methods in His Short Story

    Institute of Scientific and Technical Information of China (English)

    卞莹

    2012-01-01

    O.Henry is one of the greatest American short story writers of the 20th century.He uses some peculiar writing methods in his short story "The Gift of the Magi":a distinctive title with metaphorical meaning,elaborate description of character and delicate portrayal of psychology,a reasonable and unexpected ending.

  18. Movement, Memory and Mathematics: Henri Bergson and the Ontology of Learning

    Science.gov (United States)

    de Freitas, Elizabeth; Ferrara, Francesca

    2015-01-01

    Using the work of philosopher Henri Bergson (1859-1941) to examine the nature of movement and memory, this article contributes to recent research on the role of the body in learning mathematics. Our aim in this paper is to introduce the ideas of Bergson and to show how these ideas shed light on mathematics classroom activity. Bergson's monist…

  19. On New Rhetoric, John Henry Newman and the Language of Metaphors: Implications for Branding Higher Education

    Science.gov (United States)

    Lawler-Brunner, Jennifer Lynne

    2012-01-01

    This project interprets how John Henry Newman's (1801-1890) system of thought informs the philosophical and theoretical grounds for rhetorical praxis in the marketplace. His seminal lessons in "An Essay in Aid of a Grammar of Assent" (1870) and "The Idea of a University" (1873 ed.) demonstrate the metaphoric power of words…

  20. Ernest Henry Starling (1866-1927): the scientist and the man

    DEFF Research Database (Denmark)

    Henriksen, Jens H

    2005-01-01

    The pre-eminent achievements of the English physician and physiologist Ernest Henry Starling were his quantitative explanation of the transcapillary transport of fluid, the discovery of the first hormone, secretin, and his formulation of the law of the heart. In some ways Starling was an outsider...

  1. Mounting a Curricular Revolution: An Interview with Henry Louis Gates, Jr.

    Science.gov (United States)

    von Zastrow, Claus

    2009-01-01

    This article presents an interview with Henry Louis Gates, Jr., Harvard professor and cultural critic who has captured 25 million viewers with his PBS documentary series, African American Lives (WNET). Using genealogical research and DNA science, Gates traces the family history of 19 famous African Americans. What results is a rich and moving…

  2. Movement, Memory and Mathematics: Henri Bergson and the Ontology of Learning

    Science.gov (United States)

    de Freitas, Elizabeth; Ferrara, Francesca

    2015-01-01

    Using the work of philosopher Henri Bergson (1859-1941) to examine the nature of movement and memory, this article contributes to recent research on the role of the body in learning mathematics. Our aim in this paper is to introduce the ideas of Bergson and to show how these ideas shed light on mathematics classroom activity. Bergson's monist…

  3. The Henry reaction in [Bmim][PF₆]-based microemulsions promoted by acylase.

    Science.gov (United States)

    Xia, Wen-Jian; Xie, Zong-Bo; Jiang, Guo-Fang; Le, Zhang-Gao

    2013-11-11

    An environmentally-friendly, enzyme-promoted procedure for the Henry reaction was first studied using water-in-[Bmim][PF6] microemulsions as reaction medium. The Amano acylase from Aspergillus oryzae showed better catalytic activity for the addition reactions of nitromethane with a series of aromatic aldehydes, and a highest yield of 90% was obtained.

  4. The occcurrence in Poland of Helminthosporium pedicellatum Henry, the imperfect stage of Trichometrasphaeria pedicellata Nelson

    Directory of Open Access Journals (Sweden)

    Maria Dorenda

    2014-11-01

    Full Text Available In the summer of 1967 colonies of a fungus from the genus Helminthosporium whose microscopic characters corresponded to the description of Helminthosporium pedicellatum Henry were isolated from the youngest wheat roots. There has so far been no mention of this species in Polish mycological literature.

  5. Community Arts Programs: Cohesion and Difference Case Studies. Henry Street Settlement and El Museo del Barrio

    Science.gov (United States)

    Kiebert-Gruen, Cathleen

    2009-01-01

    A comparative case study of two cultural institutions, Henry Street Settlement and El Museo del Barrio, founded almost eighty years apart, were involved in social justice causes and community arts. Although both of these institutions participated in the political activism of their time, they also demonstrated an important adaptability. They were…

  6. Henry David Thoreau, Martin Luther King Jr., and the American Tradition of Protest.

    Science.gov (United States)

    Powell, Brent

    1995-01-01

    Maintains that Henry David Thoreau and Martin Luther King, Jr. fundamentally altered the tradition of protest and reform. Compares and contrasts the role of each man in U.S. social and constitutional history. Concludes that while Thoreau lacked the broad influence of King, his writings influenced both King and Mohandas Gandhi. (CFR)

  7. Effective Henry's Law constant measurements for glyoxal in model aerosols containing sulfate

    Science.gov (United States)

    Kampf, C.; Waxman, E.; Slowik, J.; Dommen, J.; Prevot, A.; Baltensperger, U.; Noziere, B.; Hoffmann, T.; Volkamer, R.

    2012-04-01

    Traditional models represent secondary organic aerosol (SOA) formation based on the gas-phase oxidation of a limited set of precursor molecules. However, these models tend to under-estimate the amounts and degree of oxygenation of actual SOA, indicating missing processes. One such source that has become increasingly important in recent years is glyoxal (CHOCHO, the smallest alpha-dicarbonyl). Unlike traditional SOA precursors, glyoxal forms SOA by partitioning to the aqueous phase according to Henry's Law. This work presents an analysis of Henry's Law constants for glyoxal uptake to laboratory-generated aerosols in a dynamically coupled gas-aerosol system. We combine CU LED-CE-DOAS measurements of gas-phase glyoxal with online HR-Tof-AMS and time-resolved HPLC ESI MS/MS particle-phase measurements to characterize the time resolved evolution of glyoxal partitioning, and relate molecular-specific measurements to AMS mass spectra. The experiments were performed in the simulation chamber facility at PSI, Switzerland, and investigate ammonium sulfate (AS), and mixed AS / fulvic acid seed aerosols under relative humidity conditions ranging from 50 to 85% RH. The Henry's Law and effective Henry's Law constants are compared with other values reported in the literature.

  8. Implications of Two Well-Known Models for Instructional Designers in Distance Education: Dick-Carey versus Morrison-Ross-Kemp

    Science.gov (United States)

    Akbulut, Yavuz

    2007-01-01

    This paper first summarizes, and then compares and contrasts two well-known instructional design models: Dick and Carey Model (DC) and Morrison, Ross and Kemp model (MRK). The target audiences of both models are basically instructional designers. Both models have applications for different instructional design settings. They both see the…

  9. TRAVERSABLE WORMHOLES IN BRANS-DICKE AND f(R) GRAVITATIONAL THEORIES%Brans-Dicke理论和f(R)理论中的可穿越虫洞

    Institute of Scientific and Technical Information of China (English)

    吕璐峰; 刘文彪

    2012-01-01

    Brans-Dicke理论和f(R)理论均为不同于Einstein广义相对论的修正引力理论,并且在Brans-Dicke理论参数ω=0时能够回到f(R)理论.人们在Brans-Dicke理论框架下研究得出只有-3/2〈ω〈-4/3才存在可穿越虫洞,ω=0时没有;然而,f(R)理论中已经证明确实也存在可穿越虫洞.为了解决上述所谓的矛盾,有文献修改了Brans-Dicke理论中的某些函数,从而改变ω的取值范围.仔细分析发现,文献中探讨的是对应不同Φ(r),b(r)的可穿越虫洞,自然会给出不一致的结论.本文对2种修正引力理论中的可穿越虫洞问题进行了澄清,明确了各自虫洞解的讨论前提条件.%Brans-Dicke theory and f(R) theory are two types of modified gravitational theories.Brans-Dicke theory under ω=0 is consistent with f(R) theory.Due to the traversable wormhole solution,Brans-Dicke theory under ω=0 should also be consistent with f(R) theory.However,the traversable wormhole solution in Brans-Dicke theory is limited under-3/2〈ω〈-4/3,excluding ω=0.Meanwhile,a traversable wormhole solution is given in f(R) theory.The C(ω) function in Brans-Dicke wormhole solution has been modified to extend the range of ω to 0.In fact,the traversable wormholes in Brans-Dicke theory and f(R) theory correspond to different functions of Φ(r) and b(r).It is not necessary to modify the range of ω in Brans-Dicke solutions.

  10. 基于Dick&Carey模型的专门用途英语教学设计研究%A Research on ESP Teaching Design Based on Dick & Carey Model

    Institute of Scientific and Technical Information of China (English)

    赵星驰

    2016-01-01

    专门用途英语,是根据学习者的特定目的和特定需求而开设的英语课程.本文以Walter Dick& Lou Carey教授提出的教学系统开发模型为依据,对学前教育专业《英语口语》课程进行教学课程设计,探索ESP教学模式在高职英语教学中的应用方法,解决高职院校英语教学难题,实现英语教学与岗位需求的无缝对接.

  11. Biobleaching of wheat straw-rich soda pulp with alkalophilic laccase from gamma-proteobacterium JB: optimization of process parameters using response surface methodology.

    Science.gov (United States)

    Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince

    2008-11-01

    An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.

  12. Enhanced production of alkaline thermostable keratinolytic protease from calcium alginate immobilized cells of thermoalkalophilic Bacillus halodurans JB 99 exhibiting dehairing activity.

    Science.gov (United States)

    Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R

    2012-01-01

    The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.

  13. Existence of naked singularities in the Brans-Dicke theory of gravitation. An analytical and numerical study

    Energy Technology Data Exchange (ETDEWEB)

    Bedjaoui, Nabil [LMFA and INSSET, Universite de Picardie Jules Verne, 48 rue Raspail, 02100 St Quentin (France); LeFloch, Philippe G [Laboratoire Jacques-Louis Lions and Centre National de la Recherche Scientifique, Universite Pierre et Marie Curie (Paris 6), 4 Place Jussieu, 75252 Paris (France); Martin-Garcia, Jose M [Institut d' Astrophysique de Paris and Centre National de la Recherche Scientifique, Universite Pierre et Marie Curie, 98bis Boulevard Arago, 75014 Paris (France); Novak, Jerome, E-mail: Bedjaoui@u-picardie.f, E-mail: pgLeFloch@gmail.co, E-mail: Garcia@iap.f, E-mail: Jerome.Novak@obspm.f [Laboratoire Univers et Theories, Observatoire de Paris and Centre National de la Recherche Scientifique, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France)

    2010-12-21

    Within the framework of the scalar-tensor models of gravitation and by relying on analytical and numerical techniques, we establish the existence of a class of spherically symmetric spacetimes containing a naked singularity. Our result relies on and extends a work by Christodoulou on the existence of naked singularities for the Einstein-scalar field equations. We establish that a key parameter in Christodoulou's construction couples to the Brans-Dicke field and becomes a dynamical variable, which enlarges and modifies the phase space of solutions. We recover analytically many properties first identified by Christodoulou, in particular the loss of regularity (especially at the center), and then investigate numerically the properties of these spacetimes.

  14. Fano-Agarwal couplings and non-rotating wave approximation in single-photon timed Dicke subradiance

    Science.gov (United States)

    Mirza, Imran M.; Begzjav, Tuguldur

    2016-04-01

    Recently a new class of single-photon timed Dicke (TD) subradiant states has been introduced with possible applications in single-photon-based quantum information storage and on demand ultrafast retrieval (Scully M. O., Phys. Rev. Lett., 115 (2015) 243602). However, the influence of any kind of virtual processes on the decay of these new kind of subradiant states has been left as an open question. In the present paper, we focus on this problem in detail. In particular, we investigate how pure Fano-Agarwal couplings and other virtual processes arising from non-rotating wave approximation impact the decay of otherwise sub- and superradiant states. In addition to the overall virtual couplings among all TD states, we also focus on the dominant role played by the couplings between specific TD states.

  15. Solving the Flatness and Quasi-flatness Problems in Brans-Dicke Cosmologies with a Varying Light Speed

    CERN Document Server

    Barrow, John D; Barrow, John D.; Magueijo, Joao

    1999-01-01

    We define the flatness and quasi-flatness problems in cosmological models. We seek solutions to both problems in homogeneous and isotropic Brans-Dicke cosmologies with varying speed of light. We formulate this theory and find perturbative, non-perturbative, and asymptotic solutions using both numerical and analytical methods. For a particular range of variations of the speed of light the flatness problem can be solved. Under other conditions there exists a late-time attractor with a constant value of Ømega that is smaller than, but of order, unity. Thus these theories may solve the quasi-flatness problem, a considerably more challenging problem than the flatness problem. We also discuss the related \\Lambda and quasi-\\Lambda problem in these theories. We conclude with an appraisal of the difficulties these theories may face.

  16. Characterization of the quantum phase transition in a two-mode Dicke model for different cooperation numbers

    Science.gov (United States)

    Quezada, L. F.; Nahmad-Achar, E.

    2017-01-01

    We show how the use of variational states to approximate the ground state of a system can be employed to study a multimode Dicke model. One of the main contributions of this work is the introduction of a not very commonly used quantity, the cooperation number, and the study of its influence on the behavior of the system, paying particular attention to the quantum phase transitions and the accuracy of the used approximations. We also show how these phase transitions affect the dependence of the expectation values of some of the observables relevant to the system and the entropy of entanglement with respect to the energy difference between atomic states and the coupling strength between matter and radiation, thus characterizing the transitions in different ways.

  17. A Study of Cosmic Expansion Generated by Non-conservation of Matter in the Framework of Brans-Dicke Theory

    CERN Document Server

    Roy, Sudipto

    2016-01-01

    The present study, on the expansion of universe, is based on an assumption regarding the possibility of inter-conversion between matter and dark energy, through some interaction of matter with the scalar field in the framework of Brans-Dicke theory. The field equations for a spatially flat space-time have been solved using an empirical dependence of scalar field parameter upon the scale factor. To represent the behaviour regarding the non-conservation of matter, a function, expressed in terms of the Hubble parameter, has been empirically incorporated into the field equations. Their solution shows that, this function, whose value is proportional to the matter content of the universe, decreases monotonically with time. This matter-field interaction generates late time acceleration, causing the deceleration parameter to change its sign from positive to negative. Time dependence of the proportion of dark energy component of the universe has been determined and shown graphically. Time variation of gravitational co...

  18. Higgs potential from extended Brans-Dicke theory and the time-evolution of the fundamental constants

    CERN Document Server

    Sola, Joan; Khodam-Mohammadi, A

    2016-01-01

    Despite the enormous significance of the Higgs potential in the context of the Standard Model of electroweak interactions and in Grand Unified Theories, its ultimate origin is fundamentally unknown and must be introduced by hand in accordance with the underlying gauge symmetry and the requirement of renormalizability. Here we propose a more physical motivation for the structure of the Higgs potential, which we link to gravity, and more specifically to an extended Brans-Dicke (BD) theory containing two interacting scalar fields. One of these fields is coupled to curvature as in the BD formulation, whereas the other is coupled to gravity both derivatively and non-derivatively through the curvature scalar and the Ricci tensor. By requiring that the cosmological solutions of the model are consistent with observations, we show that the effective scalar field potential adopts the Higgs potential form with a mildly time-evolving vacuum expectation value. Such residual vacuum dynamics could be responsible for the pos...

  19. Time Variation of the Matter Content of the Expanding Universe in the Framework of Brans-Dicke Theory

    CERN Document Server

    Roy, Sudipto

    2016-01-01

    In the framework of Brans-Dicke theory, a cosmological model regarding the expanding universe has been formulated by considering an inter-conversion of matter and dark energy. A function of time has been incorporated into the expression of the density of matter to account for the non-conservation of the matter content of the universe. This function is proportional to the matter content of the universe. Its functional form is determined by using empirical expressions of the scale factor and the scalar field in field equations. This scale factor has been chosen to generate a signature flip of the deceleration parameter with time. The matter content is found to decrease with time monotonically, indicating a conversion of matter into dark energy. This study leads us to the expressions of the proportions of matter and dark energy of the universe. Dependence of various cosmological parameters upon the matter content has been explored.

  20. [Crusading and Chronicle Writing on the Medieval Baltic Frontier: A Companion to the Chronicle of Henry of Livonia] / Michael Amundsen

    Index Scriptorium Estoniae

    Amundsen, Michael

    2012-01-01

    Arvustus: Crusading and chronicle writing on the medieval Baltic frontier : a companion to the Chronicle of Henry of Livonia / edited by Marek Tamm, Linda Kaljundi, Carsten Selch Jensen. Farnham : Ashgate, 2011