Energy Technology Data Exchange (ETDEWEB)
Cary,; Bruce, R [Santa Fe, NM; Stubben, Christopher J [Los Alamos, NM
2011-03-22
The invention provides highly sensitive and specific assays for the major citrus pathogens Xylella fastidiosa and Xanthomonas axonopodis, including a field deployable multiplexed assay capable of rapidly assaying for both pathogens simultaneously. The assays are directed at particular gene targets derived from pathogenic strains that specifically cause the major citrus diseases of citrus variegated chlorosis (Xylella fastidiosa 9a5c) and citrus canker (Xanthomonas axonopodis pv citri). The citrus pathogen assays of the invention offer femtomole sensitivity, excellent linear dynamic range, and rapid and specific detection.
Directory of Open Access Journals (Sweden)
Valente eAritua
2015-10-01
Full Text Available Common bacterial blight is a devastating seed-borne disease of common beans that also occurs on other legume species including lablab and Lima beans. We sequenced and analysed the genomes of 26 isolates of Xanthomonas axonopodis pv. phaseoli and X. fuscans subsp. fuscans, the causative agents of this disease, collected over four decades and six continents. This revealed considerable genetic variation within both taxa, encompassing both single-nucleotide variants and differences in gene content, that could be exploited for tracking pathogen spread. The bacterial isolate from Lima bean fell within the previously described Genetic Lineage 1, along with the pathovar type isolate (NCPPB 3035. The isolates from lablab represent a new, previously unknown genetic lineage closely related to strains of X. axonopodis pv. glycines. Finally, we identified more than 100 genes that appear to have been recently acquired by Xanthomonas axonopodis pv. phaseoli from X. fuscans subsp. fuscans.
Evolutionary history of the plant pathogenic bacterium Xanthomonas axonopodis.
Directory of Open Access Journals (Sweden)
Nadia Mhedbi-Hajri
Full Text Available Deciphering mechanisms shaping bacterial diversity should help to build tools to predict the emergence of infectious diseases. Xanthomonads are plant pathogenic bacteria found worldwide. Xanthomonas axonopodis is a genetically heterogeneous species clustering, into six groups, strains that are collectively pathogenic on a large number of plants. However, each strain displays a narrow host range. We address the question of the nature of the evolutionary processes--geographical and ecological speciation--that shaped this diversity. We assembled a large collection of X. axonopodis strains that were isolated over a long period, over continents, and from various hosts. Based on the sequence analysis of seven housekeeping genes, we found that recombination occurred as frequently as point mutation in the evolutionary history of X. axonopodis. However, the impact of recombination was about three times greater than the impact of mutation on the diversity observed in the whole dataset. We then reconstructed the clonal genealogy of the strains using coalescent and genealogy approaches and we studied the diversification of the pathogen using a model of divergence with migration. The suggested scenario involves a first step of generalist diversification that spanned over the last 25,000 years. A second step of ecology-driven specialization occurred during the past two centuries. Eventually, secondary contacts between host-specialized strains probably occurred as a result of agricultural development and intensification, allowing genetic exchanges of virulence-associated genes. These transfers may have favored the emergence of novel pathotypes. Finally, we argue that the largest ecological entity within X. axonopodis is the pathovar.
International Nuclear Information System (INIS)
Souza, C. S.; Ferreira, L. C. S.; Thomas, L.; Barbosa, J. A. R. G.; Balan, A.
2009-01-01
The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. Maltose-binding protein is the periplasmic component of the ABC transporter responsible for the uptake of maltose/maltodextrins. The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. The crystal belonged to the primitive hexagonal space group P6 1 22, with unit-cell parameters a = 123.59, b = 123.59, c = 304.20 Å, and contained two molecules in the asymetric unit. It diffracted to 2.24 Å resolution
Directory of Open Access Journals (Sweden)
Tamires Ribeiro
2016-12-01
Full Text Available The aim of this study was to evaluate the resistance of 58 common bean lines against common bacterial blight (Xanthomonas axonopodis pv. phaseoli and bacterial wilt (Curtobacterium flaccumfaciens pv. flaccumfaciens. The experimental design consisted of completely randomized blocks, with four replications per pathogen. The results were subjected to variance analysis by the F test at 1% probability. Significant differences between the treatments indicated different resistance levels among the lines against both pathogens. According to the Scott-Knott test, six lines were resistant to Xanthomonas axonopodis pv. phaseoli, 14 moderately resistant, and 38 susceptible. To Curtobacterium flaccumfaciens pv. flaccumfaciens, 11 lines were resistant, 26 moderately resistant and 21 susceptible. Among these, the lines Pr10-3-4/1, Pr10-5-2/1 and Pr10-5- 2/2 of the black bean group and C10-2-4/2 of the Carioca group were resistant to both major bacterial diseases affecting common bean in Brazil.
Directory of Open Access Journals (Sweden)
Roberto Luis Portz
2006-07-01
Full Text Available A bacteriose (Xanthomonas axonopodis pv. manihotis e a doenca de maior importancia economica na cultura da mandioca. Para estudar a variabilidade genetica desta bacteria no Oeste do Parana, foram realizados levantamentos em Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa e Pato Bragado. Os isolados foram caracterizados em relacao a atividade de amilase, ƒ¿ e ƒÀ-esterase e agressividade. Dos 61 materiais vegetais coletados, obtiveram-se 19 isolados da bacteria, com maior incidencia para variedades de mesa em relacao aqueles para industria. Manivas provenientes de Pato Bragado, Entre Rios do Oeste e Mercedes apresentaram incidencias de 10, 27 e 10%, respectivamente, valores inferiores aos de Marechal Candido Rondon (50% e Nova Santa Rosa (58%. Os isolados foram agrupados em cinco, seis e 12 grupos em relacao a capacidade amilolitica, agressividade e isoenzimas de esterase, respectivamente. Nao houve relacao entre atividade de amilase e agressividade. Isolados de Marechal Candido Rondon foram mais agressivos que os provenientes das outras regioes. O agrupamento com base em esterase permitiu verificar que isolados provenientes de Entre Rios do Oeste, Nova Santa Rosa e Mercedes apresentaram alto grau de similaridade. Estes resultados indicam haver diferenciacaoentre os isolados da bacteria presentes nos municipios amostrados.The bacterial blight (Xanthomonas axonopodis pv. manihotis is the most important disease of cassava. To study the genetic variability of pathogen in the West of Parana, a research was carried out at Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa and Pato Bragado. The isolates were characterized to amylase activity, ƒ¿ and ƒÀ-esterase and aggressiveness. From 61 collected materials, were obtained 19 bacterial isolates, with larger incidence for varieties of human consume than those for industry. Stems from Pato Bragado, Entre Rios do Oeste and Mercedes
Efect of aqueous extract from turmeric (Curcuma longa L.) in Xanthomonas axonopodis pv. manihotis.
Odair Josà Kuhn
2003-01-01
The cassava bacterial blight caused by Xanthomonas axonopodis pv. manihotis is the most importance disease of the culture and it is distributed in all the places where it is cultivated. Infected stems constitute themselves in the principal way of the bacterium dissemination to new cultivation areas. The chemical control of phytobacteria is difficult due to the products shortage, as well as, the existing ones are used exclusively in plantations of high economic value. By the other hand, the al...
The molybdate-binding protein (ModA) of the plant pathogen Xanthomonas axonopodis pv. citri.
Balan, Andrea; Santacruz, Carolina P; Moutran, Alexandre; Ferreira, Rita C C; Medrano, Francisco J; Pérez, Carlos A; Ramos, Carlos H I; Ferreira, Luís C S
2006-12-01
The modABC operon of phytopathogen Xanthomonas axonopodis pv. citri (X. citri) encodes a putative ABC transporter involved in the uptake of the molybdate and tungstate anions. Sequence analyses showed high similarity values of ModA orthologs found in X. campestris pv. campestris (X. campestris) and Escherichia coli. The X. citri modA gene was cloned in pET28a and the recombinant protein, expressed in the E. coli BL21 (DE3) strain, purified by immobilized metal affinity chromatography. The purified protein remained soluble and specifically bound molybdate and tungstate with K(d) 0.29+/-0.12 microM and 0.58+/-0.14 microM, respectively. Additionally binding of molybdate drastically enhanced the thermal stability of the recombinant ModA as compared to the apoprotein. This is the first characterization of a ModA ortholog expressed by a phytopathogen and represents an important tool for functional, biochemical and structural analyses of molybdate transport in Xanthomonas species.
Mayer, Lauri; Vendruscolo, Claire Tondo; Silva, Wladimir Padilha da; Moura, Andrea Bittencourt
2008-01-01
Goma xantana é um heteropolissacarídeo bacteriano sintetizado por várias espécies do gênero Xanthomonas. Devido principalmente às suas excelentes propriedades reológicas, encontra diversas aplicações na indústria alimentícia, petrolífera, cosmética e em produtos farmacêuticos. Este trabalho objetivou a produção, a análise da viscosidade, do comportamento reológico e a composição química da goma xantana produzida por sete cepas de Xanthomonas axonopodis pv. phaseoli. A produção de xantana vari...
Arrieta-Ortiz, Mario L; Rodríguez-R, Luis M; Pérez-Quintero, Álvaro L; Poulin, Lucie; Díaz, Ana C; Arias Rojas, Nathalia; Trujillo, Cesar; Restrepo Benavides, Mariana; Bart, Rebecca; Boch, Jens; Boureau, Tristan; Darrasse, Armelle; David, Perrine; Dugé de Bernonville, Thomas; Fontanilla, Paula; Gagnevin, Lionel; Guérin, Fabien; Jacques, Marie-Agnès; Lauber, Emmanuelle; Lefeuvre, Pierre; Medina, Cesar; Medina, Edgar; Montenegro, Nathaly; Muñoz Bodnar, Alejandra; Noël, Laurent D; Ortiz Quiñones, Juan F; Osorio, Daniela; Pardo, Carolina; Patil, Prabhu B; Poussier, Stéphane; Pruvost, Olivier; Robène-Soustrade, Isabelle; Ryan, Robert P; Tabima, Javier; Urrego Morales, Oscar G; Vernière, Christian; Carrere, Sébastien; Verdier, Valérie; Szurek, Boris; Restrepo, Silvia; López, Camilo; Koebnik, Ralf; Bernal, Adriana
2013-01-01
Xanthomonas axonopodis pv. manihotis (Xam) is the causal agent of bacterial blight of cassava, which is among the main components of human diet in Africa and South America. Current information about the molecular pathogenicity factors involved in the infection process of this organism is limited. Previous studies in other bacteria in this genus suggest that advanced draft genome sequences are valuable resources for molecular studies on their interaction with plants and could provide valuable tools for diagnostics and detection. Here we have generated the first manually annotated high-quality draft genome sequence of Xam strain CIO151. Its genomic structure is similar to that of other xanthomonads, especially Xanthomonas euvesicatoria and Xanthomonas citri pv. citri species. Several putative pathogenicity factors were identified, including type III effectors, cell wall-degrading enzymes and clusters encoding protein secretion systems. Specific characteristics in this genome include changes in the xanthomonadin cluster that could explain the lack of typical yellow color in all strains of this pathovar and the presence of 50 regions in the genome with atypical nucleotide composition. The genome sequence was used to predict and evaluate 22 variable number of tandem repeat (VNTR) loci that were subsequently demonstrated as polymorphic in representative Xam strains. Our results demonstrate that Xanthomonas axonopodis pv. manihotis strain CIO151 possesses ten clusters of pathogenicity factors conserved within the genus Xanthomonas. We report 126 genes that are potentially unique to Xam, as well as potential horizontal transfer events in the history of the genome. The relation of these regions with virulence and pathogenicity could explain several aspects of the biology of this pathogen, including its ability to colonize both vascular and non-vascular tissues of cassava plants. A set of 16 robust, polymorphic VNTR loci will be useful to develop a multi-locus VNTR analysis
Robène, Isabelle; Perret, Marion; Jouen, Emmanuel; Escalon, Aline; Maillot, Marie-Véronique; Chabirand, Aude; Moreau, Aurélie; Laurent, Annie; Chiroleu, Frédéric; Pruvost, Olivier
2015-07-01
Bacterial blight of onion is an emerging disease threatening world onion production. The causal agent Xanthomonas axonopodis pv. allii is seed transmitted and a reliable and sensitive tool is needed to monitor seed exchanges. A triplex quantitative real-time PCR assay was developed targeting two X. axonopodis pv. allii-specific markers and an internal control chosen in 5.8S rRNA gene from Alliaceae. Amplification of at least one marker indicates the presence of the bacterium in seed extracts. This real-time PCR assay detected all the 79 X. axonopodis pv. allii strains tested and excluded 85.2% of the 135 non-target strains and particularly all 39 saprophytic and pathogenic bacteria associated with onion. Cross-reactions were mainly obtained for strains assigned to nine phylogenetically related X. axonopodis pathovars. The cycle cut-off was estimated statistically at 36.3 considering a risk of false positive of 1%. The limit of detection obtained in at least 95% of the time (LOD 95%) was 5×10(3) CFU/g (colony forming unit/g). The sensitivity threshold was found to be 1 infected seed in 32,790 seeds. This real-time PCR assay should be useful for preventing the long-distance spread of X. axonopodis pv. allii via contaminated seed lots and determining the epidemiology of the bacterium. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Carvalho Flávia Maria de Souza
2005-01-01
Full Text Available Xanthomonas axonopodis pv. citri strains that cause disease in citrus were investigated by pulsed field and plasmid profile analysis. For the first method, genomic DNA was digested by the rare-cutting enzymes Xba I and Vsp I. The strains evaluated were collected in seven different States of Brazil and in Argentina, Bolivia, Paraguay and Uruguay. Genetic variability was found among strains of X. axonopodis pv. citri from different geographical areas Argentina, Bolivia and Uruguay, with similarities varying from 0.62 to 0.83. However, the strains collected in Brazil, despite being from different States, have shown a genetic similarity ranging from 0.83 to 1.00. Cluster analysis showed a relationship between genomic similarity and geographical origin of the strains. Plasmids were observed in all strains, with a total of five different plasmids, with sizes between 57.7 and 83.0 kilobases. The 72.6 kb plasmid was the most frequent, present in 15 out of 22 strains, while the 68.1 kb plasmid was observed in two strains only. Although the plasmid diversity detected in the present study was not very great, the X. axonopodis pv. citri strains evaluated showed a considerable degree of diversity with regard to this extrachromosomal genetic element.
International Nuclear Information System (INIS)
Santacruz, C. P.; Balan, A.; Ferreira, L. C. S.; Barbosa, J. A. R. G.
2006-01-01
The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222 1, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222 1 , with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress
Energy Technology Data Exchange (ETDEWEB)
Santacruz, C. P.; Balan, A.; Ferreira, L. C. S. [Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil); Barbosa, J. A. R. G., E-mail: joao@lnls.br [Centro de Biologia Molecular e Estrutural (CeBiMe), Laboratório Nacional de Luz Síncrotron (LNLS), CP 6192, Campinas, SP 13084-971 (Brazil); Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil)
2006-03-01
The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222{sub 1,} with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222{sub 1}, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress.
Medina, Cesar Augusto; Reyes, Paola Andrea; Trujillo, Cesar Augusto; Gonzalez, Juan Luis; Bejarano, David Alejandro; Montenegro, Nathaly Andrea; Jacobs, Jonathan M; Joe, Anna; Restrepo, Silvia; Alfano, James R; Bernal, Adriana
2018-03-01
Xanthomonas axonopodis pv. manihotis (Xam) causes cassava bacterial blight, the most important bacterial disease of cassava. Xam, like other Xanthomonas species, requires type III effectors (T3Es) for maximal virulence. Xam strain CIO151 possesses 17 predicted T3Es belonging to the Xanthomonas outer protein (Xop) class. This work aimed to characterize nine Xop effectors present in Xam CIO151 for their role in virulence and modulation of plant immunity. Our findings demonstrate the importance of XopZ, XopX, XopAO1 and AvrBs2 for full virulence, as well as a redundant function in virulence between XopN and XopQ in susceptible cassava plants. We tested their role in pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) and effector-triggered immunity (ETI) using heterologous systems. AvrBs2, XopR and XopAO1 are capable of suppressing PTI. ETI suppression activity was only detected for XopE4 and XopAO1. These results demonstrate the overall importance and diversity in functions of major virulence effectors AvrBs2 and XopAO1 in Xam during cassava infection. © 2017 BSPP AND JOHN WILEY & SONS LTD.
Sindt, Nathan M.; Robison, Faith; Brick, Mark A.; Schwartz, Howard F.; Heuberger, Adam L.; Prenni, Jessica E.
2018-02-01
Matrix-assisted desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) is a fast and effective tool for microbial species identification. However, current approaches are limited to species-level identification even when genetic differences are known. Here, we present a novel workflow that applies the statistical method of partial least squares discriminant analysis (PLS-DA) to MALDI-TOF-MS protein fingerprint data of Xanthomonas axonopodis, an important bacterial plant pathogen of fruit and vegetable crops. Mass spectra of 32 X. axonopodis strains were used to create a mass spectral library and PLS-DA was employed to model the closely related strains. A robust workflow was designed to optimize the PLS-DA model by assessing the model performance over a range of signal-to-noise ratios (s/n) and mass filter (MF) thresholds. The optimized parameters were observed to be s/n = 3 and MF = 0.7. The model correctly classified 83% of spectra withheld from the model as a test set. A new decision rule was developed, termed the rolled-up Maximum Decision Rule (ruMDR), and this method improved identification rates to 92%. These results demonstrate that MALDI-TOF-MS protein fingerprints of bacterial isolates can be utilized to enable identification at the strain level. Furthermore, the open-source framework of this workflow allows for broad implementation across various instrument platforms as well as integration with alternative modeling and classification algorithms.
International Nuclear Information System (INIS)
Peyrou, M.; Del Campo, R.; Russi, P.; Mara, H.; Rigamonti, N.; Larrechart, L.; Perez, E.
2012-01-01
Xanthomonas axonopodis pv. ci tri (X ac) produces citrus canker disease in all citrus commercial species. The bacteria can be disseminated through vegetative propagation material in asymptomatic form. To optimize bacteria detection techniques applicable to asymptomatic citrus plant tissue routine analysis, ELISA, Immunofluorescence, Pcr, qRT P CR and host plant inoculation (bioassay) diagnostic techniques were compared. Tests were made from decimal dilutions between 108 uf6.ml-1 and 102 ufc.mL-1 using a pure culture of 49b strain.The detection level obtained was 1.8 x 102 ufc.mL-1 using Inmunofluorescence; 1.8x104 ufc.mL-1 with indirect ELISA, 1.8 x 103 ufc.mL-1 by means of PCR; 10 ufc.mL-1 through of qRT P CR and 230 ufc.mL-1 in sour orange inoculated plants. The experiment was repeated at least three times for each technique. Considering this result, and taking into account that sensitivity, practicity and cost, are important when a great number of plants need to be tested, the PCR and inoculation in host plants were those that met the best characteristics to be evaluated in asymptomatic plant material
International Nuclear Information System (INIS)
Silva, Lorena M.A.; Alves Filho, Elenilson G.; Choze, Rafael; Liao, Luciano M.; Alcantara, Glaucia B.
2012-01-01
Xanthomonas axonopodis (Xac) bacterium causes one of the most feared and untreatable diseases in citriculture: citrus canker. To understand the response mechanisms of orange trees when attacked by Xac, leaves and fruits of Citrus sinensis were directly evaluated by HRMAS NMR (high resolution magic angle spinning nuclear magnetic resonance) spectroscopy. This technique allows the analysis of samples without laborious pre-treatments and also allows access to important information about chemical composition of samples. The orange tree leaves and fruit peels investigated in this study demonstrated the biochemical changes caused by Xac. Aided by chemometric analysis, the HRMAS NMR results show relevant changes in amino acids, carbohydrates, organic acids and terpenoids content. (author)
Energy Technology Data Exchange (ETDEWEB)
Hilario, Eduardo; Teixeira, Elaine Cristina; Pedroso, Gisele Audrei; Bertolini, Maria Célia [Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil); Medrano, Francisco Javier, E-mail: fjmedrano@yahoo.com [Departamento de Cristalografia de Proteínas, Centro de Biologia Molecular Estrutural, Laboratório Nacional de Luz Síncrotron, Caixa Postal 6192, CEP 13084-971, Campinas-SP (Brazil); Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil)
2006-05-01
XAC1151, a small heat-shock protein from X. axonopodis pv. citri belonging to the α-crystallin family, was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The hspA gene (XAC1151) from Xanthomonas axonopodis pv. citri encodes a protein of 158 amino acids that belongs to the small heat-shock protein (sHSP) family of proteins. These proteins function as molecular chaperones by preventing protein aggregation. The protein was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The crystal belongs to the rhombohedral space group R3, with unit-cell parameters a = b = 128.7, c = 55.3 Å. The crystal structure was solved by molecular-replacement methods. Structure refinement is in progress.
Distribution and biological role of the oligopeptide-binding protein (OppA) in Xanthomonas species.
Oshiro, Elisa E; Tavares, Milene B; Suzuki, Celso F; Pimenta, Daniel C; Angeli, Claudia B; de Oliveira, Julio C F; Ferro, Maria I T; Ferreira, Luis C S; Ferreira, Rita C C
2010-04-01
In this study we investigated the prevalence of the oppA gene, encoding the oligopeptide binding protein (OppA) of the major bacterial oligopeptide uptake system (Opp), in different species of the genus Xanthomonas. The oppA gene was detected in two Xanthomonas axonopodis strains among eight tested Xanthomonas species. The generation of an isogenic oppA-knockout derivative of the Xac 306 strain, showed that the OppA protein neither plays a relevant role in oligopeptide uptake nor contributes to the infectivity and multiplication of the bacterial strain in leaves of sweet orange (Citrus sinensis) and Rangpur lime (Citrus limonia). Taken together these results suggest that the oppA gene has a recent evolutionary history in the genus and does not contribute in the physiology or pathogenesis of X. axonopodis.
Distribution and biological role of the oligopeptide-binding protein (OppA in Xanthomonas species
Directory of Open Access Journals (Sweden)
Elisa E. Oshiro
2010-01-01
Full Text Available In this study we investigated the prevalence of the oppA gene, encoding the oligopeptide binding protein (OppA of the major bacterial oligopeptide uptake system (Opp, in different species of the genus Xanthomonas. The oppA gene was detected in two Xanthomonas axonopodis strains among eight tested Xanthomonas species. The generation of an isogenic oppA-knockout derivative of the Xac 306 strain, showed that the OppA protein neither plays a relevant role in oligopeptide uptake nor contributes to the infectivity and multiplication of the bacterial strain in leaves of sweet orange (Citrus sinensis and Rangpur lime (Citrus limonia. Taken together these results suggest that the oppA gene has a recent evolutionary history in the genus and does not contribute in the physiology or pathogenesis of X. axonopodis.
Directory of Open Access Journals (Sweden)
Popović Tatjana
2012-01-01
Full Text Available Bean production is threaten by phytopathogenic bacteria causing agents of blights, Xanthomonas axonopodis pv. phaseoli (Xap and Pseudomonas savastanoi pv. phaseolicola (Psp. Since there is no satisfactory chemical control for the disease, the recommended measures are preventive and include use of healthy seed, crop rotation, deep plowing and use of resistant cultivars. In this work we involved a detection method for isolation of Xap and Psp from bean seed to semi-selective medium Milk Agar Tween (MT. On this medium, Xap formed yellow, mucoid and convex colonies with two hydrolysis zones (less milk and more enlightened, and Psp formed whitish-cream, flat and round colonies. The identification of Xap and Psp was confirmed using the ELISA and PCR. Due to its selectivity, easy preparation and possibility of simultaneous detection of bacteria Xap and Psp, MT medium can be recommended for routine test of seed health for local seed or seed from import.
International Nuclear Information System (INIS)
Guzzo, Cristiane R.; Nagem, Ronaldo A. P.; Galvão-Botton, Leonor M. P.; Guimarães, Beatriz G.; Medrano, Francisco J.; Barbosa, João A. R. G.; Farah, Chuck S.
2005-01-01
The first crystallographic study of a member of the YaeQ family of proteins, which are conserved in a small group of Gram-negative bacteria, most of which are animal or plant pathogens, is reported. Diffraction data were collected to 1.9 Å resolution and an interpretable electron-density map was obtained. Xanthomonas axonopodis pv. citri YaeQ (XAC2396) is a member of a family of bacterial proteins conserved in several Gram-negative pathogens. Here, the cloning, expression, purification and crystallization of the 182-residue (20.6 kDa) YaeQ protein are described. Recombinant YaeQ containing selenomethionine was crystallized in space group P2 1 and crystals diffracted to 1.9 Å resolution at a synchrotron source. The unit-cell parameters are a = 39.75, b = 91.88, c = 48.03 Å, β = 108.37°. The calculated Matthews coefficient suggests the presence of two YaeQ molecules in the asymmetric unit. Initial experimental phases were calculated by the multiple-wavelength anomalous dispersion technique and an interpretable electron-density map was obtained
Balan, Andrea; Santacruz-Pérez, Carolina; Moutran, Alexandre; Ferreira, Luís Carlos Souza; Neshich, Goran; Gonçalves Barbosa, João Alexandre Ribeiro
2008-02-01
In Xanthomonas axonopodis pv. citri (Xac or X. citri), the modA gene codes for a periplasmic protein (ModA) that is capable of binding molybdate and tungstate as part of the ABC-type transporter required for the uptake of micronutrients. In this study, we report the crystallographic structure of the Xac ModA protein with bound molybdate. The Xac ModA structure is similar to orthologs with known three-dimensional structures and consists of two nearly symmetrical domains separated by a hinge region where the oxyanion-binding site lies. Phylogenetic analysis of different ModA orthologs based on sequence alignments revealed three groups of molybdate-binding proteins: bacterial phytopathogens, enterobacteria and soil bacteria. Even though the ModA orthologs are segregated into different groups, the ligand-binding hydrogen bonds are mostly conserved, except for Archaeglobus fulgidus ModA. A detailed discussion of hydrophobic interactions in the active site is presented and two new residues, Ala38 and Ser151, are shown to be part of the ligand-binding pocket.
Insights into xanthomonas axonopodis pv. Citri biofilm through proteomics
Zimaro, Tamara
2013-08-07
Background: Xanthomonas axonopodis pv. Citri (X. a. pv. Citri) causes citrus canker that can result in defoliation and premature fruit drop with significant production losses worldwide. Biofilm formation is an important process in bacterial pathogens and several lines of evidence suggest that in X. a. pv. Citri this process is a requirement to achieve maximal virulence since it has a major role in host interactions. In this study, proteomics was used to gain further insights into the functions of biofilms. Results: In order to identify differentially expressed proteins, a comparative proteomic study using 2D difference gel electrophoresis was carried out on X. a. pv. Citri mature biofilm and planktonic cells. The biofilm proteome showed major variations in the composition of outer membrane proteins and receptor or transport proteins. Among them, several porins and TonB-dependent receptor were differentially regulated in the biofilm compared to the planktonic cells, indicating that these proteins may serve in maintaining specific membrane-associated functions including signaling and cellular homeostasis. In biofilms, UDP-glucose dehydrogenase with a major role in exopolysaccharide production and the non-fimbrial adhesin YapH involved in adherence were over-expressed, while a polynucleotide phosphorylase that was demonstrated to negatively control biofilm formation in E. coli was down-regulated. In addition, several proteins involved in protein synthesis, folding and stabilization were up-regulated in biofilms. Interestingly, some proteins related to energy production, such as ATP-synthase were down-regulated in biofilms. Moreover, a number of enzymes of the tricarboxylic acid cycle were differentially expressed. In addition, X. a. pv. Citri biofilms also showed down-regulation of several antioxidant enzymes. The respective gene expression patterns of several identified proteins in both X. a. pv. Citri mature biofilm and planktonic cells were evaluated by
Directory of Open Access Journals (Sweden)
Sung Pae Chang
2016-08-01
Full Text Available Xanthomonas axonopodis pv. glycines (Xag is a necrotrophic bacterial pathogen of the soybean that causes bacterial pustules and is a nonhost pathogen of the chili pepper. In the current study, chili pepper fruit wound inoculated in planta with Xag 8ra formed necrotic lesions on the fruit surface and induced several structural and chemical barriers systemically in the fruit tissue. The initial defense response included programmed cell death of necrotizing and necrotized cells, which was characterized by nuclear DNA cleavage, as detected by TUNEL-confocal laser scanning microscopy (CLSM, and phosphatidylserine exposure on cell walls distal to the infection site, as detected by Annexin V FLUOS-CLSM. These two responses may facilitate cell killing and enhance transportation of cell wall materials used for cell wall thickening, respectively. The cells beneath the necrotic tissue were enlarged and divided to form periclinal cell walls, resulting in extensive formation of several parallel boundary layers at the later stages of infection, accompanying the deposition of wall fortification materials for strengthening structural defenses. These results suggest that nonhost resistance of chili pepper fruit against the nonhost necrotrophic pathogen Xag 8ra is activated systematically from the initial infection until termination of the infection cycle, resulting in complete inhibition of bacterial pathogenesis by utilizing organ-specific in situ physiological events governed by the expression of genes in the plant fruit organ.
Vernière, C J; Gottwald, T R; Pruvost, O
2003-07-01
ABSTRACT Experimental inoculations of Xanthomonas axonopodis pv. citri in different tissues of Tahiti lime and Pineapple sweet orange were conducted monthly under natural conditions on Réunion Island. The interactions between a set of environmental and epidemic variables associated with disease expression and 184 different factor combinations were investigated to determine the parameters needed to explain Asiatic citrus canker (ACC) disease expression. Area under the disease progress curve (AUDPC), inoculation date (Id), fruit and leaf age ratings (FAR and LAR), and number of days during the first 2 weeks postinoculation for which the temperature was less than 14 degrees C (T(min)) or more than 28 degrees C (T(max)) were retained by principal component analysis and canonical correlation analysis as the most meaningful epidemic and environmental variables, respectively. AUDPC as the strongest dependent variable and combinations of the environmental variables as independent variables were used in multiple regression analyses. Tissue age rating at the time of infection was a good predictor for disease resulting from spray inoculation on fruits and leaves and also on fruits following a wound inoculation. Temperature, as expressed by T(min) or T(max), was also a significant factor in determining disease development described by AUDPC. Mature green stems were highly susceptible after wounding, similarly to leaves, but buds and leaf scars expressed the lowest susceptibility. These variations in disease expression according to the tissues will have different impacts on ACC epidemiology.
Li, Wenbin; Brlansky, Ronald H; Hartung, John S
2006-05-01
Herbaria are important resources for the study of the origins and dispersal of plant pathogens, particularly bacterial plant pathogens that incite local lesions in which large numbers of pathogen genomes are concentrated. Xanthomonas axonopodis pv. citri (Xac), the causal agent of citrus bacterial canker disease, is a notable example of such a pathogen. The appearance of novel strains of the pathogen in Florida and elsewhere make it increasingly important to understand the relationships among strains of this pathogen. USDA-ARS at Beltsville, Maryland maintains approximately 700 herbarium specimens with citrus canker disease lesions up to 90 years old, originally collected from all over the world, and so is an important resource for phytogeographic studies of this bacterium. Unfortunately, DNA in herbarium specimens is degraded and may contain high levels of inhibitors of PCR. In this study, we compared a total of 23 DNA isolation techniques in combination with 31 novel primer pairs in order to develop an efficient protocol for the analysis of Xac DNA in herbarium specimens. We identified the most reliable extraction method, identified in terms of successful amplification by our panel of 31 primer pairs. We also identified the most robust primer pairs, identified as successful in the largest number of extracts prepared by different methods. We amplified Xac genomic sequences up to 542 bp long from herbarium samples up to 89 years old. Primers varied in effectiveness, with some primer pairs amplifying Xac DNA from a 1/10,000 dilution of extract from a single lesion from a citrus canker herbarium specimen. Our methodology will be useful to identify pathogens and perform molecular analyses of bacterial and possibly fungal genomes from herbarium specimens.
DEFF Research Database (Denmark)
Champion, Elise; Remaud-Simeon, Magali; Skov, Lars Kobberøe
2009-01-01
Glycoside hydrolase family 13 (GH-13) mainly contains starch-degrading or starch-modifying enzymes. Sucrose hydrolases utilize sucrose instead of amylose as the primary glucosyl donor. Here, the catalytic properties and X-ray structure of sucrose hydrolase from Xanthomonas campestris pv. campestris...... of GH-13. Comparisons with structures of the highly similar sucrose hydrolase from X. axonopodis pv. glycines most notably showed that residues Arg516 and Asp138, which form a salt bridge in the X. axonopodis sucrose complex and define part of the subsite -1 glucosyl-binding determinants...
La proteína PthB de Xanthomonas axonopodis pv. manihotis es autoactiva en ensayos de doble hibrido
Directory of Open Access Journals (Sweden)
Juliana Gil
2011-01-01
Full Text Available La bacteriosis vascular de yuca producida por la bacteria Xanthomonas axonopodis pv. manihotis (Xam es uno de los factores limitantes para la producción de yuca. Dentro de los primeros factores de patogenicidad identificados en esta bacteria se encuentra el gen pthB. La proteína PthB pertenece a la familia de efectores PthA/AvrBs3, que se caracterizan por presentar dominios NLS (Nuclear Localization Signal y un dominio AAD (Acidic Activation Domain, lo cual sugiere que estas proteínas actúan como factores de transcripción. La identificación de las proteínas de yuca que interactúan con PthB permitiría dar luces sobre la función de esta proteína en la patogenicidad de esta bacteria. En este trabajo se clonó pthB en una fusión traduccional con el BD (Binding Domain del factor de transcripción GAL4. Después de transformar este constructo en una cepa de levadura, se observó autoactivación de los genes reporteros, incluso a concentraciones altas de 3-AT. La eliminación del primer, segundo o de los dos NLS y del AAD no eliminaron la capacidad de autoactivación de los genes reporteros mediada por PthB. Estos resultados indican la imposibilidad de su utilización en un tamizaje de una librería de ADNc de yuca para identificar las proteínas que interactúan con PthB.
2008-01-01
pathogens also have been detected and identified by numerous nucleic acid-based techniques, including Southern blot hybridization and direct nucleotide...Xanthomonas axonopodis pv. vitians FB-1309; ATCC19320 Lettuce ; USA 1 Xanthomonas axonopodis sp. alfalfae XA129; Med. 2 Alfalfa; Sudan 1 Xanthomonas
Directory of Open Access Journals (Sweden)
Ottado Jorgelina
2010-03-01
Full Text Available Abstract Background Plant natriuretic peptides (PNPs belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival. Results Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 α subunit, maturase K, and α- and β-tubulin. Conclusions We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence.
Garavaglia, Betiana S; Thomas, Ludivine; Zimaro, Tamara; Gottig, Natalia; Daurelio, Lucas D; Ndimba, Bongani; Orellano, Elena G; Ottado, Jorgelina; Gehring, Christoph A
2010-01-01
Background: Plant natriuretic peptides (PNPs) belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP) uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival.Results: Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 ? subunit, maturase K, and ?- and ?-tubulin.Conclusions: We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence. 2010 Garavaglia et al; licensee BioMed Central Ltd.
Garavaglia, Betiana S
2010-03-21
Background: Plant natriuretic peptides (PNPs) belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP) uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival.Results: Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 ? subunit, maturase K, and ?- and ?-tubulin.Conclusions: We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence. 2010 Garavaglia et al; licensee BioMed Central Ltd.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 97 ... Query: 99 ... VARAMQYIDTHLYEPVSVAHLAQAACMSRFHFARVFRDAVGASPM...EYLRLRRLERAQAML 158 ... VARAMQYIDTHLYEPVSVAHLAQAACMSRFHFARVFRDAVGASPME...YLRLRRLERAQAML Sbjct: 1 ... VARAMQYIDTHLYEPVSVAHLAQAACMSRFHFARVFRDAVGASPMEYLRLRRLERAQAML 60 ...
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AC4077 ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 150 ... Query: 744 VRPVRPEDDA...LFRAFFARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARSIALVAIDPR 803 ... VRPVRPEDDALFRAF...FARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARSIALVAIDPR Sbjct: 1 ... VRPVRPEDDALFRAFFARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARS
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein ... B [Xanthomonas axonopodis pv. citri str. 306] ... Length = 101 ... Query: 9 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 68 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD Sbjct: 1 ... TSHRPYLLRALVEWINDNGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 60 ...
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein ... B [Xanthomonas axonopodis pv. citri str. 306] ... Length = 101 ... Query: 9 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 68 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD Sbjct: 1 ... TSHRPYLLRALVEWINDNGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 60 ...
Directory of Open Access Journals (Sweden)
Chang-Gi Back
2015-09-01
Full Text Available In this study, we developed a species-specific PCR assay for rapid and accurate detection of three Xanthomonas species, X. axonopodis pv. poinsettiicola (XAP, X. hyacinthi (XH and X. campestris pv. zantedeschiae (XCZ, based on their draft genome sequences. XAP, XH and XCZ genomes consist of single chromosomes that contain 5,221, 4,395 and 7,986 protein coding genes, respectively. Species-specific primers were designed from variable regions of the draft genome sequence data and assessed by a PCR-based detection method. These primers were also tested for specificity against 17 allied Xanthomonas species as well as against the host DNA and the microbial community of the host surface. Three primer sets were found to be very specific and no amplification product was obtained with the host DNA and the microbial community of the host surface. In addition, a detection limit of 1 pg/μl per PCR reaction was detected when these primer sets were used to amplify corresponding bacterial DNAs. Therefore, these primer sets and the developed species-specific PCR assay represent a valuable, sensitive, and rapid diagnostic tool that can be used to detect three specific pathogens at early stages of infection and may help control diseases.
Activity of Antarctic fungi extracts against phytopathogenic bacteria.
Purić, J; Vieira, G; Cavalca, L B; Sette, L D; Ferreira, H; Vieira, M L C; Sass, D C
2018-06-01
This study aims to obtain secondary metabolites extracts from filamentous fungi isolated from soil and marine sediments from Antarctic ecosystems and to assess its potential antibacterial activity on Xanthomonas euvesicatoria and Xanthomonas axonopodis pv. passiflorae (phytopathogenic bacteria causing diseases in pepper and tomato and passionfruit, respectively). Among the 66 crude intracellular and extracellular extracts obtained from fungi recovered from soil and 79 obtained from marine sediment samples, 25 showed the ability to prevent the growth of X. euvesicatoria in vitro and 28 showed the ability to prevent the growth of X. axonopodis pv. passiflorae in vitro. Intracellular and extracellular extracts from soil fungi inhibited around 97% of X. euvesicatoria and 98% of X. axonopodis pv. passiflorae at 2·1 mg ml -1 . The average inhibition rates against X. euvesicatoria and X. axonopodis pv. passiflorae for intracellular and extracellular extracts from marine sediments fungi were around 96 and 97%, respectively, at 3·0 mg ml -1 . Extracts containing secondary metabolites with antimicrobial activity against X. euvesicatoria and X. axonopodis pv. passiflorae were obtained, containing possible substitutes for the products currently used to control these phytopathogens. Micro-organisms from extreme ecosystems, such as the Antarctic ecosystem, need to survive in harsh conditions with low temperatures, low nutrients and high UV radiation. Micro-organisms adapt to these conditions evolving diverse biochemical and physiological adaptations essential for survival. All this makes these micro-organisms a rich source of novel natural products based on unique chemical scaffolds. Discovering novel bioactive compounds is essential because of the rise in antibiotic-resistant micro-organisms and the emergence of new infections. Fungi from Antarctic environments have been proven to produce bioactive secondary metabolites against various micro-organisms, but few studies
Investigation of a Quadruplex-Forming Repeat Sequence Highly Enriched in Xanthomonas and Nostoc sp.
Directory of Open Access Journals (Sweden)
Charlotte Rehm
Full Text Available In prokaryotes simple sequence repeats (SSRs with unit sizes of 1-5 nucleotides (nt are causative for phase and antigenic variation. Although an increased abundance of heptameric repeats was noticed in bacteria, reports about SSRs of 6-9 nt are rare. In particular G-rich repeat sequences with the propensity to fold into G-quadruplex (G4 structures have received little attention. In silico analysis of prokaryotic genomes show putative G4 forming sequences to be abundant. This report focuses on a surprisingly enriched G-rich repeat of the type GGGNATC in Xanthomonas and cyanobacteria such as Nostoc. We studied in detail the genomes of Xanthomonas campestris pv. campestris ATCC 33913 (Xcc, Xanthomonas axonopodis pv. citri str. 306 (Xac, and Nostoc sp. strain PCC7120 (Ana. In all three organisms repeats are spread all over the genome with an over-representation in non-coding regions. Extensive variation of the number of repetitive units was observed with repeat numbers ranging from two up to 26 units. However a clear preference for four units was detected. The strong bias for four units coincides with the requirement of four consecutive G-tracts for G4 formation. Evidence for G4 formation of the consensus repeat sequences was found in biophysical studies utilizing CD spectroscopy. The G-rich repeats are preferably located between aligned open reading frames (ORFs and are under-represented in coding regions or between divergent ORFs. The G-rich repeats are preferentially located within a distance of 50 bp upstream of an ORF on the anti-sense strand or within 50 bp from the stop codon on the sense strand. Analysis of whole transcriptome sequence data showed that the majority of repeat sequences are transcribed. The genetic loci in the vicinity of repeat regions show increased genomic stability. In conclusion, we introduce and characterize a special class of highly abundant and wide-spread quadruplex-forming repeat sequences in bacteria.
Investigation of a Quadruplex-Forming Repeat Sequence Highly Enriched in Xanthomonas and Nostoc sp.
Rehm, Charlotte; Wurmthaler, Lena A; Li, Yuanhao; Frickey, Tancred; Hartig, Jörg S
2015-01-01
In prokaryotes simple sequence repeats (SSRs) with unit sizes of 1-5 nucleotides (nt) are causative for phase and antigenic variation. Although an increased abundance of heptameric repeats was noticed in bacteria, reports about SSRs of 6-9 nt are rare. In particular G-rich repeat sequences with the propensity to fold into G-quadruplex (G4) structures have received little attention. In silico analysis of prokaryotic genomes show putative G4 forming sequences to be abundant. This report focuses on a surprisingly enriched G-rich repeat of the type GGGNATC in Xanthomonas and cyanobacteria such as Nostoc. We studied in detail the genomes of Xanthomonas campestris pv. campestris ATCC 33913 (Xcc), Xanthomonas axonopodis pv. citri str. 306 (Xac), and Nostoc sp. strain PCC7120 (Ana). In all three organisms repeats are spread all over the genome with an over-representation in non-coding regions. Extensive variation of the number of repetitive units was observed with repeat numbers ranging from two up to 26 units. However a clear preference for four units was detected. The strong bias for four units coincides with the requirement of four consecutive G-tracts for G4 formation. Evidence for G4 formation of the consensus repeat sequences was found in biophysical studies utilizing CD spectroscopy. The G-rich repeats are preferably located between aligned open reading frames (ORFs) and are under-represented in coding regions or between divergent ORFs. The G-rich repeats are preferentially located within a distance of 50 bp upstream of an ORF on the anti-sense strand or within 50 bp from the stop codon on the sense strand. Analysis of whole transcriptome sequence data showed that the majority of repeat sequences are transcribed. The genetic loci in the vicinity of repeat regions show increased genomic stability. In conclusion, we introduce and characterize a special class of highly abundant and wide-spread quadruplex-forming repeat sequences in bacteria.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ter ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 125 ... Query: 66 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 125 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG Sbjct: 1 ... ELTVGDVMISRSQMVSLPVEARFIDLMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 60 ... Query: 186 EQIVG 190 ... EQIVG Sbjct: 121 EQIVG 125
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ter ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 125 ... Query: 72 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 131 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG Sbjct: 1 ... ELTVGDVMISRSQMVSLPVEARFIDLMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 60 ... Query: 192 EQIVG 196 ... EQIVG Sbjct: 121 EQIVG 125
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr
Genomes-based phylogeny of the genus Xanthomonas
Directory of Open Access Journals (Sweden)
Rodriguez-R Luis M
2012-03-01
Full Text Available Abstract Background The genus Xanthomonas comprises several plant pathogenic bacteria affecting a wide range of hosts. Despite the economic, industrial and biological importance of Xanthomonas, the classification and phylogenetic relationships within the genus are still under active debate. Some of the relationships between pathovars and species have not been thoroughly clarified, with old pathovars becoming new species. A change in the genus name has been recently suggested for Xanthomonas albilineans, an early branching species currently located in this genus, but a thorough phylogenomic reconstruction would aid in solving these and other discrepancies in this genus. Results Here we report the results of the genome-wide analysis of DNA sequences from 989 orthologous groups from 17 Xanthomonas spp. genomes available to date, representing all major lineages within the genus. The phylogenetic and computational analyses used in this study have been automated in a Perl package designated Unus, which provides a framework for phylogenomic analyses which can be applied to other datasets at the genomic level. Unus can also be easily incorporated into other phylogenomic pipelines. Conclusions Our phylogeny agrees with previous phylogenetic topologies on the genus, but revealed that the genomes of Xanthomonas citri and Xanthomonas fuscans belong to the same species, and that of Xanthomonas albilineans is basal to the joint clade of Xanthomonas and Xylella fastidiosa. Genome reduction was identified in the species Xanthomonas vasicola in addition to the previously identified reduction in Xanthomonas albilineans. Lateral gene transfer was also observed in two gene clusters.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...
ORF Alignment: NC_003921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance
ORF Alignment: NC_003921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance
NCBI nr-aa BLAST: CBRC-TNIG-22-0185 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0185 ref|NP_642362.1| putative manganese transport protein MntH [Xanth...omonas axonopodis pv. citri str. 306] sp|Q8PKX1|MNTH_XANAC Probable manganese transport protein mntH gb|AAM36898.1| manga
Directory of Open Access Journals (Sweden)
Fabiano Tófoli de Araújo
Full Text Available BACKGROUND: The uptake of sulphur-containing compounds plays a pivotal role in the physiology of bacteria that live in aerobic soils where organosulfur compounds such as sulphonates and sulphate esters represent more than 95% of the available sulphur. Until now, no information has been available on the uptake of sulphonates by bacterial plant pathogens, particularly those of the Xanthomonas genus, which encompasses several pathogenic species. In the present study, we characterised the alkanesulphonate uptake system (Ssu of Xanthomonas axonopodis pv. citri 306 strain (X. citri, the etiological agent of citrus canker. METHODOLOGY/PRINCIPAL FINDINGS: A single operon-like gene cluster (ssuEDACB that encodes both the sulphur uptake system and enzymes involved in desulphurisation was detected in the genomes of X. citri and of the closely related species. We characterised X. citri SsuA protein, a periplasmic alkanesulphonate-binding protein that, together with SsuC and SsuB, defines the alkanesulphonate uptake system. The crystal structure of SsuA bound to MOPS, MES and HEPES, which is herein described for the first time, provides evidence for the importance of a conserved dipole in sulphate group coordination, identifies specific amino acids interacting with the sulphate group and shows the presence of a rather large binding pocket that explains the rather wide range of molecules recognised by the protein. Isolation of an isogenic ssuA-knockout derivative of the X. citri 306 strain showed that disruption of alkanesulphonate uptake affects both xanthan gum production and generation of canker lesions in sweet orange leaves. CONCLUSIONS/SIGNIFICANCE: The present study unravels unique structural and functional features of the X. citri SsuA protein and provides the first experimental evidence that an ABC uptake system affects the virulence of this phytopathogen.
Directory of Open Access Journals (Sweden)
Denilson de Jesus Assis
2014-01-01
Full Text Available Um destino para resíduos agro-industriais é usá-los como substratos fermentescíveis, diminuindo o custo na produção de produtos com alto valor agregado. Este trabalho avaliou a influência da natureza dos resíduos fermentescíveis e das cepas de Xanthomonas sobre a produção e propriedades do biopolímero resultante. A produção foi realizada em agitador orbital (250 rpm / 28 °C / 120 h por fermentação de sacarose (controle, glicerina residual do biodiesel e resíduo líquido de sisal. Tanto a composição do substrato como as cepas mostraram um forte efeito sobre a produção (0,36-2,40 gL- 1, viscosidade aparente (13,73 para 36,31 mPa.s e massa molecular (2,1-5,9 × 10(6 Da da goma de xantana resultante, não influenciando o comportamento pseudoplástico de soluções aquosas dos biopolímeros.
Improvement of common bacterial blight resistance in South African ...
African Journals Online (AJOL)
Common bacterial blight (CBB) caused by Xanthomonas axonopodis pv. phaseoli is an important seed-borne disease of dry beans in South Africa. Development of resistant cultivars is considered the best control measurement for the disease. Backcross breeding was used to improve BB resistance in the small white ...
2485-IJBCS-Article-Dr Zinsou Valerien
African Journals Online (AJOL)
hp
Thowthampitak J. 2008. RpfF gene of. Xanthomonas axonopodis pv. glycines involved in the regulation of virulence factor production and epiphytic fitness of bacterial pustule pathogen on soybean leaves. PhD thesis, Kasetsart. University, p. 139. Wrather JA, Sleper DA, Stevens WE,. Shannon JG, Wilson RF. 2003. Planting.
Epiphytic bacteria from various bean genotypes and their potential ...
African Journals Online (AJOL)
Naturally occurring epiphytic non-pathogeni bacteria were isolated from reproductive tissue of various bean genotypes grown in the field and screened for both in vitro and in vivo antagonism to Xanthomonas axonopodis pv. phaseoli (formely X. campestris pv phaseoli). Of the 22 potential bacterial antagonists screened in ...
Procedimientos para detectar y medir el sesgo entre observadores
Benavente, Ana; Alto, Manuel; López, Juan José
2006-01-01
En este trabajo se realiza un análisis de los distintos métodos para detectar y medir el sesgo entre observadores desde dos perspectivas básicas: el enfoque clásico, fundamentado en índices descriptivos y el enfoque del modelado, fundamentado en modelos loglineales. Se demuestra que estas medidas no son satisfactorias para detectar y medir el sesgo de forma unívoca porque presentan resultados contradictorios y se proponen nuevas alternativas a desarrollar que permitan descomponer correctament...
Directory of Open Access Journals (Sweden)
Quezado-Duval Alice Maria
2003-01-01
Full Text Available Apesar de amplamente empregados em lavouras de tomate para processamento industrial no Brasil, fungicidas cúpricos e antibióticos registrados para uso agrícola nem sempre resultam em controle eficiente das bacterioses que afetam a cultura. O aparecimento de estirpes resistentes é uma das causas dessa baixa eficiência. Avaliou-se, in vitro, a sensibilidade a cobre, estreptomicina e oxitetraciclina de 389 isolados de Xanthomonas spp. associadas à mancha-bacteriana do tomateiro, sendo 92 de X. axonopodis pv. vesicatoria (60 do grupo "A"/raça T1 e 32 do "C"/raça T3, 93 de X. vesicatoria (grupo "B"/raça T2 e 204 de X. gardneri (grupo "D"/raça T2. Os isolados foram obtidos de plantas doentes em campos comerciais de tomate para processamento industrial nos estados de Goiás, Minas Gerais, Pernambuco e Bahia, nos anos de 1995 a 1998 e em 2000. Alíquotas de 5 ml de suspensões bacterianas foram depositadas em meio Nutriente-Ágar suplementado com sulfato de cobre, nas concentrações de 50 e 200 µg/ml; sulfato de estreptomicina, a 25 e 200 µg/ml e cloridrato de oxitetraciclina, a 25 µg/ml. Nenhum isolado foi resistente a oxitetraciclina, como também nenhum foi resistente ao cobre na concentração de 200 µg/ml do sulfato de cobre. No entanto, houve diferença entre isolados quanto à sensibilidade ao sulfato de cobre na concentração de 50 µg/ml e ao sulfato de estreptomicina nas duas concentrações empregadas. As freqüências de isolados de X. gardneri, X. axonopodis pv. vesicatoria (grupos "A" e "C" e X. vesicatoria resistentes à estreptomicina (25 µg/ml do produto usado foram, respectivamente, 98%, 38% e 2%, ao passo que, ao cobre, foram, respectivamente, 48%, 4% e 74%. Todos os isolados do grupo "C" foram sensíveis à estreptomicina e 97% sensíveis ao cobre.
African Journals Online (AJOL)
eobe
Xanthan gum is a major biopolymer which finds a lot of applications industrially and domestically. ... gum was produced from pineapple peels using Xanthomonas campestris by ... producing microorganism is strongly influenced by the medium.
Modelos de Requisitos Basados en I* para Detectar Proactividad en Dashboards
Directory of Open Access Journals (Sweden)
Alain Pérez-Acosta
2014-06-01
Full Text Available El objetivo del trabajo es presentar modelos para la captura de los requisitos de un dashboard para detectar un comportamiento proactivo. Estos modelos siguen un enfoque orientado hacia metas y fueron creados con el marco de trabajo i*, que toma como base las premisas del modelado social. Para detectar el comportamiento proactivo se usaron patrones basados en modelos de i* para detectar proactividad en la etapa de requisitos de un sistema de software. Los modelos que se obtienen como resultado del trabajo tienen representados los actores, metas, intenciones, tareas y recursos que se necesitan para modelar los requisitos de un dashboard con un comportamiento proactivo y pueden, además, ser utilizados en distintos contextos de negocio.
Occurrence and Characterisation of Xanthomonas axonopodis pv ...
African Journals Online (AJOL)
Soybean bacterial pustule disease was studied during the flowering and at pod maturation, in thirty four sites of the main soybean cultivation areas in eight districts of the Guinea Savanna in Benin. Twenty and 10 soybean plants were randomly inspected for incidence and severity, respectively, on two diagonals through the ...
Xanthomonas euvesicatoria Causes Bacterial Spot Disease on Pepper Plant in Korea
Directory of Open Access Journals (Sweden)
Min-Seong Kyeon
2016-10-01
Full Text Available In 2004, bacterial spot-causing xanthomonads (BSX were reclassified into 4 species—Xanthomonas euvesicatoria, X. vesicatoria, X. perforans, and X. gardneri. Bacterial spot disease on pepper plant in Korea is known to be caused by both X. axonopodis pv. vesicatoria and X. vesicatoria. Here, we reidentified the pathogen causing bacterial spots on pepper plant based on the new classification. Accordingly, 72 pathogenic isolates were obtained from the lesions on pepper plants at 42 different locations. All isolates were negative for pectolytic activity. Five isolates were positive for amylolytic activity. All of the Korean pepper isolates had a 32 kDa-protein unique to X. euvesicatoria and had the same band pattern of the rpoB gene as that of X. euvesicatoria and X. perforans as indicated by PCR-restriction fragment length polymorphism analysis. A phylogenetic tree of 16S rDNA sequences showed that all of the Korean pepper plant isolates fit into the same group as did all the reference strains of X. euvesicatoria and X. perforans. A phylogenetic tree of the nucleotide sequences of 3 housekeeping genes—gapA, gyrB, and lepA showed that all of the Korean pepper plant isolates fit into the same group as did all of the references strains of X. euvesicatoria. Based on the phenotypic and genotypic characteristics, we identified the pathogen as X. euvesicatoria. Neither X. vesicatoria, the known pathogen of pepper bacterial spot, nor X. perforans, the known pathogen of tomato plant, was isolated. Thus, we suggest that the pathogen causing bacterial spot disease of pepper plants in Korea is X. euvesicatoria.
Physiological effect of the toxin from Xanthomonas retroflexus on ...
African Journals Online (AJOL)
Physiological effect of the toxin from Xanthomonas retroflexus on redroot pigweed (Amaranthus retroflexus). Z Sun, M Li, J Chen, Y Li. Abstract. A new toxin from Xanthomonas retroflexus could cause a series of physiological responses on seedlings of redroot pigweed. The experimental results revealed that respiratory ratio ...
Biochemical and molecular tools reveal two diverse Xanthomonas groups in bananas
DEFF Research Database (Denmark)
Adriko, John; Aritua, V.; Mortensen, Carmen Nieves
2016-01-01
Xanthomonas campestris pv. musacearum (Xcm) causing the banana Xanthomonas wilt (BXW) disease has been the main xanthomonad associated with bananas in East and Central Africa based on phenotypic and biochemical characteristics. However, biochemical methods cannot effectively distinguish between...... pathogenic and non-pathogenic xanthomonads. In this study, gram-negative and yellow-pigmented mucoid bacteria were isolated from BXW symptomatic and symptomless bananas collected from different parts of Uganda. Biolog, Xcm-specific (GspDm), Xanthomonas vasicola species-specific (NZ085) and Xanthomonas genus......-specific (X1623) primers in PCR, and sequencing of ITS region were used to identify and characterize the isolates. Biolog tests revealed several isolates as xanthomonads. The GspDm and NZ085 primers accurately identified three isolates from diseased bananas as Xcm and these were pathogenic when re...
Wagacha, John M.; Dossaji, Saifuddin F.
2016-01-01
The objective of this study was to determine the chemical composition and antibacterial activity of essential oils (EOs) of Tagetes minuta against three phytopathogenic bacteria Pseudomonas savastanoi pv. phaseolicola, Xanthomonas axonopodis pv. phaseoli, and Xanthomonas axonopodis pv. manihotis. The essential oils were extracted using steam distillation method in a modified Clevenger-type apparatus while antibacterial activity of the EOs was evaluated by disc diffusion method. Gas chromatography coupled to mass spectrometry (GC/MS) was used for analysis of the chemical profile of the EOs. Twenty compounds corresponding to 96% of the total essential oils were identified with 70% and 30% of the identified components being monoterpenes and sesquiterpenes, respectively. The essential oils of T. minuta revealed promising antibacterial activities against the test pathogens with Pseudomonas savastanoi pv. phaseolicola being the most susceptible with mean inhibition zone diameters of 41.83 and 44.83 mm after 24 and 48 hours, respectively. The minimum inhibitory concentrations and minimum bactericidal concentrations of the EOs on the test bacteria were in the ranges of 24–48 mg/mL and 95–190 mg/mL, respectively. These findings provide a scientific basis for the use of T. minuta essential oils as a botanical pesticide for management of phytopathogenic bacteria. PMID:27721831
Directory of Open Access Journals (Sweden)
Marco Scortichini
2010-11-01
Full Text Available Forty-five Xanthomonas arboricola pv. juglandis (Xaj strains originating from Juglans regia cultivation in different countries were molecularly typed by means of MultiLocus Sequence Typing (MLST, using acnB, gapA, gyrB and rpoD gene fragments. A total of 2.5 kilobases was used to infer the phylogenetic relationship among the strains and possible recombination events. Haplotype diversity, linkage disequilibrium analysis, selection tests, gene flow estimates and codon adaptation index were also assessed. The dendrograms built by maximum likelihood with concatenated nucleotide and amino acid sequences revealed two major and two minor phylotypes. The same haplotype was found in strains originating from different continents, and different haplotypes were found in strains isolated in the same year from the same location. A recombination breakpoint was detected within the rpoD gene fragment. At the pathovar level, the Xaj populations studied here are clonal and under neutral selection. However, four Xaj strains isolated from walnut fruits with apical necrosis are under diversifying selection, suggesting a possible new adaptation. Gene flow estimates do not support the hypothesis of geographic isolation of the strains, even though the genetic diversity between the strains increases as the geographic distance between them increases. A triplet deletion, causing the absence of valine, was found in the rpoD fragment of all 45 Xaj strains when compared with X. axonopodis pv. citri strain 306. The codon adaptation index was high in all four genes studied, indicating a relevant metabolic activity.
Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop
2015-01-01
Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048
Insights into xanthomonas axonopodis pv. Citri biofilm through proteomics
Zimaro, Tamara; Thomas, Ludivine; Marondedze, Claudius; Garavaglia, Betiana S; Gehring, Christoph A; Ottado, Jorgelina; Gottig, Natalia
2013-01-01
in adherence were over-expressed, while a polynucleotide phosphorylase that was demonstrated to negatively control biofilm formation in E. coli was down-regulated. In addition, several proteins involved in protein synthesis, folding and stabilization were up
DNA polymorphism analysis of Xanthomonas campestris pv ...
African Journals Online (AJOL)
strand conformation polymorphism (SSCP) techniques using M13 and 16S rRNA primers, respectively, for genotyping of the phytopathogenic bacterium Xanthomonas campestris pv. campestris was studied. RAPD provided a simple, rapid, and ...
International Nuclear Information System (INIS)
Islam, R.; Ahmed, J.; Al-Reza, S. M.; Rahman, M. M.; Nyme, Z.; Lisa, L. A.; Yousaf, M.; Alam, M. N.
2015-01-01
In this study, we characterized some Xanthomonas sp. from rice rhizosphere soil by 16S rDNA sequence analysis and the potentiality tested of oil and extracts of Clerodendrum viscosum Vent. leaves against those isolated bacteria. The essential oil compositions were evaluated by GC-MS analysis and identified twenty four compounds as 94.37% of the total essential oil, where cyclohepta-1,3,5,-triene (16.07%), 2H-1,4-pyridoxazin-3(4H)-one (12.27%), L-carvenol (8.04%), p-cymene (9.15%), alpha-terpineol (7.98%), beta-sitosterol (6.76%), tyranton (6.42%), mesityl oxide (6.34%), gamma-terpinene (5.42%) and beta-linalool (3.74%) were the major constituents. According to the 16S rDNA sequences analysis, Hb28 and Xb43 isolates have shown the 100% similarity for Xanthomonas retroflexus and Xanthomonas theicola. In addition, isolates Ha18, Xb33 and Jb30 also have shown the maximum similarity of 98% for Xanthomonas sp. TB8-9-II, Xanthomonas campestris and Xanthomonas sp. BBCT38. Furthermore, in vitro studies showed that the oil have the inhibitory effect on Xanthomonas sp. TB8-9-II, X. campestris, X. retroflexus, Xanthomonas sp. BBCT38, and X. theicola, where the zone of inhibition and MIC values were 18.8 to 25.9 mm and 62.5 to 125 meu g ml/sup -1/, respectively. However, organic extracts showed the zone of inhibition and MIC values were 13.4 to 22.9 and 62.5 to 500 meu g ml-1, respectively. Our findings suggested that the essential oil and extracts of C. viscosum Vent. leaves might be the effective source to control Xanthomonas sp. biologically. (author)
EFEITO ANTIBIÓTICO DO PRÓPOLIS SOBRE BACTÉRIAS FITOPATOGÊNICAS
BIANCHINI, L.; BEDENDO, I.P.
1998-01-01
O efeito antibiótico de extrato aquoso de própolis, em várias concentrações, foi avaliado para cinco espécies de bactérias fitopatogênicas. Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis e Xanthomonas axonopodis pv. phaseoli foram completamente inibidas em meio de cultura contendo 10% de extrato de própolis. Erwinia chrysanthemi foi parcialmente inibida, enquanto Pseudomonas syringae pv. tabaci se mostrou insensível ao extrato, desenvolvendo colônias idênticas àquel...
Identification and characterisation of Xanthomonas campestris pv
African Journals Online (AJOL)
Ednar Wulff
2013-02-06
Feb 6, 2013 ... strains as Xanthomonas, but only 32 as Xcc. PCR tests with primers targeting a fragment of the hrpF ... Cabbage heads affected by Xcc loose market ..... veins near the leaf margins using a mouse tooth forceps with teeth.
Polymerase chain reaction (PCR) is particularly useful for plant pathogen detection. In the present study, multiplex PCR and SYBR green real-time PCR were developed to facilitate simultaneous detection of three important rice pathogens, Xanthomonas oryzae pv. oryzae, X. oryzae pv. oryzicola, and Bur...
Xanthan gum production by Xanthomonas campestris pv ...
African Journals Online (AJOL)
Cassava starch is a main renewable bio-resource with low price and mass production in Guangxi, China. It was used as carbon source in growing Xanthomonas campestris pv. campestris 8004 (Xcc 8004) for xanthan gum production in this study. The xanthan gum yield of gelatinized cassava starch was higher than that of ...
La metacognición como estrategia para detectar procesos cognitivos en niños con retraso mental
Vázquez, Ana; Suzanne, León; Rodríguez, María
2006-01-01
Este artículo se basa en una investigación tendiente a detectar los procesos cognitivos que empleaban los niños con retraso mental en la resolución de situaciones matemáticas, mediante el uso de estrategias metacognitivas. Se trabajó con una muestra de veinte niños con retraso mental que asisten a aulas integradas, de las provincias de Heredia y Alajuela. Se elaboró la Batería de Resolución de Situaciones matemáticas (BARSIMAR) para detectar los procesos cognitivos que empleaban los niños ant...
Meningitis due to Xanthomonas maltophilia.
Directory of Open Access Journals (Sweden)
Girijaratnakumari T
1993-07-01
Full Text Available During 1st week of post-operative period, a 28 year old female patient operated for left cerebellopontine angle tumor, continued to get fever. Lumbar puncture did not reveal any organisms. She responded to ciprofloxacin. Two months later, she was readmitted with signs and symptoms of meningitis. The CSF tapped on lumbar puncture grew Xanthomonas maltophilia, Gram negative bacilli, sensitive to various antibiotics, ciprofloxacin being one of them. The patient was given ciprofloxacin for 3 weeks. On follow up, a year later she was found to be asymptomatic.
Slaat Xanthomonas dit jaar weer toe in Prunus laurocerasus
Doorn, van J.; Dalfsen, van P.; Pham, K.T.K.
2012-01-01
Een diagnostische test moet duidelijk maken of er sprake is van Xanthomonas in Prunus laurocerasus. De bacterieziekte is namelijk makkelijk te verwarren met andere ziekten. Onderzoek, gefinancierd door het Productschap Tuinbouw, richt zich op het toetsen van moerplanten voordat hier van gestekt gaat
Natural occurrence and pathogenicity of Xanthomonas bacteria on ...
African Journals Online (AJOL)
The objectives of this study were to verify the presence of Xanthomonas bacteria on plants growing in and around enset gardens in South and Southwest Ethiopia, and to elucidate the pathogenicity of Xcm strains to cultivated and wild plants. Several economical and ornamental plants were assessed for wilting in South and ...
Xanthomonas citri pv. citri pathotypes
DEFF Research Database (Denmark)
Di Lorenzo, Flaviana; Silipo, Alba; Gersby, Lotte Bettina Andersen
2017-01-01
Xanthomonas citri pv. citri is the pathogen responsible for Asiatic citrus canker, one of the most serious citrus diseases worldwide. The lipopolysaccharide (LPS) molecule has been demonstrated to be involved in X. citri pv. citri virulence. Despite enormous progress in investigations of the mole...
Huang, Chao-Li; Pu, Pei-Hua; Huang, Hao-Jen; Sung, Huang-Mo; Liaw, Hung-Jiun; Chen, Yi-Min; Chen, Chien-Ming; Huang, Ming-Ban; Osada, Naoki; Gojobori, Takashi; Pai, Tun-Wen; Chen, Yu-Tin; Hwang, Chi-Chuan; Chiang, Tzen-Yuh
2015-01-01
Background: Comparative genomics provides insights into the diversification of bacterial species. Bacterial speciation usually takes place with lasting homologous recombination, which not only acts as a cohering force between diverging lineages but brings advantageous alleles favored by natural selection, and results in ecologically distinct species, e.g., frequent host shift in Xanthomonas pathogenic to various plants. Results: Using whole-genome sequences, we examined the genetic divergence in Xanthomonas campestris that infected Brassicaceae, and X. citri, pathogenic to a wider host range. Genetic differentiation between two incipient races of X. citri pv. mangiferaeindicae was attributable to a DNA fragment introduced by phages. In contrast to most portions of the genome that had nearly equivalent levels of genetic divergence between subspecies as a result of the accumulation of point mutations, 10% of the core genome involving with homologous recombination contributed to the diversification in Xanthomonas, as revealed by the correlation between homologous recombination and genomic divergence. Interestingly, 179 genes were under positive selection; 98 (54.7%) of these genes were involved in homologous recombination, indicating that foreign genetic fragments may have caused the adaptive diversification, especially in lineages with nutritional transitions. Homologous recombination may have provided genetic materials for the natural selection, and host shifts likely triggered ecological adaptation in Xanthomonas. To a certain extent, we observed positive selection nevertheless contributed to ecological divergence beyond host shifting. Conclusion: Altogether, mediated with lasting gene flow, species formation in Xanthomonas was likely governed by natural selection that played a key role in helping the deviating populations to explore novel niches (hosts) or respond to environmental cues, subsequently triggering species diversification. © Huang et al.
Huang, Chao-Li
2015-03-15
Background: Comparative genomics provides insights into the diversification of bacterial species. Bacterial speciation usually takes place with lasting homologous recombination, which not only acts as a cohering force between diverging lineages but brings advantageous alleles favored by natural selection, and results in ecologically distinct species, e.g., frequent host shift in Xanthomonas pathogenic to various plants. Results: Using whole-genome sequences, we examined the genetic divergence in Xanthomonas campestris that infected Brassicaceae, and X. citri, pathogenic to a wider host range. Genetic differentiation between two incipient races of X. citri pv. mangiferaeindicae was attributable to a DNA fragment introduced by phages. In contrast to most portions of the genome that had nearly equivalent levels of genetic divergence between subspecies as a result of the accumulation of point mutations, 10% of the core genome involving with homologous recombination contributed to the diversification in Xanthomonas, as revealed by the correlation between homologous recombination and genomic divergence. Interestingly, 179 genes were under positive selection; 98 (54.7%) of these genes were involved in homologous recombination, indicating that foreign genetic fragments may have caused the adaptive diversification, especially in lineages with nutritional transitions. Homologous recombination may have provided genetic materials for the natural selection, and host shifts likely triggered ecological adaptation in Xanthomonas. To a certain extent, we observed positive selection nevertheless contributed to ecological divergence beyond host shifting. Conclusion: Altogether, mediated with lasting gene flow, species formation in Xanthomonas was likely governed by natural selection that played a key role in helping the deviating populations to explore novel niches (hosts) or respond to environmental cues, subsequently triggering species diversification. © Huang et al.
Proposal of Xanthomonas translucens pv. pistaciae pv. nov., pathogenic to pistachio (Pistacia vera).
Giblot-Ducray, Danièle; Marefat, Alireza; Gillings, Michael R; Parkinson, Neil M; Bowman, John P; Ophel-Keller, Kathy; Taylor, Cathy; Facelli, Evelina; Scott, Eileen S
2009-12-01
Strains of Xanthomonas translucens have caused dieback in the Australian pistachio industry for the last 15 years. Such pathogenicity to a dicotyledonous woody host contrasts with that of other pathovars of X. translucens, which are characterized by their pathogenicity to monocotyledonous plant families. Further investigations, using DNA-DNA hybridization, gyrB gene sequencing and integron screening, were conducted to confirm the taxonomic status of the X. translucens pathogenic to pistachio. DNA-DNA hybridization provided a clear classification, at the species level, of the pistachio pathogen as a X. translucens. In the gyrB-based phylogeny, strains of the pistachio pathogen clustered among the X. translucens pathovars as two distinct lineages. Integron screening revealed that the cassette arrays of strains of the pistachio pathogen were different from those of other Xanthomonas species, and again distinguished two groups. Together with previously reported pathogenicity data, these results confirm that the pistachio pathogen is a new pathovar of X. translucens and allow hypotheses about its origin. The proposed name is Xanthomonas translucens pv. pistaciae pv. nov.
Banana Xanthomonas wilt in Ethiopia: Occurrence and insect vector ...
African Journals Online (AJOL)
Bacterial wilt caused by Xanthomonas vasicola pv. musacearum (Xvm) is an important disease of enset and banana in south and south-western Ethiopia where, the diversity of the insect fauna on banana inflorescences was unknown and the role of insects as vectors of the disease had not been studied. The objectives of ...
EFEITO ANTIBIÓTICO DO PRÓPOLIS SOBRE BACTÉRIAS FITOPATOGÊNICAS
Directory of Open Access Journals (Sweden)
L. BIANCHINI
1998-01-01
Full Text Available O efeito antibiótico de extrato aquoso de própolis, em várias concentrações, foi avaliado para cinco espécies de bactérias fitopatogênicas. Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis e Xanthomonas axonopodis pv. phaseoli foram completamente inibidas em meio de cultura contendo 10% de extrato de própolis. Erwinia chrysanthemi foi parcialmente inibida, enquanto Pseudomonas syringae pv. tabaci se mostrou insensível ao extrato, desenvolvendo colônias idênticas àquelas observadas em meios livres de própolis. Concentrações menores não foram suficientes para exercer um efeito antimicrobiano desejável sobre as bactérias pertencentes a todas as espécies testadas. Resultados idênticos foram obtidos quando própolis foi incorporado ao meio antes ou após a autoclavagem, demonstrando que a substância ativa presente no extrato não é termosensível. Foi demonstrado, portanto, o uso potencial do própolis como antibiótico para o controle de bactérias fitopatogênicas.The antibiotic effect of aqueous extract of propolis was evaluated in vitro against five species of bacteria. The growth of Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis and Xanthomonas axonopodis pv. phaseoli was completely inhibited in a medium containing 10% of propolis. Erwinia chrysanthemi was partially inhibited and Pseudomonas syringae pv. tabaci was not affected. Lower concentration of the aqueous extract was not effective to promote a desirable antibiotic action against all bacterial species tested. The active ingredient present in the propolis was thermostable. The potential use of the propolis to control phytopathogenic bacteria was demonstrated.
DEFF Research Database (Denmark)
Mbega, Ernest Rashid; Wulff, Ednar Gadelha; Mabagala, R.B.
2012-01-01
of Xanthomonas campestris pv. malvacearum, were pathogenic on tomato and pepper plants. Strains identified by Biolog as Sphingomonas sanguinis and Sphingomonas terrae also incited black rot symptoms on pepper leaves. However, bacterial strains belonging to the genus Stenotrophomonas, Chryseobacterium, Pantoea...... and Flavobacterium were not pathogenic on tomato and pepper. Phylogenetic analysis showed that strains of the genus Xanthomonas are more closely related to Stenotrophomonas and Pantoea compared to the other bacterial genera found in tomato seeds....
Advanced Copper Composites Against Copper-Tolerant Xanthomonas perforans and Tomato Bacterial Spot.
Strayer-Scherer, A; Liao, Y Y; Young, M; Ritchie, L; Vallad, G E; Santra, S; Freeman, J H; Clark, D; Jones, J B; Paret, M L
2018-02-01
Bacterial spot, caused by Xanthomonas spp., is a widespread and damaging bacterial disease of tomato (Solanum lycopersicum). For disease management, growers rely on copper bactericides, which are often ineffective due to the presence of copper-tolerant Xanthomonas strains. This study evaluated the antibacterial activity of the new copper composites core-shell copper (CS-Cu), multivalent copper (MV-Cu), and fixed quaternary ammonium copper (FQ-Cu) as potential alternatives to commercially available micron-sized copper bactericides for controlling copper-tolerant Xanthomonas perforans. In vitro, metallic copper from CS-Cu and FQ-Cu at 100 μg/ml killed the copper-tolerant X. perforans strain within 1 h of exposure. In contrast, none of the micron-sized copper rates (100 to 1,000 μg/ml) from Kocide 3000 significantly reduced copper-tolerant X. perforans populations after 48 h of exposure compared with the water control (P copper-based treatments killed the copper-sensitive X. perforans strain within 1 h. Greenhouse studies demonstrated that all copper composites significantly reduced bacterial spot disease severity when compared with copper-mancozeb and water controls (P copper composites significantly reduced disease severity when compared with water controls, using 80% less metallic copper in comparison with copper-mancozeb in field studies (P copper composites have the potential to manage copper-tolerant X. perforans and tomato bacterial spot.
Formulasi Bakteri Endofit Akar Kedelai untuk Pengendalian Pustul Bakteri
Directory of Open Access Journals (Sweden)
Trimurti Habazar
2015-04-01
Full Text Available Two isolates of bacterial endophyte from soybean root were found to be effective to control bacterial pustule caused by Xanthomonas axonopodis pv. glycines. Formulation of the bacterial isolates is required to maintain the effectivity of this bacterial isolates during storage, transportation and application. The aim of this research was to obtain the best carrier for formulation to maintain the effectivity of bacterial endophyte in storage to control bacterial pustule on soybean. Three kind of carrier agent was evaluated for formulation of bacterial endophyte i.e. peat soil, tapioca flour and coconut water + 1% palm oil. Each carrier agent was combined with 5 treatment of storage time i.e. 0, 1, 3, 5 and 7 weeks. Soybean plants was inoculated by. X. axonopodis pv. glycines 2 weeks after planting by rubbing bacterial suspension (106 cel mL-1 on lower surface of leaves. The results showed that all formulas of bacterial endophyte were able to suppress the bacterial pustule on soybean. The best formulations were bacterial endophyte in peat soil stored for 1 and 7 weeks (effectivity rate 79.85% and 77.02% and coconut water + palm oil and storaged for 3 weeks (effectivity rate 77.46%.
Directory of Open Access Journals (Sweden)
Pieretti Isabelle
2012-11-01
Full Text Available Abstract Background Xanthomonas albilineans causes leaf scald, a lethal disease of sugarcane. X. albilineans exhibits distinctive pathogenic mechanisms, ecology and taxonomy compared to other species of Xanthomonas. For example, this species produces a potent DNA gyrase inhibitor called albicidin that is largely responsible for inducing disease symptoms; its habitat is limited to xylem; and the species exhibits large variability. A first manuscript on the complete genome sequence of the highly pathogenic X. albilineans strain GPE PC73 focused exclusively on distinctive genomic features shared with Xylella fastidiosa—another xylem-limited Xanthomonadaceae. The present manuscript on the same genome sequence aims to describe all other pathogenicity-related genomic features of X. albilineans, and to compare, using suppression subtractive hybridization (SSH, genomic features of two strains differing in pathogenicity. Results Comparative genomic analyses showed that most of the known pathogenicity factors from other Xanthomonas species are conserved in X. albilineans, with the notable absence of two major determinants of the “artillery” of other plant pathogenic species of Xanthomonas: the xanthan gum biosynthesis gene cluster, and the type III secretion system Hrp (hypersensitive response and pathogenicity. Genomic features specific to X. albilineans that may contribute to specific adaptation of this pathogen to sugarcane xylem vessels were also revealed. SSH experiments led to the identification of 20 genes common to three highly pathogenic strains but missing in a less pathogenic strain. These 20 genes, which include four ABC transporter genes, a methyl-accepting chemotaxis protein gene and an oxidoreductase gene, could play a key role in pathogenicity. With the exception of hypothetical proteins revealed by our comparative genomic analyses and SSH experiments, no genes potentially involved in any offensive or counter-defensive mechanism
Assessment of genetic diversity of Xanthomonas oryzae pv. oryzae
Institute of Scientific and Technical Information of China (English)
无
2000-01-01
@@Bacterial blight of rice, caused by Xanthomonas oryzae pv. Oryzae(Xoo. ), is one of the major rice diseases in China. Making clear the shift of genetic diversity of the pathogen will provide important information for rice breeding. Strains collected from 11 provinces located in Southern region of the Changjiang River in China were assessed by using inoculation method and IS-PCR(Insertion Sequence-Based Polymerase Chain Reaction) analysis.
Transmission of Xanthomonas campestris pv. campestris in seed production crops of cauliflower
Kastelein, P.; Krijger, M.C.; Zouwen, van der P.S.; Steen, van der J.J.M.; Stevens, L.H.; Wolf, van der J.M.; Fernandes Vieira, J.; Amaral Villela, F.
2014-01-01
n 2011, two polytunnel greenhouse experiments were conducted on seed production farms, one under conventional conditions in the South-West (Rilland) and the other under organic conditions in the East (Voorst) of the Netherlands, to study transmission routes of Xanthomonas campestris pv. campestris
The cys regulon of Xanthomonas citri
International Nuclear Information System (INIS)
Moutran, A.; Balan, A.
2012-01-01
Full text: In Escherichia coli, genes involved in metabolic pathway of sulfate and sulfonate compounds are clustered in a cys regulon, which includes three ABC transport system (operons: sbpcysWUA; ssuABC and tauABC), thirteen genes involved in the sulfur reduction (ssuDE; tauD and cysDNCHIJGK) and two regulatory proteins that belong to LysR transcription family: CysB and Cbl. Notably, a search and comparative analysis of these genes in the genomes of the citrus pathogen Xanthomonas citri and other phylogenetically related Xanthomonas species revealed the presence of genes involved with alkanesulfonate, sulfate ester and taurine, only in X. citri, suggesting that proteins from this regulon might be associated with pathogenicity in citrus. Using the molecular modeling associated with a system biology view, we modeled all the protein structures of the X. citri cys regulon as well as characterized the important residues forming the putative active sites. Comparison with orthologs from different microorganisms was made in order to get a phylogenetic relationships. We showed that proteins that are responsible for the affinity and specificity of the alkanesulfonate, sulfate and taurine transport systems conserved the residues involved in the sulfate coordination but are organized in different branches in evolution. Inside these phylogenetic branches, proteins involved in the sulfate transporter are highly conserved when compared to the others. Moreover, we identified that the taurine-binding protein (TauA) of the X. citri belongs to a different evolutionary branch from that one that described for E. coli. These differences were also noticed for components of the tau operon, including a putative new regulator. The function and mechanism of action of each protein is discussed in order to bring light for the sulfur assimilation processes and their importance for X. citri physiology. (author)
The cys regulon of Xanthomonas citri
Energy Technology Data Exchange (ETDEWEB)
Moutran, A.; Balan, A. [Laboratorio Nacional de Biociencias - LNBIO, Campinas, SP (Brazil)
2012-07-01
Full text: In Escherichia coli, genes involved in metabolic pathway of sulfate and sulfonate compounds are clustered in a cys regulon, which includes three ABC transport system (operons: sbpcysWUA; ssuABC and tauABC), thirteen genes involved in the sulfur reduction (ssuDE; tauD and cysDNCHIJGK) and two regulatory proteins that belong to LysR transcription family: CysB and Cbl. Notably, a search and comparative analysis of these genes in the genomes of the citrus pathogen Xanthomonas citri and other phylogenetically related Xanthomonas species revealed the presence of genes involved with alkanesulfonate, sulfate ester and taurine, only in X. citri, suggesting that proteins from this regulon might be associated with pathogenicity in citrus. Using the molecular modeling associated with a system biology view, we modeled all the protein structures of the X. citri cys regulon as well as characterized the important residues forming the putative active sites. Comparison with orthologs from different microorganisms was made in order to get a phylogenetic relationships. We showed that proteins that are responsible for the affinity and specificity of the alkanesulfonate, sulfate and taurine transport systems conserved the residues involved in the sulfate coordination but are organized in different branches in evolution. Inside these phylogenetic branches, proteins involved in the sulfate transporter are highly conserved when compared to the others. Moreover, we identified that the taurine-binding protein (TauA) of the X. citri belongs to a different evolutionary branch from that one that described for E. coli. These differences were also noticed for components of the tau operon, including a putative new regulator. The function and mechanism of action of each protein is discussed in order to bring light for the sulfur assimilation processes and their importance for X. citri physiology. (author)
DEFF Research Database (Denmark)
Hansen, Lea Benedicte Skov; Ren, Dawei; Burmølle, Mette
2017-01-01
biofilms. This study presents a comparative gene expression analysis of the Xanthomonas retroflexus transcriptome when grown in a single-species biofilm and in dual-and four-species consortia with Stenotrophomonas rhizophila, Microbacterium oxydans and Paenibacillus amylolyticus. The results revealed...
Chemical products induce resistance to Xanthomonas perforans in tomato
Directory of Open Access Journals (Sweden)
Adriana Terumi Itako
2015-09-01
Full Text Available The bacterial spot of tomato, caused by Xanthomonas spp., is a very important disease, especially in the hot and humid periods of the year. The chemical control of the disease has not been very effective for a number of reasons. This study aimed to evaluate, under greenhouse conditions, the efficacy of leaf-spraying chemicals (acibenzolar-S-methyl (ASM (0.025 g.L−1, fluazinam (0.25 g.L−1, pyraclostrobin (0.08 g.L−1, pyraclostrobin + methiran (0.02 g.L−1 + 2.2 g.L−1, copper oxychloride (1.50 g.L−1, mancozeb + copper oxychloride (0.88 g.L−1 + 0.60 g.L−1, and oxytetracycline (0.40 g.L−1 on control of bacterial spot. Tomatoes Santa Clara and Gisele cultivars were pulverized 3 days before inoculation with Xanthomonas perforans. The production of enzymes associated with resistance induction (peroxidase, polyphenol oxidase, phenylalanine ammonia-lyase, β-1,3-glucanase, and protease was quantified from leaf samples collected 24 hours before and 24 hours after chemical spraying and at 1, 2, 4, 6, and 8 days after bacterial inoculation. All products tested controlled bacterial spot, but only ASM, pyraclostrobin, and pyraclostrobin + metiram increased the production of peroxidase in the leaves of the two tomato cultivars, and increased the production of polyphenol oxidase and β-1,3-glucanase in the Santa Clara cultivar.
Chemical products induce resistance to Xanthomonas perforans in tomato.
Itako, Adriana Terumi; Tolentino Júnior, João Batista; Silva Júnior, Tadeu Antônio Fernandes da; Soman, José Marcelo; Maringoni, Antonio Carlos
2015-01-01
The bacterial spot of tomato, caused by Xanthomonas spp., is a very important disease, especially in the hot and humid periods of the year. The chemical control of the disease has not been very effective for a number of reasons. This study aimed to evaluate, under greenhouse conditions, the efficacy of leaf-spraying chemicals (acibenzolar-S-methyl (ASM) (0.025 g.L(-1)), fluazinam (0.25 g.L(-1)), pyraclostrobin (0.08 g.L(-1)), pyraclostrobin + methiran (0.02 g.L(-1) + 2.2 g.L(-1)), copper oxychloride (1.50 g.L(-1)), mancozeb + copper oxychloride (0.88 g.L(-1) + 0.60 g.L(-1)), and oxytetracycline (0.40 g.L(-1))) on control of bacterial spot. Tomatoes Santa Clara and Gisele cultivars were pulverized 3 days before inoculation with Xanthomonas perforans. The production of enzymes associated with resistance induction (peroxidase, polyphenol oxidase, phenylalanine ammonia-lyase, β-1,3-glucanase, and protease) was quantified from leaf samples collected 24 hours before and 24 hours after chemical spraying and at 1, 2, 4, 6, and 8 days after bacterial inoculation. All products tested controlled bacterial spot, but only ASM, pyraclostrobin, and pyraclostrobin + metiram increased the production of peroxidase in the leaves of the two tomato cultivars, and increased the production of polyphenol oxidase and β-1,3-glucanase in the Santa Clara cultivar.
Characterization of novel virulent broad-host-range phages of Xylella fastidiosa and Xanthomonas.
Ahern, Stephen J; Das, Mayukh; Bhowmick, Tushar Suvra; Young, Ry; Gonzalez, Carlos F
2014-01-01
The xylem-limited bacterium Xylella fastidiosa is the causal agent of several plant diseases, most notably Pierce's disease of grape and citrus variegated chlorosis. We report the isolation and characterization of the first virulent phages for X. fastidiosa, siphophages Sano and Salvo and podophages Prado and Paz, with a host range that includes Xanthomonas spp. Phages propagated on homologous hosts had observed adsorption rate constants of ~4 × 10(-12) ml cell(-1) min(-1) for X. fastidiosa strain Temecula 1 and ~5 × 10(-10) to 7 × 10(-10) ml cell(-1) min(-1) for Xanthomonas strain EC-12. Sano and Salvo exhibit >80% nucleotide identity to each other in aligned regions and are syntenic to phage BcepNazgul. We propose that phage BcepNazgul is the founding member of a novel phage type, to which Sano and Salvo belong. The lysis genes of the Nazgul-like phage type include a gene that encodes an outer membrane lipoprotein endolysin and also spanin gene families that provide insight into the evolution of the lysis pathway for phages of Gram-negative hosts. Prado and Paz, although exhibiting no significant DNA homology to each other, are new members of the phiKMV-like phage type, based on the position of the single-subunit RNA polymerase gene. The four phages are type IV pilus dependent for infection of both X. fastidiosa and Xanthomonas. The phages may be useful as agents for an effective and environmentally responsible strategy for the control of diseases caused by X. fastidiosa.
Ferreira, Rafael Marini; de Oliveira, Amanda Carolina P; Moreira, Leandro M; Belasque, José; Gourbeyre, Edith; Siguier, Patricia; Ferro, Maria Inês T; Ferro, Jesus A; Chandler, Michael; Varani, Alessandro M
2015-02-17
Members of the genus Xanthomonas are among the most important phytopathogens. A key feature of Xanthomonas pathogenesis is the translocation of type III secretion system (T3SS) effector proteins (T3SEs) into the plant target cells via a T3SS. Several T3SEs and a murein lytic transglycosylase gene (mlt, required for citrus canker symptoms) are found associated with three transposition-related genes in Xanthomonas citri plasmid pXAC64. These are flanked by short inverted repeats (IRs). The region was identified as a transposon, TnXax1, with typical Tn3 family features, including a transposase and two recombination genes. Two 14-bp palindromic sequences within a 193-bp potential resolution site occur between the recombination genes. Additional derivatives carrying different T3SEs and other passenger genes occur in different Xanthomonas species. The T3SEs include transcription activator-like effectors (TALEs). Certain TALEs are flanked by the same IRs as found in TnXax1 to form mobile insertion cassettes (MICs), suggesting that they may be transmitted horizontally. A significant number of MICs carrying other passenger genes (including a number of TALE genes) were also identified, flanked by the same TnXax1 IRs and delimited by 5-bp target site duplications. We conclude that a large fraction of T3SEs, including individual TALEs and potential pathogenicity determinants, have spread by transposition and that TnXax1, which exhibits all of the essential characteristics of a functional transposon, may be involved in driving MIC transposition. We also propose that TALE genes may diversify by fork slippage during the replicative Tn3 family transposition. These mechanisms may play a crucial role in the emergence of Xanthomonas pathogenicity. Xanthomonas genomes carry many insertion sequences (IS) and transposons, which play an important role in their evolution and architecture. This study reveals a key relationship between transposons and pathogenicity determinants in
International Nuclear Information System (INIS)
Zubrzycki, H.M.; Diamante de Zubrzycki, A.
1982-01-01
With the aim of obtaining resistance to Xanthomonas citri in citrus, mutagenic treatment was carried out with X-rays and gamma rays on buds and seedlings. As a prerequisite, attempts were made to determine some physiological and structural differences in leaves in order to evaluate and analyse the reaction to the bacterium in qualitative and quantitative terms. Citrus were found to present 3-4 annual sproutings, each having a different intensity. Grapefruit showed a greater initial increase and final length than orange, but lemon growth was greater than all the others. According to their growth, leaves clustered in three groups. Those in the middle part of the sprout showed the greatest daily increase, followed in decreasing order by those of the base and those of the apex. In orange cultivars with different degrees of reaction to Xanthomonas citri a direct association between daily growth of leaves and susceptibility was found. In fully developed leaves the number of stomata per surface unit presented an inverse ratio with susceptibility. It was observed that in a given genotype the stomata frequency per surface unit was higher in young leaves than in developed ones. Also a direct association between the leaf area and the number of stomata per leaf was found. Natural field infections were measured in leaves of developed plants. Infection in each of the 3-4 annual sproutings depends on environmental factors during the growth period and the predisposition period of the leaves. The available variation for reaction to Xanthomonas citri was higher in oranges than in grapefruit. The abscission of each leaf depends on its degree of infection, but the cultivars classed as more resistant are those requiring a smaller affected area to provoke the leaf abscission. However, abscission of a leaf is independent of the fate of the neighbouring ones. The existence of a continuous grading of infection damage within the orange cultivars suggests a genetic component for resistance
DEFF Research Database (Denmark)
Adriko, John; Aritua, V.; Mortensen, Carmen Nieves
2012-01-01
The present study developed a pathovar-specific PCR for the detection of Xanthomonas campestris pv. musacearum (Xcm), the cause of banana xanthomonas wilt, by amplification of a 265-bp region of the gene encoding the general secretion pathway protein D (GspD). A distinct DNA fragment......-specific PCR was successfully multiplexed with internal control primers targeting 16S rDNA for application on DNA from bacterial cultures and with primers targeting plant mitochondrial 26S rDNA for application on DNA extracted from plant material. Diagnostic discrimination of healthy and infected plants...
Antimicrobial activities of pyridinium-tailored pyrazoles bearing 1,3,4-oxadiazole scaffolds
Directory of Open Access Journals (Sweden)
Lei Zhou
2017-11-01
Full Text Available Herein, a series of pyridinium-tailored 5-trifluoromethylpyrazoles containing 1,3,4-oxadiazole moieties were constructed through coupling key pharmaceutical fragments of pyridinium, pyrazole, and 1,3,4-oxadiazole scaffolds in single molecular architecture. Antimicrobial results suggested that this kind of compounds exhibited significant activities against three types of pathogenic bacteria and six fungal strains in vitro. The minimal EC50 values of designed compounds against Xanthomonas oryzae pv. oryzae, Ralstonia solanacearum, and Xanthomonas axonopodis pv. citri could reach to 0.467, 1.04, and 0.600 μg/mL, respectively, through tuning and optimizing N-substituents, bridging atom, and alkyl length of the tailor. Antifungal assays revealed that all title molecules possessed considerable activity against Botrytis cinerea with the minimal EC50 value up to 2.71 μg/mL; and compounds I-8, I-10, I-12, II-12, and IV-12 showed the strongest growth suppression toward Rhizoctonia solani with EC50 values ranging from 10.2 to 24.0 μg/mL. Given the above results, this kind of compounds could serve as new lead compounds in the research of antimicrobial chemotherapy.
Praburaman, Loganathan; Jang, Jum-Suk; Muthusamy, Govarthanan; Arumugam, Sengottaiyan; Manoharan, Koildhasan; Cho, Kwang-Min; Min, Cho; Kamala-Kannan, Seralathan; Byung-Taek, Oh
2016-09-01
The study reports a simple, inexpensive, and eco-friendly synthesis of copper oxide nanoparticles (CuONPs) using Piper betle leaf extract. Formation of CuONPs was confirmed by UV-visible spectroscopy at 280 nm. Transmission electron microscopy (TEM) images showed that the CuONPs were spherical, with an average size of 50-100 nm. The scanning electron microscopy (SEM)-energy dispersive spectroscopy (EDS) peak was observed approximately at 1 and 8 keV. The X-ray diffraction (XRD) studies indicated that the particles were crystalline in nature. CuONPs effectively inhibited the growth of phytopathogens Ralstonia solanacearum and Xanthomonas axonopodis. The cytotoxic effect of the synthesized CuONPs was analyzed using rat splenocytes. The cell viability was decreased to 94% at 300 μg/mL.
Detection of mechanical and disease stresses in citrus plants by fluorescence spectroscopy
Belasque, J., Jr.; Gasparoto, M. C. G.; Marcassa, L. G.
2008-04-01
We have investigated the detection of mechanical and disease stresses in citrus plants (Citrus limonia [L.] Osbeck) using laser-induced fluorescence spectroscopy. Due to its economic importance we have chosen to investigate the citrus canker disease, which is caused by the Xanthomonas axonopodis pv. citri bacteria. Mechanical stress was also studied because it plays an important role in the plant's infection by such bacteria. A laser-induced fluorescence spectroscopy system, composed of a spectrometer and a 532 nm10 mW excitation laser was used to perform fluorescence spectroscopy. The ratio of two chlorophyll fluorescence bands allows us to detect and discriminate between mechanical and disease stresses. This ability to discriminate may have an important application in the field to detect citrus canker infected trees.
Top 10 plant pathogenic bacteria in molecular plant pathology.
Mansfield, John; Genin, Stephane; Magori, Shimpei; Citovsky, Vitaly; Sriariyanum, Malinee; Ronald, Pamela; Dow, Max; Verdier, Valérie; Beer, Steven V; Machado, Marcos A; Toth, Ian; Salmond, George; Foster, Gary D
2012-08-01
Many plant bacteriologists, if not all, feel that their particular microbe should appear in any list of the most important bacterial plant pathogens. However, to our knowledge, no such list exists. The aim of this review was to survey all bacterial pathologists with an association with the journal Molecular Plant Pathology and ask them to nominate the bacterial pathogens they would place in a 'Top 10' based on scientific/economic importance. The survey generated 458 votes from the international community, and allowed the construction of a Top 10 bacterial plant pathogen list. The list includes, in rank order: (1) Pseudomonas syringae pathovars; (2) Ralstonia solanacearum; (3) Agrobacterium tumefaciens; (4) Xanthomonas oryzae pv. oryzae; (5) Xanthomonas campestris pathovars; (6) Xanthomonas axonopodis pathovars; (7) Erwinia amylovora; (8) Xylella fastidiosa; (9) Dickeya (dadantii and solani); (10) Pectobacterium carotovorum (and Pectobacterium atrosepticum). Bacteria garnering honourable mentions for just missing out on the Top 10 include Clavibacter michiganensis (michiganensis and sepedonicus), Pseudomonas savastanoi and Candidatus Liberibacter asiaticus. This review article presents a short section on each bacterium in the Top 10 list and its importance, with the intention of initiating discussion and debate amongst the plant bacteriology community, as well as laying down a benchmark. It will be interesting to see, in future years, how perceptions change and which bacterial pathogens enter and leave the Top 10. © 2012 The Authors. Molecular Plant Pathology © 2012 BSPP and Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Hong Lu
Full Text Available Xanthomonas is a large genus of plant-associated and plant-pathogenic bacteria. Collectively, members cause diseases on over 392 plant species. Individually, they exhibit marked host- and tissue-specificity. The determinants of this specificity are unknown.To assess potential contributions to host- and tissue-specificity, pathogenesis-associated gene clusters were compared across genomes of eight Xanthomonas strains representing vascular or non-vascular pathogens of rice, brassicas, pepper and tomato, and citrus. The gum cluster for extracellular polysaccharide is conserved except for gumN and sequences downstream. The xcs and xps clusters for type II secretion are conserved, except in the rice pathogens, in which xcs is missing. In the otherwise conserved hrp cluster, sequences flanking the core genes for type III secretion vary with respect to insertion sequence element and putative effector gene content. Variation at the rpf (regulation of pathogenicity factors cluster is more pronounced, though genes with established functional relevance are conserved. A cluster for synthesis of lipopolysaccharide varies highly, suggesting multiple horizontal gene transfers and reassortments, but this variation does not correlate with host- or tissue-specificity. Phylogenetic trees based on amino acid alignments of gum, xps, xcs, hrp, and rpf cluster products generally reflect strain phylogeny. However, amino acid residues at four positions correlate with tissue specificity, revealing hpaA and xpsD as candidate determinants. Examination of genome sequences of xanthomonads Xylella fastidiosa and Stenotrophomonas maltophilia revealed that the hrp, gum, and xcs clusters are recent acquisitions in the Xanthomonas lineage.Our results provide insight into the ancestral Xanthomonas genome and indicate that differentiation with respect to host- and tissue-specificity involved not major modifications or wholesale exchange of clusters, but subtle changes in a small
A simple method for DNA isolation from Xanthomonas spp.
Directory of Open Access Journals (Sweden)
Gomes Luiz Humberto
2000-01-01
Full Text Available A simple DNA isolation method was developed with routine chemicals that yields high quality and integrity preparations when compared to some of the most well known protocols. The method described does not require the use of lysing enzymes, water bath and the DNA was obtained within 40 minutes The amount of nucleic acid extracted (measured in terms of absorbancy at 260 nm from strains of Xanthomonas spp., Pseudomonas spp. and Erwinia spp. was two to five times higher than that of the most commonly used method.
Cuestas Montañés, Eduardo José; Ortega Páez, Eduardo
2011-01-01
Este estudio avanza en la posibilidad de realizar una prueba de cribado simple e inocua para detectar la enfermedad celíaca a edades tempranas, lo que puede contribuir a disminuir la morbimortalidad asociada a la enfermedad.
Laia, Marcelo L; Moreira, Leandro M; Dezajacomo, Juliana; Brigati, Joice B; Ferreira, Cristiano B; Ferro, Maria I T; Silva, Ana C R; Ferro, Jesus A; Oliveira, Julio C F
2009-01-16
Citrus canker is a disease caused by the phytopathogens Xanthomonas citri subsp. citri, Xanthomonas fuscans subsp. aurantifolli and Xanthomonas alfalfae subsp. citrumelonis. The first of the three species, which causes citrus bacterial canker type A, is the most widely spread and severe, attacking all citrus species. In Brazil, this species is the most important, being found in practically all areas where citrus canker has been detected. Like most phytobacterioses, there is no efficient way to control citrus canker. Considering the importance of the disease worldwide, investigation is needed to accurately detect which genes are related to the pathogen-host adaptation process and which are associated with pathogenesis. Through transposon insertion mutagenesis, 10,000 mutants of Xanthomonas citri subsp. citri strain 306 (Xcc) were obtained, and 3,300 were inoculated in Rangpur lime (Citrus limonia) leaves. Their ability to cause citrus canker was analyzed every 3 days until 21 days after inoculation; a set of 44 mutants showed altered virulence, with 8 presenting a complete loss of causing citrus canker symptoms. Sequencing of the insertion site in all 44 mutants revealed that 35 different ORFs were hit, since some ORFs were hit in more than one mutant, with mutants for the same ORF presenting the same phenotype. An analysis of these ORFs showed that some encoded genes were previously known as related to pathogenicity in phytobacteria and, more interestingly, revealed new genes never implicated with Xanthomonas pathogenicity before, including hypothetical ORFs. Among the 8 mutants with no canker symptoms are the hrpB4 and hrpX genes, two genes that belong to type III secretion system (TTSS), two hypothetical ORFS and, surprisingly, the htrA gene, a gene reported as involved with the virulence process in animal-pathogenic bacteria but not described as involved in phytobacteria virulence. Nucleic acid hybridization using labeled cDNA probes showed that some of the
Classification of plant associated bacteria using RIF, a computationally derived DNA marker.
Directory of Open Access Journals (Sweden)
Kevin L Schneider
Full Text Available A DNA marker that distinguishes plant associated bacteria at the species level and below was derived by comparing six sequenced genomes of Xanthomonas, a genus that contains many important phytopathogens. This DNA marker comprises a portion of the dnaA replication initiation factor (RIF. Unlike the rRNA genes, dnaA is a single copy gene in the vast majority of sequenced bacterial genomes, and amplification of RIF requires genus-specific primers. In silico analysis revealed that RIF has equal or greater ability to differentiate closely related species of Xanthomonas than the widely used ribosomal intergenic spacer region (ITS. Furthermore, in a set of 263 Xanthomonas, Ralstonia and Clavibacter strains, the RIF marker was directly sequenced in both directions with a success rate approximately 16% higher than that for ITS. RIF frameworks for Xanthomonas, Ralstonia and Clavibacter were constructed using 682 reference strains representing different species, subspecies, pathovars, races, hosts and geographic regions, and contain a total of 109 different RIF sequences. RIF sequences showed subspecific groupings but did not place strains of X. campestris or X. axonopodis into currently named pathovars nor R. solanacearum strains into their respective races, confirming previous conclusions that pathovar and race designations do not necessarily reflect genetic relationships. The RIF marker also was sequenced for 24 reference strains from three genera in the Enterobacteriaceae: Pectobacterium, Pantoea and Dickeya. RIF sequences of 70 previously uncharacterized strains of Ralstonia, Clavibacter, Pectobacterium and Dickeya matched, or were similar to, those of known reference strains, illustrating the utility of the frameworks to classify bacteria below the species level and rapidly match unknown isolates to reference strains. The RIF sequence frameworks are available at the online RIF database, RIFdb, and can be queried for diagnostic purposes with RIF
Biofertilizantes no controle da mancha bacteriana (Xanthomonas spp.) do tomateiro
Rodrigues,Vinícius William Borges; Bueno,Thays Vieira; Tebaldi,Nilvanira Donizete
2016-01-01
RESUMO A mancha bacteriana do tomateiro, causada por quatro espécies de Xanthomonas pode provocar perdas significativas na produção da cultura e a utilização de biofertilizantes na proteção de plantas tende a reduzir a incidência de doenças. O objetivo do trabalho foi avaliar o efeito dos biofertilizantes no controle preventivo e curativo da mancha bacteriana do tomateiro. Para o controle preventivo da doença, plantas de tomate cultivar Santa Cruz Kada, com 3 a 4 folhas foram pulverizadas com...
Pathogenic and genetic diversity of Xanthomonas translucens pv. undulosa in North Dakota.
Adhikari, Tika B; Gurung, Suraj; Hansen, Jana M; Bonman, J Michael
2012-04-01
Bacterial leaf streak (BLS), caused by Xanthomonas translucens pv. undulosa, has become more prevalent recently in North Dakota and neighboring states. From five locations in North Dakota, 226 strains of X. translucens pv. undulosa were collected and evaluated for pathogenicity and then selected strains were inoculated on a set of 12 wheat cultivars and other cereal hosts. The genetic diversity of all strains was determined using repetitive sequence-based polymerase chain reaction (rep-PCR) and insertion sequence-based (IS)-PCR. Bacterial strains were pathogenic on wheat and barley but symptom severity was greatest on wheat. Strains varied greatly in aggressiveness, and wheat cultivars also showed differential responses to several strains. The 16S ribosomal DNA sequences of the strains were identical, and distinct from those of the other Xanthomonas pathovars. Combined rep-PCR and IS-PCR data produced 213 haplotypes. Similar haplotypes were detected in more than one location. Although diversity was greatest (≈92%) among individuals within a location, statistically significant (P ≤ 0.001 or 0.05) genetic differentiation among locations was estimated, indicating geographic differentiation between pathogen populations. The results of this study provide information on the pathogen diversity in North Dakota, which will be useful to better identify and characterize resistant germplasm.
Caserta, R; Picchi, S C; Takita, M A; Tomaz, J P; Pereira, W E L; Machado, M A; Ionescu, M; Lindow, S; De Souza, A A
2014-11-01
Xylella fastidiosa and Xanthomonas citri subsp. citri, that cause citrus variegated chlorosis (CVC) and citrus canker diseases, respectively, utilize diffusible signal factor (DSF) for quorum sensing. DSF, produced by RpfF, are similar fatty acids in both organisms, although a different set of genes is regulated by DSF in each species. Because of this similarity, Xylella fastidiosa DSF might be recognized and affect the biology of Xanthomonas citri. Therefore, transgenic Citrus sinensis and Carrizo citrange plants overexpressing the Xylella fastidiosa rpfF were inoculated with Xanthomonas citri and changes in symptoms of citrus canker were observed. X. citri biofilms formed only at wound sites on transgenic leaves and were thicker; however, bacteria were unable to break through the tissue and form pustules elsewhere. Although abundant growth of X. citri occurred at wound sites on inoculated transgenic leaves, little growth was observed on unwounded tissue. Genes in the DFS-responsive core in X. citri were downregulated in bacteria isolated from transgenic leaves. DSF-dependent expression of engA was suppressed in cells exposed to xylem sap from transgenic plants. Thus, altered symptom development appears to be due to reduced expression of virulence genes because of the presence of antagonists of DSF signaling in X. citri in rpfF-expressing plants.
Xanthomonas citri MinC Oscillates from Pole to Pole to Ensure Proper Cell Division and Shape
Soibelmann Glock Lorenzoni, André; Dantas, Giordanni; Bergsma, Tessa; Ferreira, Henrique; Scheffers, Dirk
2017-01-01
Xanthomonas citri (Xac) is the causal agent of citrus canker, a disease that affects citrus crops and causes economic impact worldwide. To further characterize cell division in this plant pathogen, we investigated the role of the protein MinC in cell division, chromosome segregation, and
Citrus canker control is based on protection measures and eradication of plants infected with Xanthomonas citri subsp. citri. Although these measures show satisfactory results, the use of resistant genotypes is an important alternative for citrus canker control. The aim of this study was to evaluate...
Biofertilizantes no controle da mancha bacteriana (Xanthomonas spp. do tomateiro
Directory of Open Access Journals (Sweden)
Vinícius William Borges Rodrigues
2016-03-01
Full Text Available RESUMO A mancha bacteriana do tomateiro, causada por quatro espécies de Xanthomonas pode provocar perdas significativas na produção da cultura e a utilização de biofertilizantes na proteção de plantas tende a reduzir a incidência de doenças. O objetivo do trabalho foi avaliar o efeito dos biofertilizantes no controle preventivo e curativo da mancha bacteriana do tomateiro. Para o controle preventivo da doença, plantas de tomate cultivar Santa Cruz Kada, com 3 a 4 folhas foram pulverizadas com os biofertilizantes (Soil-Set, Agro-Mos e Cop-R-Quick e água (testemunha; e dois dias após foram inoculadas por aspersão com a suspensão bacteriana nas concentrações 109 UFC mL-1 (OD550=0,5 e 106UFC mL-1, com o isolado UFU A35 de Xanthomonas sp. Para o controle curativo, as plantas foram inoculadas com a suspensão bacteriana, e dois dias após foram pulverizadas com os biofertilizantes e água. A severidade da mancha bacteriana foi avaliada usando uma escala diagramática; aos 3, 5, 8, 11 e 14 dias após a inoculação e calculada a área abaixo da curva de progresso de doença (AACPD. O controle preventivo foi mais eficiente no manejo da mancha bacteriana do tomateiro, e os diferentes biofertilizantes reduziram a severidade da doença.
Energy Technology Data Exchange (ETDEWEB)
Moreira, Angelita da S.; Vendruscolo, Claire T.; Furlan, Ligia [Universidade Federal de Pelotas, RS (Brazil). Centro de Biotecnologia]. E-mail: angelita@ufpel.tche.br; claire@ufpel.tche.br; ligia@ufpel.tche.br; Galland, Griselda [Rio Grande do Sul Univ., Porto Alegre, RS (Brazil). Inst. de Qumica
2001-07-01
In this work we describe the characterisation of Xanthan biopolymers synthesized by two Xanthomonas campestris pv pruni strains, in aerobic fermentation. By chromatography on TLC we could notice the presence of Mannose monomer in higher proportion in the 82 strain with relation to the another ones. The viscosity results showed the temperature dependence. The 06 and 82 strains had their viscosity increased whereas for the 87 strain we could observe a reduction with temperature increasing. The {sup 13}C NMR spectrum of 87 strain showed the characteristic signals at approximately 92.8, 70.4 and 61.4 ppm, attributed to C1, C4 and C6 from glucose monomer, with higher intensity. (author)
Wolf, van der J.M.; Zouwen, van der P.S.; Heijden, van der L.
2013-01-01
During seed production, Brassica seed may become infected with Xanthomonas campestris pv. campestris after systemic colonization of plants upon leaf infection, or alternatively, after flower infection. Polytunnel experiments were conducted in 2007 and 2008 to study the relative importance of these
Greenhouse and controlled-environment studies were conducted to determine the effects of incubation temperature, dew period temperature and duration, plant growth stage, and cell concentration on the bioherbicidal efficacy of a highly virulent isolate (LVA987) of the bacterial pathogen, Xanthomonas ...
Xanthomonas fragariae is a bacterium that causes angular leaf spot of strawberry. Asymptomatic infections are common and contribute to the difficulties in disease management. The aim of this study was to develop a loop-mediated isothermal amplification (LAMP) assay with a bacterial enrichment proced...
Tryptophan-Containing Cyclic Decapeptides with Activity against Plant Pathogenic Bacteria
Directory of Open Access Journals (Sweden)
Cristina Camó
2017-10-01
Full Text Available A library of 66 cyclic decapeptides incorporating a Trp residue was synthesized on solid phase and screened against the phytopathogenic bacteria Pseudomonas syringae pv. syringae, Xanthomonas axonopodis pv. vesicatoria, and Erwinia amylovora. The hemolytic activity of these peptides was also evaluated. The results obtained were compared with those of a collection of Phe analogues previously reported. The analysis of the data showed that the presence of the Trp improved the antibacterial activity against these three pathogens. In particular, 40 to 46 Trp analogues displayed lower minimum inhibitory concentration (MIC values than their corresponding Phe counterparts. Interestingly, 26 Trp-containing sequences exhibited MIC of 0.8 to 3.1 μM against X. axonopodis pv. vesicatoria, 21 peptides MIC of 1.6 to 6.2 μM against P. syringae pv. syringae and six peptides MIC of 6.2 to 12.5 μM against E. amylovora. Regarding the hemolysis, in general, Trp derivatives displayed a percentage of hemolysis comparable to that of their Phe analogues. Notably, 49 Trp-containing cyclic peptides showed a hemolysis ≤ 20% at 125 μM. The peptides with the best biological activity profile were c(LKKKLWKKLQ (BPC086W and c(LKKKKWLLKQ (BPC108W, which displayed MIC values ranging from 0.8 to 12.5 μM and a hemolysis ≤ 8% at 125 μM. Therefore, it is evident that these Trp sequences constitute promising candidates for the development of new agents for use in plant protection.
Directory of Open Access Journals (Sweden)
Bogdanove Adam J
2007-12-01
Full Text Available Abstract Background Lipopolysaccharide (LPS is a pathogen associated molecular pattern (PAMP of animal and plant pathogenic bacteria. Variation at the interstrain level is common in LPS biosynthetic gene clusters of animal pathogenic bacteria. This variation has been proposed to play a role in evading the host immune system. Even though LPS is a modulator of plant defense responses, reports of interstrain variation in LPS gene clusters of plant pathogenic bacteria are rare. Results In this study we report the complete sequence of a variant 19.9 kb LPS locus present in the BXO8 strain of Xanthomonas oryzae pv. oryzae (Xoo, the bacterial blight pathogen of rice. This region is completely different in size, number and organization of genes from the LPS locus present in most other strains of Xoo from India and Asia. Surprisingly, except for one ORF, all the other ORFs at the BXO8 LPS locus are orthologous to the genes present at this locus in a sequenced strain of X. axonopodis pv. citri (Xac; a pathogen of citrus plants. One end of the BXO8 LPS gene cluster, comprised of ten genes, is also present in the related rice pathogen, X. oryzae pv. oryzicola (Xoc. In Xoc, the remainder of the LPS gene cluster, consisting of seven genes, is novel and unrelated to LPS gene clusters of any of the sequenced xanthomonads. We also report substantial interstrain variation suggestive of very recent horizontal gene transfer (HGT at the LPS biosynthetic locus of Xanthomonas campestris pv. campestris (Xcc, the black rot pathogen of crucifers. Conclusion Our analyses indicate that HGT has altered the LPS locus during the evolution of Xanthomonas oryzae pathovars and suggest that the ancestor of all Xanthomonas oryzae pathovars had an Xac type of LPS gene cluster. Our finding of interstrain variation in two major xanthomonad pathogens infecting different hosts suggests that the LPS locus in plant pathogenic bacteria, as in animal pathogens, is under intense
Directory of Open Access Journals (Sweden)
Joaquim Geraldo Cáprio da Costa
2003-10-01
Full Text Available O crestamento bacteriano comum e a antracnoseincitados por Xanthomonas axonopodis pv. phaseoli (Smith Vauterin, Hoste, Kesters & Swings e Colletotrichum lindemuthianum (Sacc. & Magn. Scrib., respectivamente, podem reduzir consideravelmente a produtividade do feijoeiro comum (Phaseolus vulgaris L.. Conduziu-se este trabalho com o objetivo de obter linhagens com resistência conjunta ao crestamento bacteriano comum e à antracnose, com características agronômicas desejáveis. Foram obtidas 35 populações F2 provenientes de cruzamentos simples entre linhagens com resistência ao crestamento bacteriano comum proveniente de P. acutifolius A. Gray e linhagens resistentes à antracnose e com características agronômicas favoráveis. As populações segregantes de F2 a F5 foram inoculadas com o patótipo 89 de C. lindemuthianum com uma concentração de 1,2 x 10(6 conídios/mL e submetidas à seleção massal modificada. As plantas que apresentaram grau superior a 4 foram eliminadas. Na geração F5, foi realizada seleção individual das plantas remanescentes para obter as famílias F6. As famílias F6 foram avaliadas mediante inoculação com os patótipos 55, 89, 95 e 453 de C. lindemuthianum. As famílias F7 resistentes à antracnose foram inoculadas em casa-de-vegetação por incisão das folhas primárias com tesoura mergulhada em uma suspensão de 5 x 10(7 ufc do isolado XpCNF 15 de X. axonopodis pv. phaseoli. As linhagens resistentes foram avaliadas em quatro experimentos de campo. Foram selecionadas 17 linhagens com alto rendimento de grãos, resistentes ao crestamento bacteriano comum e à antracnose, com boa altura de inserção das vagens inferiores e resistentes ao acamamento.Common bacterial blight and anthracnose diseases, incited by Xanthomonas axonopodis pv. phaseoli (Smith Vauterin, Hoste, Kesters & Swings and Colletotrichum lindemuthianum (Sacc. & Magn. Scrib., respectively, are major constrains for dry bean (Phaseolus vulgaris L
Tranformasi Fragmen Dna Kromosom Xanthomonas Campestris ke dalam Escherichia Coli
Directory of Open Access Journals (Sweden)
Wibowo Mangunwardoyo
2002-04-01
Full Text Available Research on DNA transformation of Xanthomonas campestris into Escherichia coli DH5αα using plasmid vector Escherichia coli (pUC19. was carried out. DNA chromosome was isolated using CTAB method, alkali lysis method was used to isolate DNA plasmid. Both of DNA plasmid and chromosome were digested using restriction enzyme EcoRI. Competent cell was prepared with CaCl2 and heat shock method for transformation procedure. The result revealed transformation obtain 5 white colonies, with transformation frequency was 1,22 x 10-8 colony/competent cell. Electrophoresis analysis showed the DNA fragment (insert in range 0.5 – 7,5 kb. Further research should be carried out to prepare the genomic library to obtain better result of transformant.
Nemeth, J.; Vuurde, van J.W.L.
2006-01-01
Immunofluorescence colony-staining (IFC) is based on sample pour plating in combination with immunofluorescence staining for recognition of the target colony. IFC was optimised for detecting Xanthomonas campestris pv. vesicatoria (Xcv) and Clavibacter michiganensis subsp. michiganensis (Cmm) in
Glycerol as a carbon source for xantan production by Xanthomonas campestris isolates
Directory of Open Access Journals (Sweden)
Bajić Bojana Ž.
2015-01-01
Full Text Available The success of xanthan biosynthesis depends on several factors, most importantly the genetic potential of the production microorganism and cultivation media composition. Cultivation media composition affects the yield and quality of the desired product as well as production costs. This is why many studies focus on finding cheap alternative raw materials, especially carbon sources, to replace commercially used glucose and sucrose. In addition to the Xanthomonas campestris ATCC 13951 which is the primary industrial production microorganism, other Xanthomonas strains can produce xanthan as well. Under the same conditions, different strains produce different amounts of the biopolymer of varying quality. The aim of this paper is to compare producibility of phytopathogenic X. campestris strains, isolated from the environment with the reference X. campestris ATCC 13951 strain and to estimate the possibility of xanthan production using alternative glycerol-based media than the synthetic glucose-based media. Submerged cultivation on the medium based on glucose or glycerol (2.0 %w/v was performed using the reference strain and eight isolated X. campestris strains. In order to assess the success of biosynthesis, xanthan yield and rheological properties were determined. Strains isolated from the environment produced yields between 2.98 g/L and 12.17 g/L on the glucose-based medium and 1.68 g/L and 6.31 g/L on the glycerol-based medium. Additionally, X. campestris ATCC 13951 provided the highest yield when using glucose (13.24 g/L, as well as glycerol-based medium (7.44 g/L. The obtained results indicate that in the applied experimental conditions and using all tested strains, glycerol is viable as a carbon source for the production of xanthan.
Zuluaga, Paola; Szurek, Boris; Koebnik, Ralf; Kroj, Thomas; Morel, Jean-Benoit
2017-01-01
Plants are constantly challenged by a wide range of pathogens and have therefore evolved an array of mechanisms to defend against them. In response to these defense systems, pathogens have evolved strategies to avoid recognition and suppress plant defenses (Brown and Tellier, 2011). Three recent reports dealing with the resistance of rice to Xanthomonas oryzae have added a new twist to our understanding of this fascinating co-evolutionary arms race (Ji et al., 2016; Read et al., 2016; Triplet...
Lettuce yields can be reduced by the disease bacterial leaf spot (BLS) caused by the pathogen Xanthomonas campestris pv. vitians (Xcv) and host resistance is the most feasible method to reduce disease losses. The cultivars La Brillante, Pavane, and Little Gem express an incompatible host-pathogen in...
Directory of Open Access Journals (Sweden)
Murray Grant
2012-01-01
Full Text Available Following publication of our article [1], we found errors in analyses performed by the corresponding author (DJS related to the phylogenetic relationship between Xylella species and the other xanthomonads. These errors do not make any difference to the main findings and conclusions reported in our paper. For example, the phylogenetic positions of NCPPB1131, NCPPB1132 and NCPPB4393 within the Group 1 Xanthomonas species are unaffected. However, we wish to apologize to the authors of a previous work [2] for creating any negative impression on the quality of their phylogenetic analyses and to take this opportunity to rectify the errors. [...
Tripathi, Jaindra N; Lorenzen, Jim; Bahar, Ofir; Ronald, Pamela; Tripathi, Leena
2014-08-01
Banana Xanthomonas wilt (BXW), caused by the bacterium Xanthomonas campestris pv. musacearum (Xcm), is the most devastating disease of banana in east and central Africa. The spread of BXW threatens the livelihood of millions of African farmers who depend on banana for food security and income. There are no commercial chemicals, biocontrol agents or resistant cultivars available to control BXW. Here, we take advantage of the robust resistance conferred by the rice pattern-recognition receptor (PRR), XA21, to the rice pathogen Xanthomonas oryzae pv. oryzae (Xoo). We identified a set of genes required for activation of Xa21-mediated immunity (rax) that were conserved in both Xoo and Xcm. Based on the conservation, we hypothesized that intergeneric transfer of Xa21 would confer resistance to Xcm. We evaluated 25 transgenic lines of the banana cultivar 'Gonja manjaya' (AAB) using a rapid bioassay and 12 transgenic lines in the glasshouse for resistance against Xcm. About 50% of the transgenic lines showed complete resistance to Xcm in both assays. In contrast, all of the nontransgenic control plants showed severe symptoms that progressed to complete wilting. These results indicate that the constitutive expression of the rice Xa21 gene in banana results in enhanced resistance against Xcm. Furthermore, this work demonstrates the feasibility of PRR gene transfer between monocotyledonous species and provides a valuable new tool for controlling the BXW pandemic of banana, a staple food for 100 million people in east Africa. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.
Baby leaf lettuce cultivars with resistance to bacterial leaf spot (BLS) caused by Xanthomonas campestris pv. vitians (Xcv) are needed to reduce crop losses. The objectives of this research were to assess the genetic diversity for BLS resistance in baby leaf lettuce cultivars and to select early gen...
Pruvost, Olivier; Boyer, Claudine; Vital, Karine; Gagnevin, Lionel; De Bruno Austin, L.; Rey, Jean-Yves
2011-01-01
Bacterial canker of mango (or bacterial black spot), caused by Xanthomonas citri pv. mangiferaeindicae, is an economically important disease in tropical and subtropical producing areas (1). X. citri pv. mangiferaeindicae can cause severe infection in a wide range of mango cultivars and induces raised, angular, black leaf lesions, sometimes with a chlorotic halo. Several months after infection, leaf lesions dry and turn light brown or ash gray. Severe leaf infection may result in abscission. F...
Meio semi-seletivo para isolamento de Xanthomonas campestris pv. viticola
Directory of Open Access Journals (Sweden)
Peixoto Ana Rosa
2006-01-01
Full Text Available O cancro bacteriano causado por Xanthomonas campestris pv. viticola é a fitobacteriose mais importante da videira no Submédio São Francisco. O isolamento de X. campestris pv. viticola de tecidos vegetais infectados é dificultado pela presença de contaminantes bacterianos, entre os quais Microbacterium barkeri. Objetivando-se a formulação de meio de cultura semi-seletivo, 22 isolados de X. campestris pv. viticola foram testados com relação a 30 antibióticos. O meio semi-seletivo NYDAM (extrato de carne 3, peptona 5, glicose 10, extrato de levedura 5, ágar 18 e ampicilina 0,1 em g L-1 inibiu M. barkeri e bactérias fitopatogênicas podendo ser utilizado para isolar X. campestris pv. viticola de hospedeiros com infecção natural em campo.
International Nuclear Information System (INIS)
Moreira, Angelita da S.; Vendruscolo, Claire T.; Furlan, Ligia; Galland, Griselda
2001-01-01
In this work we describe the characterisation of Xanthan biopolymers synthesized by two Xanthomonas campestris pv pruni strains, in aerobic fermentation. By chromatography on TLC we could notice the presence of Mannose monomer in higher proportion in the 82 strain with relation to the another ones. The viscosity results showed the temperature dependence. The 06 and 82 strains had their viscosity increased whereas for the 87 strain we could observe a reduction with temperature increasing. The 13 C NMR spectrum of 87 strain showed the characteristic signals at approximately 92.8, 70.4 and 61.4 ppm, attributed to C1, C4 and C6 from glucose monomer, with higher intensity. (author)
Lucas,Gilvaine Ciavareli; Alves,Eduardo; Pereira,Ricardo Borges; Perina,Fabiano José; Souza,Ricardo Magela de
2012-01-01
The objective of this work was to evaluate the effects of plant essential oils (EOs) on the growth of Xanthomonas vesicatoria, on bacterial morphology and ultrastructure, and on the severity of tomato bacterial spot. EOs from citronella, clove, cinnamon, lemongrass, eucalyptus, thyme, and tea tree were evaluated in vitro at concentrations of 0.1, 1.0, 10, and 100% in 1.0% powdered milk. The effect of EOs, at 0.1%, on the severity of tomato bacterial spot was evaluated in tomato seedlings unde...
Deng, Yinyue; Wu, Jien; Yin, Wenfang; Li, Peng; Zhou, Jianuan; Chen, Shaohua; He, Fei; Cai, Jun; Zhang, Lian-Hui
2016-05-01
Diffusible signal factor (DSF) represents a new class of widely conserved quorum sensing signals, which regulates various biological functions through intra- or interspecies signaling. The previous studies identified that there is an antagonistic interaction between Xanthomonas and Bacillus species bacteria in natural ecosystem, but the detailed molecular mechanism of interspecies competition is not clear. This study showed that Xanthomonas campestris pv. campestris (Xcc) interfered with morphological transition and sporulation of Bacillus thuringiensis in mixed cultures, whereas abrogation of the DSF synthase RpfF reduced the interference. DSF inhibited B. thuringiensis cell division and sporulation through modulation of ftsZ, which encodes an important cell division protein in bacterial cells. In addition, RpfF is essential for production of six DSF-family signals in Xcc, which employ the same signaling pathways to regulate biological functions in Xcc and play similar effects on reduction of cell division, sporulation and antibiotic resistance of B. thuringiensis. Furthermore, abrogation of RpfF decreased the competitive capability of Xcc against B. thuringiensis on the surface of Chinese cabbage leaves. Our findings provide new insights into the role of DSF-family signals in interspecies competition and depict molecular mechanisms with which Xcc competes with B. thuringiensis. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
Artier, Juliana; da Silva Zandonadi, Flávia; de Souza Carvalho, Flávia Maria; Pauletti, Bianca Alves; Leme, Adriana Franco Paes; Carnielli, Carolina Moretto; Selistre-de-Araujo, Heloisa Sobreiro; Bertolini, Maria Célia; Ferro, Jesus Aparecido; Belasque Júnior, José; de Oliveira, Julio Cezar Franco; Novo-Mansur, Maria Teresa Marques
2018-01-01
Citrus canker is a plant disease caused by Gram-negative bacteria from the genus Xanthomonas. The most virulent species is Xanthomonas citri ssp. citri (XAC), which attacks a wide range of citrus hosts. Differential proteomic analysis of the periplasm-enriched fraction was performed for XAC cells grown in pathogenicity-inducing (XAM-M) and pathogenicity-non-inducing (nutrient broth) media using two-dimensional electrophoresis combined with liquid chromatography-tandem mass spectrometry. Amongst the 40 proteins identified, transglycosylase was detected in a highly abundant spot in XAC cells grown under inducing condition. Additional up-regulated proteins related to cellular envelope metabolism included glucose-1-phosphate thymidylyltransferase, dTDP-4-dehydrorhamnose-3,5-epimerase and peptidyl-prolyl cis-trans-isomerase. Phosphoglucomutase and superoxide dismutase proteins, known to be involved in pathogenicity in other Xanthomonas species or organisms, were also detected. Western blot and quantitative real-time polymerase chain reaction analyses for transglycosylase and superoxide dismutase confirmed that these proteins were up-regulated under inducing condition, consistent with the proteomic results. Multiple spots for the 60-kDa chaperonin and glyceraldehyde-3-phosphate dehydrogenase were identified, suggesting the presence of post-translational modifications. We propose that substantial alterations in cellular envelope metabolism occur during the XAC infectious process, which are related to several aspects, from defence against reactive oxygen species to exopolysaccharide synthesis. Our results provide new candidates for virulence-related proteins, whose abundance correlates with the induction of pathogenicity and virulence genes, such as hrpD6, hrpG, hrpB7, hpa1 and hrpX. The results present new potential targets against XAC to be investigated in further functional studies. © 2016 BSPP AND JOHN WILEY & SONS LTD.
Ainembabazi, John Herbert; Tripathi, Leena; Rusike, Joseph; Abdoulaye, Tahirou; Manyong, Victor
2015-01-01
Credible empirical evidence is scanty on the social implications of genetically modified (GM) crops in Africa, especially on vegetatively propagated crops. Little is known about the future success of introducing GM technologies into staple crops such as bananas, which are widely produced and consumed in the Great Lakes Region of Africa (GLA). GM banana has a potential to control the destructive banana Xanthomonas wilt disease. To gain a better understanding of future adoption and consumption of GM banana in the GLA countries which are yet to permit the production of GM crops; specifically, to evaluate the potential economic impacts of GM cultivars resistant to banana Xanthomonas wilt disease. The paper uses data collected from farmers, traders, agricultural extension agents and key informants in the GLA. We analyze the perceptions of the respondents about the adoption and consumption of GM crop. Economic surplus model is used to determine future economic benefits and costs of producing GM banana. On the release of GM banana for commercialization, the expected initial adoption rate ranges from 21 to 70%, while the ceiling adoption rate is up to 100%. Investment in the development of GM banana is economically viable. However, aggregate benefits vary substantially across the target countries ranging from US$ 20 million to 953 million, highest in countries where disease incidence and production losses are high, ranging from 51 to 83% of production. The findings support investment in the development of GM banana resistant to Xanthomonas wilt disease. The main beneficiaries of this technology development are farmers and consumers, although the latter benefit more than the former from reduced prices. Designing a participatory breeding program involving farmers and consumers signifies the successful adoption and consumption of GM banana in the target countries.
Directory of Open Access Journals (Sweden)
Guo-Feng Jiang
2013-09-01
Full Text Available It is well known that the type III secretion system (T3SS and type III (T3 effectors are essential for the pathogenicity of most bacterial phytopathogens and that the expression of T3SS and T3 effectors is suppressed in rich media but induced in minimal media and plants. To facilitate in-depth studies on T3SS and T3 effectors, it is crucial to establish a medium for T3 effector expression and secretion. Xanthomonas campestris pv. campestris (Xcc is a model bacterium for studying plant-pathogen interactions. To date no medium for Xcc T3 effector secretion has been defined. Here, we compared four minimal media (MME, MMX, XVM2, and XOM2 which are reported for T3 expression induction in Xanthomonas spp. and found that MME is most efficient for expression and secretion of Xcc T3 effectors. By optimization of carbon and nitrogen sources and pH value based on MME, we established XCM1 medium, which is about 3 times stronger than MME for Xcc T3 effectors secretion. We further optimized the concentration of phosphate, calcium, and magnesium in XCM1 and found that XCM1 with a lower concentration of magnesium (renamed as XCM2 is about 10 times as efficient as XCM1 (meanwhile, about 30 times stronger than MME. Thus, we established an inducing medium XCM2 which is preferred for T3 effector secretion in Xcc.
Directory of Open Access Journals (Sweden)
Nilvanira Donizeti Tebaldi
2007-12-01
Full Text Available A detecção, a transmissão e o efeito de Xanthomonas campestris pv. campestris (Xcc na qualidade fisiológica de sementes de brócolis (Brassica oleracea var. italica foram avaliados, a partir de sementes obtidas de plantas ("Baron, Flórida, Hana Midori Sakata, Precoce Piracicaba de Verão, Ramoso Santana e Sabre" inoculadas com a bactéria, em condições de campo. Para a detecção do patógeno nas sementes foram utilizados os meios de cultura semi-seletivos: SX ágar, NSCAA e BSCAA; a taxa de transmissão da bactéria pelas sementes às plântulas foi avaliada usando semeadura em areia e meio de cultura contido em tubo de ensaio. Para a avaliação da qualidade fisiológica de sementes foram realizados o teste padrão de germinação e os testes de vigor: envelhecimento acelerado, índice de velocidade de emergência, crescimento de plântulas e massa seca. De acordo com os resultados, o meio de cultura semi-seletivo NSCAA foi mais eficaz para detectar Xcc em sementes de brócolis; não houve diferença significativa entre os genótipos na taxa de transmissão da bactéria pelas sementes e Xcc não afetou a germinação e o vigor das sementes.The detection, transmission and the effect of Xanthomomas campestris pv. campestris (Xcc in the physiological quality of broccoli seeds were evaluated. The seeds were obtained from inoculated field plants (`Baron', `Flórida', `Hana Midori Sakata', `Precoce Piracicaba de Verão', `Ramoso Santana' and `Sabre' genotypes with the bacterium. For the seed pathogen detection the semi-selective medium were used: starch for xanthomonads (SX agar, nutrient starch cycloheximide antibiotic agar (NSCAA and basal starch cycloheximide antibiotic agar (BSCAA; the bacteria seeds transmission percentage was evaluated using sand and test tube. The physiological seed quality was evaluated by the standard germination and vigor tests: the accelerated aging, speed of emergence, seedling growth and seedling dry weight. The
Directory of Open Access Journals (Sweden)
Nilvanira Donizete Tebaldi
2007-09-01
Full Text Available A detecção, a transmissão e o efeito de Xanthomonas campestris pv. campestris (Xcc na qualidade fisiológica de sementes de brócolis (Brassica oleracea var. italica foram avaliadas, a partir de sementes obtidas de plantas ("Baron, Flórida, Hana Midori Sakata, Precoce Piracicaba de Verão, Ramoso Santana e Sabre" inoculadas com a bactéria, em condições de campo. Para a detecção do patógeno nas sementes foram utilizados os meios de cultura semi-seletivos: SX ágar, NSCAA e BSCAA; a taxa de transmissão da bactéria pelas sementes às plântulas foi avaliada usando semeadura em areia e meio de cultura contido em tubo de ensaio. Para a avaliação da qualidade fisiológica das sementes foram realizados o teste padrão de germinação e os testes de vigor: envelhecimento acelerado, índice de velocidade de emergência, crescimento das plântulas e massa seca. De acordo com os resultados, o meio de cultura semi-seletivo NSCAA foi mais eficaz para detectar Xcc em sementes de brócolis; não houve diferença significativa entre os genótipos na taxa de transmissão da bactéria pelas sementes e Xcc não afetou a germinação e o vigor das sementes.The detection, transmission and the effect of Xanthomomas campestris pv. campestris (Xcc in the physiological quality of broccoli seeds were evaluated. The seeds were obtained from inoculated field plants ('Baron', 'Flórida', 'Hana Midori Sakata', 'Precoce Piracicaba de Verão', 'Ramoso Santana' and 'Sabre' genotypes with the bacterium. For the seed pathogen detection the semi-selective medium were used: starch for xanthomonads (SX agar, nutrient starch cycloheximide antibiotic agar (NSCAA and basal starch cycloheximide antibiotic agar (BSCAA; the bacteria seeds transmission percentage was evaluated using sand and test tube. The physiological seed quality was evaluated by the standard germination and vigor tests: the accelerated aging, speed of emergence, seedling growth and seedling dry weight
Zuluaga, Paola; Szurek, Boris; Koebnik, Ralf; Kroj, Thomas; Morel, Jean-Benoit
2017-01-01
Plants are constantly challenged by a wide range of pathogens and have therefore evolved an array of mechanisms to defend against them. In response to these defense systems, pathogens have evolved strategies to avoid recognition and suppress plant defenses (Brown and Tellier, 2011). Three recent reports dealing with the resistance of rice to Xanthomonas oryzae have added a new twist to our understanding of this fascinating co-evolutionary arms race (Ji et al., 2016; Read et al., 2016; Triplett et al., 2016). They show that pathogens also develop sophisticated effector mimics to trick recognition.
Calloni, Juan; Paez, Sergio; Saldarini, Javier; Cuevas, Juan Carlos; Mulassano, Micaela; Bianciotti, Andrés; Scarello, Eduardo; Banchio, Leandro; Degiovanni, Federico; Scharff, Lucía
2017-01-01
Es de amplio conocimiento la utilización masiva de las distintas redes sociales. Éstas han cambiado los hábitos y características de la comunicación, tal como la facilidad de intercambio de información, la existencia de receptores globales y la accesibilidad de éstas tecnologías a todos los sectores sociales. Las actitudes violentas y peligrosas en redes sociales constituyen un campo de estudio objeto de varias disciplinas. Detectar este tipo de actitudes de manera temprana, colaboran a...
Surface layers of Xanthomonas malvacearum, the cause of bacterial blight of cotton.
Verma, J P; Formanek, H
1981-01-01
Mureins were isolated from two strains of Xanthomonas malvacearum, a phytopathogenic bacterium causing bacterial blight of cotton. The purity of murein was 70-95 % and the amino acid and amino sugar components (glutamic acid, alanina, meso-disminopimelic acid, muramic acid and glucosamine) were present at the molar ratio of 1:1.9:1:l.12.0.85. The bacterium secreted a copious amount of slime which masked itd surface structure. The slime was composed of densley interwoven network of filamentous material originating from the cell surface and extended into the medium without and discernable boundary. The slime was secreted through surface layers pores by force, giving the effect of a spray or jet. Slime also played a role in chain formatin of baterial cells.
Directory of Open Access Journals (Sweden)
Sandra Cristina Vigo
2009-12-01
Full Text Available A exploração da atividade biológica de compostos secundários presentes nas tinturas ou em óleos essenciais de plantas podem representar, ao lado da indução de resistência, mais uma forma potencial de controle de doenças em plantas cultivadas. O presente trabalho objetivou avaliar o potencial de tinturas de Lippia alba, Lippia sidoides, Mikania glomerata, Equisetum sp. e Hedera helix e óleos essenciais de Rosmarinus officinalis e Cinnamomum zeylanicum nas atividades in vitro, in vivo e na produção de proteínas na indução de resistência, em plantas de feijão vagem cultivar Bragança. Os resultados obtidos demonstraram que as tinturas de L. alba e L. sidoides e os óleos essenciais (R. officinalis e C. zeylanicum apresentaram atividade in vitro aos isolados de Xanthomonas axonopodis pv. phaseoli. Todas as tinturas ensaiadas apresentaram menores valores do progresso da doença (AACPD, em relação à testemunha, merecendo destaque a tintura de L. alba, que estavam correlacionadas com os maiores teores de polifenoloxidase, peroxidase e proteínas solúveis totais, evidenciando uma possível indução de resistência. Os óleos essenciais não apresentaram diferença na AACPD e nem na indução de proteínas.Additionally to resistance inducers, the exploitation of secondary compounds biological activity present in plants alcohol extracts or essential oils could potential way to control diseases in cultivated plants. This aimed to evaluate the potential of Lippia alba, Lippia sidoides, Mikania glomerata, Equisetum sp. and Hedera helix alcohol extracts and, Rosmarinus officinalis and Cinnamomum zeylanicum essential oils on in vitro and in vivo activity, and protein production on resistance induction in snap beans Bragança cultivar. Results showed in vitro activity against Xanthomonas axonopodis pv. phaseoli for L. alba and L. sidoides extracts, and essential oils. Although all alcohol extracts have showed the lowest area under the
Directory of Open Access Journals (Sweden)
Renata de Cássia Camara
2012-04-01
Full Text Available Assays were done under greenhouse conditions in order to evaluate the effect of pyraclostrobin (0.0375, 0.0750 and 0.150 mL.L-1 and acibenzolar-S-methyl (ASM (0.025 g.L-1 in common bacterial blight, using leaves of snap beans cultivar Bragança. These chemicals were sprayed at three different times: five days before; five days before + five days after; and five days after leaf inoculation with an isolate of Xanthomonas axonopodis pv. phaseoli. They were determinate the levels of polyphenoloxidase, peroxidase and total soluble proteins on inoculated and non-inoculated leaves of snap beans sprayed with pyraclostrobin (0.075 g.L-1 and ASM (0.025 g.L-1. All concentration of pyraclostrobin and ASM reduced the area under the disease progress curve (AUDPC on leaves of snap beans, and the least AUDPC value was observed when this products were sprayed five days before + five days after inoculation. Higher levels of polyphenoloxidase, peroxidase and the total soluble proteins were observed on leaves sprayed with pyraclostrobin or ASM.Ensaios foram conduzidos sob condições de casa-de-vegetação para avaliar o efeito de pyraclostrobin (0,0375; 0.0750 e 0,150 mL.L-1 e acibenzolar-S-methyl (ASM (0.025 g.L-1 sobre o crestamento bacteriano comum, em folhas de feijão-vagem cultivar Bragança. Os produtos foram pulverizados em três diferentes períodos: cinco dias antes, cinco dias antes + cinco dias após e cinco dias após a inoculação dos folíolos com um isolado de Xanthomonas axonopodis pv. phaseoli. Foram determinados os teores de polifenoloxidase, peroxidase e proteínas solúveis totais em folhas inoculadas e não-inoculadas de feijão-vagem pulverizadas com pyraclostrobin (0,075 g.L-1 e ASM (0,025 g.L-1. Todas as concentrações de pyraclostrobin e ASM reduziram os valores da área abaixo da curva do progresso da doença (AUPDC e o menor valor da AUPDC foi observado para a aplicação dos produtos cinco dias antes + cinco dias após a inocula
XocR, a LuxR solo required for virulence in Xanthomonas oryzae pv. oryzicola.
Xu, Huiyong; Zhao, Yancun; Qian, Guoliang; Liu, Fengquan
2015-01-01
Xanthomonas oryzae pv. oryzicola (Xoc) causes bacterial leaf streak (BLS) in rice, a serious bacterial disease of rice in Asia and parts of Africa. The virulence mechanisms of Xoc are not entirely clear and control measures for BLS are poorly developed. The solo LuxR proteins are widespread and shown to be involved in virulence in some plant associated bacteria (PAB). Here, we have cloned and characterized a PAB LuxR solo from Xoc, named as XocR. Mutation of xocR almost completely impaired the virulence ability of Xoc on host rice, but did not alter the ability to trigger HR (hypersensitive response, a programmed cell death) on non-host (plant) tobacco, suggesting the diversity of function of xocR in host and non-host plants. We also provide evidence to show that xocR is involved in the regulation of growth-independent cell motility in response to a yet-to-be-identified rice signal, as mutation of xocR impaired cell swimming motility of wild-type Rs105 in the presence but not absence of rice macerate. We further found that xocR regulated the transcription of two characterized virulence-associated genes (recN and trpE) in the presence of rice macerate. The promoter regions of recN and trpE possessed a potential binding motif (an imperfect pip box-like element) of XocR, raising the possibility that XocR might directly bind the promoter regions of these two genes to regulate their transcriptional activity. Our studies add a new member of PAB LuxR solos and also provide new insights into the role of PAB LuxR solo in the virulence of Xanthomonas species.
Directory of Open Access Journals (Sweden)
Denis de M. Diniz
2012-01-01
Full Text Available Foi estudada a otimização do processo de produção de goma xantana a partir de casca de cacau ou soro de leite como fonte de carbono, e determinou-se o rendimento da goma obtida pela bioconversão de casca de cacau e soro de leite com a Xanthomonas campestris 1182. A goma foi produzida em meios com potássio e nitrogênio a 25 °C, 250 rpm por 120 horas. Os rendimentos foram: 2,335 g.L-1 para a sacarose; 4,995 g.L-1 para a casca de cacau seca e 12,01 g.L-1 utilizando soro de leite. Portanto, é viável a produção de goma xantana utilizando fontes de carbono como a casca de cacau e o soro de leite.The optimization of the production process of xanthan gum from cocoa husks or milk whey as carbon source was studied, and the production rate of gum obtained by the bioconversion of cocoa pods and whey was determined, using Xanthomonas campestris 1182. The gum was produced in a medium with potassium and nitrogen at 25 °C, 250 rpm for 120 hours. The results were: 2.335 g.L-1 for sucrose; 4.995 g.L-1 for cocoa dry pods and 12.01 g.L-1 using whey. Therefore, the production of xanthan gum is feasible upon using carbon sources such as cocoa hulls and whey.
DEFF Research Database (Denmark)
Chan, JWYF; Maynard, Scott; Goodwin, PH
1998-01-01
A putative two-component signal transduction system was amplified and cloned from the plant pathogenic bacterium Xanthomonas campestris pv. phaseoli var. fuscans isolate BXPF65. The 620 bp amplified fragment was sequenced and analyzed with the BLAST Enhanced Alignment Utility (BEAUTY). BEAUTY...... that the putative histidine kinase has homology with conserved “transmitter” domains of sensor proteins in two-component signal transduction systems. RFLP analysis using the putative signal transduction system showed polymorphisms among the strains....
Deng, Yinyue; Liu, Xiaoling; Wu, Ji'en; Lee, Jasmine; Chen, Shaohua; Cheng, Yingying; Zhang, Chunyan; Zhang, Lian-Hui
2015-01-01
Plant pathogen Xanthomonas campestris pv. campestris produces cis-11-methyl-2-dodecenoic acid (diffusible signal factor [DSF]) as a cell-cell communication signal to regulate biofilm dispersal and virulence factor production. Previous studies have demonstrated that DSF biosynthesis is dependent on the presence of RpfF, an enoyl-coenzyme A (CoA) hydratase, but the DSF synthetic mechanism and the influence of the host plant on DSF biosynthesis are still not clear. We show here that exogenous ad...
Directory of Open Access Journals (Sweden)
Adriano Márcio Freire Silva
2013-03-01
Full Text Available O cancro bacteriano da videira é causado por Xanthomonas campestris pv. viticola (Xcv. Visando à limpeza clonal de mudas de 'Red Globe', foram estudados: tamanho ideal de ápices e gemas axilares para cultivo em meio de Galzy modificado (MGM; efeito da termoterapia (38ºC/30 dias; e ação de antibióticos na eliminação de Xcv em videiras infectadas. Os percentuais de contaminação por Xcv e de regeneração foram analisados, e as plantas obtidas foram indexadas em meio ágar nutritivo-dextrose-extrato de levedura-ampicilina (NYDAM, seguindo-se teste de patogenicidade. O cultivo de explantes com 3 mm possibilitou a obtenção de plantas livres da bactéria, com regeneração 14,3 vezes maior que explantes com 1 mm. A termoterapia de mudas infectadas, associada ao cultivo in vitro, não eliminou o patógeno. O cultivo de explantes com 10 mm, durante 40 dias em MGM + cefotaxima (300 mg L-1, proporcionou limpeza clonal das mudas. A indexação de plantas de videira regeneradas in vitro, quanto à infecção por Xcv utilizando NYDAM, seguida de teste de patogenicidade, é uma alternativa econômica e eficiente para produção de mudas de alta qualidade fitossanitária.Bacterial canker is caused by Xanthomonas campestris pv. viticola (Xcv. In order to eliminate Xcv from 'Red Globe' plants it was studied: optimal size of meristem tips and axillary buds for cultivation in modified Galzy's medium (MGM; effects of thermotherapy (38ºC/30 days; and action of antibiotics in the elimination of Xcv in infected grapevines. The percentages of contamination by Xcv and regeneration were analyzed and plants obtained were indexed using the semi-selective culture medium nutrient agar-dextrose-yeast extract-ampicilin (NYDAM followed by a pathogenicity test. The cultivation of 3 mm explants permitted to obtain plants free of bacteria with regeneration 14.3 times higher than 1 mm explants. The thermotherapy of infected plants associated to the in vitro culture
Czech Academy of Sciences Publication Activity Database
Beran, P.; Mráz, Ivan; Kokošková, B.; Bohatá, A.
2015-01-01
Roč. 141, č. 3 (2015), s. 617-621 ISSN 0929-1873 R&D Projects: GA MZe QH71229 Institutional support: RVO:60077344 Keywords : Oligonucleotides * atpD * Xanthomonas euvesicatoria * Lycopersicon esculentum Subject RIV: EE - Microbiology, Virology Impact factor: 1.494, year: 2015
Calloni, Juan Carlos; Degiovanni, Federico; Paez, Sergio; Scarello, Eduardo; Scharff, Lucia; Bianciotti, Andrés; Banchio, Leandro; Mulassano, Micaela; Francia, Federico; Saldarini, Javier; Cuevas, Juan Carlos
2016-01-01
[4 p.] il. Es de amplio conocimiento la utilización masiva de las distintas redes sociales. Éstas han cambiado los hábitos y características de la comunicación, tal como la facilidad de intercambio de información, la existencia de receptores globales y la accesibilidad de éstas tecnologías a todos los sectores sociales. Las actitudes violentas y peligrosas en redes sociales constituyen un campo de estudio objeto de varias disciplinas. Detectar este tipo de actitudes de manera temprana c...
Aparna, Gudlur; Chatterjee, Avradip; Sonti, Ramesh V; Sankaranarayanan, Rajan
2009-06-01
Xanthomonas oryzae pv oryzae (Xoo) causes bacterial blight, a serious disease of rice (Oryza sativa). LipA is a secretory virulence factor of Xoo, implicated in degradation of rice cell walls and the concomitant elicitation of innate immune responses, such as callose deposition and programmed cell death. Here, we present the high-resolution structural characterization of LipA that reveals an all-helical ligand binding module as a distinct functional attachment to the canonical hydrolase catalytic domain. We demonstrate that the enzyme binds to a glycoside ligand through a rigid pocket comprising distinct carbohydrate-specific and acyl chain recognition sites where the catalytic triad is situated 15 A from the anchored carbohydrate. Point mutations disrupting the carbohydrate anchor site or blocking the pocket, even at a considerable distance from the enzyme active site, can abrogate in planta LipA function, exemplified by loss of both virulence and the ability to elicit host defense responses. A high conservation of the module across genus Xanthomonas emphasizes the significance of this unique plant cell wall-degrading function for this important group of plant pathogenic bacteria. A comparison with the related structural families illustrates how a typical lipase is recruited to act on plant cell walls to promote virulence, thus providing a remarkable example of the emergence of novel functions around existing scaffolds for increased proficiency of pathogenesis during pathogen-plant coevolution.
Directory of Open Access Journals (Sweden)
Rončević Zorana Z.
2014-01-01
Full Text Available The biocontrol agents are a very promising alternative to synthetic pesticides that are presently used to control plant diseases caused by phytopathogenic microorganisms. Members of the Bacillus genera are soil bacteria that produce significant quantities of agriculturally important bioactive compounds. Production of these compounds can be improved by changing the nutritional and environmental conditions. The aim of this study was the optimization of medium composition, using response surface methodology, for the production of compounds effective against Xanthomonas campestris ATCC 13951 by Bacillus subtilis ATCC 6633. To study the production of antimicrobial compounds by selected Bacillus strain, the producing microorganisms were cultivated on nutrient broth. The inhibition zone diameter of 18.0 mm obtained by the diffusion-disc method indicated that the used Bacillus subtilis strain produces compounds with antimicrobial activity against Xanthomonas campestris ATCC 13951. To optimize the composition of the cultivation medium in terms of glycerol, sodium nitrite and phosphates content, experiments were carried out in accordance with Box-Behnken design, and optimization of multiple responses was performed using the concept of desirability function. The developed model predicted that the maximum inhibition zone diameter (26.23 mm against tested phytopathogen is achieved when the initial content of glycerol, sodium nitrite and phosphate were 50.00 g/L, 2.85 g/L and 11.00 g/L, respectively. To minimize the consumption of medium components and costs of effluents processing, additional optimization set was made. The techno-economic analysis of the obtained results has to be done to select optimal medium composition for industrial production of antimicrobial compounds.
Vicente, J G; Everett, B; Roberts, S J
2006-07-01
ABSTRACT Twenty-five Xanthomonas isolates, including some isolates received as either X. campestris pv. armoraciae or pv. raphani, caused discrete leaf spot symptoms when spray-inoculated onto at least one Brassica oleracea cultivar. Twelve of these isolates and four other Xanthomonas isolates were spray- and pin-inoculated onto 21 different plant species/cultivars including horseradish (Armoracia rusticana), radish (Raphanus sativus), and tomato (Lycopersicon esculentum). The remaining 13 leaf spot isolates were spray-inoculated onto a subset of 10 plant species/cultivars. The leaf spot isolates were very aggressive on several Brassica spp., radish, and tomato causing leaf spots and dark sunken lesions on the middle vein, petiole, and stem. Based on the differential reactions of several Brassica spp. and radish cultivars, the leaf spot isolates were divided into three races, with races 1 and 3 predominating. A differential series was established to determine the race-type of isolates and a gene-for-gene model based on the interaction of two avirulence genes in the pathogen races and two matching resistance genes in the differential hosts is proposed. Repetitive-DNA polymerase chain reaction-based fingerprinting was used to assess the genetic diversity of the leaf spot isolates and isolates of closely related Xanthomonas pathovars. Although there was variability within each race, the leaf spot isolates were clustered separately from the X. campestris pv. campestris isolates. We propose that X. campestris isolates that cause a nonvascular leaf spot disease on Brassica spp. should be identified as pv. raphani and not pv. armoraciae. Race-type strains and a neopathotype strain for X. campestris pv. raphani are proposed.
Kai-Huai Li; Yong-Hong Yu; Hui-Juan Dong; Wen-Bin Zhang; Jin-Cheng Ma; Hai-Hong Wang
2017-01-01
In bacteria, the metabolism of branched-chain amino acids (BCAAs) is tightly associated with branched-chain fatty acids (BCFAs) synthetic pathways. Although previous studies have reported on BCFAs biosynthesis, more detailed associations between BCAAs metabolism and BCFAs biosynthesis remain to be addressed. In this study, we deleted the ilvC gene, which encodes ketol-acid reductoisomerase in the BCAAs synthetic pathway, from the Xanthomonas campestris pv. campestris (Xcc) genome. We characte...
Virulence of Xanthomonas translucens pv. poae Isolated from Poa annua
Directory of Open Access Journals (Sweden)
Arielle Chaves
2013-03-01
Full Text Available Bacterial wilt is a vascular wilt disease caused by Xanthomonas translucens pv. poae that infects Poa annua, a grass that is commonly found on golf course greens throughout the world. Bacterial wilt causes symptoms of etiolation, wilting, and foliar necrosis. The damage is most prevalent during the summer and the pathogen can kill turf under conditions optimal for disease development. Fifteen isolates of X. translucens pv. poae were collected from northern regions in the United States and tested for virulence against P. annua. All 15 isolates were pathogenic on P. annua, but demonstrated variable levels of virulence when inoculated onto P. annua under greenhouse conditions. The isolates were divided into two virulence groups. The first group containing four isolates generally resulted in less than 40% mortality following inoculation. The second group, containing the other eleven isolates, produced between 90 and 100% mortality following inoculation. These results suggest that differences in the virulence of bacterial populations present on a golf course may result in more or less severe amounts of observed disease.
Vinaya, K; Kavitha, R; Ananda Kumar, C S; Benaka Prasad, S B; Chandrappa, S; Deepak, S A; Nanjunda Swamy, S; Umesha, S; Rangappa, K S
2009-01-01
Several 1-benzhydryl-sulfonyl-4-(3-(piperidin-4-yl)propyl)piperidine derivatives 8(a-j) were prepared by the treatment of substituted benzhydryl chlorides with 4-(3-(piperidin-4-yl)propyl)piperidine followed by N-sulfonation with sulfonyl chlorides in the presence of dry methylene dichloride and triethyl amine. The synthesized compounds were characterized by (1)H-NMR, IR, and elemental analysis. All the synthesized compounds were evaluated in vitro for their efficacy as antimicrobial agents by artificial inoculation technique against standard strains of two important bacterial viz., Xanthomonas axonopodis pv. vesicatoria and Ralstonia solanacearum as well as and two fungal pathogens namely Alternaria solani and Fusarium solani of tomato plants. We have briefly investigated the structure-activity relation studies and reveal that the nature of substitutions on benzhydryl ring and sulfonamide ring influences the antibacterial activity. Among the synthesized new compounds 8b, 8d, 8g, 8h, 8i, and 8j were showed significant potent antimicrobial activities compared to the standard drugs chloramphenicol, mancozeb.
Gomez Marciel, Aitor
2017-01-01
El aumento de la población, de la expectativa de vida y de los malos hábitos como el sedentarismo, la dieta inadecuada y la obesidad influyen directamente en la incidencia y prevalencia de diabetes mellitus en el mundo, caracterizándola como epidemia mundial. Según la Organización Mundial de la Salud, 422 millones de adultos tenían diabetes en 2014. El objetivo de este trabajo ha sido conocer el rol de enfermería para evitar y detectar complicaciones y comprobar si los cuidados que efectúa so...
International Nuclear Information System (INIS)
Biagi, C.M.R. de
1992-01-01
Detection of bacteriocin production was studied under distinct conditions using strains of plant pathogenic bacteria from the genera Erwinia, Pseudomonas and Xanthomonas. 58.06%, 79.31% and 40.00% of producing strains were found respectively in the three groups of bacteria using the 523 medium which was the best for the detection of bacteriocin production. Increasing agar concentrations added to the medium up to 1,5% improved the detection. The amount of medium added to the Petri dishes did not affect bacteriocin production. The longest incubation time (72 h.) improved the detection of haloes production. Ultra-violet irradiation in low dosages seems to improve the visualization of haloes production but this is dependent on the tested strains. (author)
Saratale, Rijuta G; Benelli, Giovanni; Kumar, Gopalakrishnan; Kim, Dong Su; Saratale, Ganesh D
2018-04-01
In recent years, the use of nanoparticle-based antimicrobials has been increased due to many advantages over conventional agrochemicals. This study investigates the utilization of common medicinal plant dandelion, Taraxacum officinale, for the synthesis of silver nanoparticles (TOL-AgNPs). AgNPs were evaluated for antimicrobial activity against two important phytopathogens, Xanthomonas axonopodis and Pseudomonas syringae. The morphology, size, and structure of TOL-AgNPs were characterized using UV-visible spectroscopy and X-ray diffraction (XRD). Fourier transform infrared spectroscopy (FT-IR) showed the presence of phytochemicals involved during synthesis of NPs. High-resolution transmission electron microscopy (HR-TEM) analysis shed light on the size of monodispersed spherical AgNPs ranging between 5 and 30 nm, with an average particle size of about 15 nm. The TOL-AgNPs (at 20 μg/mL concentration) showed significant antibacterial activity with significant growth inhibition of phytopathogens X. axonopodis (22.0 ± 0.84 mm) and P. syringae (19.5 ± 0.66 mm). The synthesized AgNPs had higher antibacterial activity in comparison with commercial AgNPs. Synergistic assays with standard antibiotics revealed that nanoformulations with tetracycline showed better broad-spectrum efficiency to control phytopathogens. They also possessed significant antioxidant potential in terms of ABTS (IC 50 = 45.6 μg/mL), DPPH (IC 50 = 56.1 μg/mL), and NO (IC 50 = 55.2 μg/mL) free radical scavenging activity. The TOL-AgNPs showed high cytotoxic effect against human liver cancer cells (HepG2). Overall, dandelion-mediated AgNPs synthesis can represent a novel approach to develop effective antimicrobial and anticancer drugs with a cheap and eco-friendly nature.
Lee, Boyoung; Lee, Soohyun; Ryu, Choong-Min
2012-07-01
Plants modulate defence signalling networks in response to different biotic stresses. The present study evaluated the effect of a phloem-sucking aphid on plant defence mechanisms in pepper (Capsicum annuum) during subsequent pathogen attacks on leaves and rhizosphere bacteria on roots. Plants were pretreated with aphids and/or the chemical trigger benzothiadiazol (BTH) 7 d before being challenged with two pathogenic bacteria, Xanthomonas axonopodis pv. vesicatoria (Xav) as a compatible pathogen and X. axonopodis pv. glycines (Xag) as an incompatible (non-host) pathogen. Disease severity was noticeably lower in aphid- and BTH + aphid-treated plants than in controls. Although treatment with BTH or aphids alone did not affect the hypersensitive response (HR) against Xag strain 8ra, the combination treatment had a synergistic effect on the HR. The aphid population was reduced by BTH pretreatment and by combination treatment with BTH and bacterial pathogens in a synergistic manner. Analysis of the expression of the defence-related genes Capsicum annum pathogenesis-related gene 9 (CaPR9), chitinase 2 (CaCHI2), SAR8·2 and Lipoxygenase1 (CaLOX1) revealed that aphid infestation resulted in the priming of the systemic defence responses against compatible and incompatible pathogens. Conversely, pre-challenge with the compatible pathogen Xav on pepper leaves significantly reduced aphid numbers. Aphid infestation increased the population of the beneficial Bacillus subtilis GB03 but reduced that of the pathogenic Ralstonia solanacearum SL1931. The expression of defence-related genes in the root and leaf after aphid feeding indicated that the above-ground aphid infestation elicited salicylic acid and jasmonic acid signalling throughout the whole plant. The findings of this study show that aphid feeding elicits plant resistance responses and attracts beneficial bacterial populations to help the plant cope with subsequent pathogen attacks.
Directory of Open Access Journals (Sweden)
Tzu-Pi Huang
Full Text Available Citrus bacterial canker caused by Xanthomonas axonopodis pv. citri is a devastating disease resulting in significant crop losses in various citrus cultivars worldwide. A biocontrol agent has not been recommended for this disease. To explore the potential of bacilli native to Taiwan to control this disease, Bacillus species with a broad spectrum of antagonistic activity against various phytopathogens were isolated from plant potting mixes, organic compost and the rhizosphere soil. Seven strains TKS1-1, OF3-16, SP4-17, HSP1, WG6-14, TLB7-7, and WP8-12 showing superior antagonistic activity were chosen for biopesticide development. The genetic identity based on 16S rDNA sequences indicated that all seven native strains were close relatives of the B. subtilis group and appeared to be discrete from the B. cereus group. DNA polymorphisms in strains WG6-14, SP4-17, TKS1-1, and WP8-12, as revealed by repetitive sequence-based PCR with the BOXA1R primers were similar to each other, but different from those of the respective Bacillus type strains. However, molecular typing of the strains using either tDNA-intergenic spacer regions or 16S-23S intergenic transcribed spacer regions was unable to differentiate the strains at the species level. Strains TKS1-1 and WG6-14 attenuated symptom development of citrus bacterial canker, which was found to be correlated with a reduction in colonization and biofilm formation by X. axonopodis pv. citri on leaf surfaces. The application of a Bacillus strain TKS1-1 endospore formulation to the leaf surfaces of citrus reduced the incidence of citrus bacterial canker and could prevent development of the disease.
Host range of Xanthomonas sp., causal agent of the false red stripe of sugarcane, among grasses
Mantovani, Elaine Spindola; Marini, Danyelle Cristine; Giglioti, Éder Antônio
2006-01-01
Falsa estria vermelha (FEV), uma nova doença causada por Xanthomonas sp., é diferente diferente de todas as outras doenças já descritas em cana-de-açúcar. Ela está distribuída por toda as principais regiões canavieiras do centro-sul do Brasil, mas ainda não foi detectada no norte e nordeste do Brasil nem em qualquer outro país. O presente estudo determinou a gama de culturas e plantas daninhas hospedeiras da bactéria dentre espécies pertencentes às gramíneas, através de inoculação por injeção...
Tayi, Lavanya; Maku, Roshan V.; Patel, Hitendra Kumar; Sonti, Ramesh V.
2016-01-01
Xanthomonas oryzae pv.oryzae (Xoo) causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs) like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bi...
Asiatic citrus canker (ACC) (caused by Xanthomonas citri subsp citri, Xcc) is a major disease of citrus in wet tropical and subtropical production regions. Screening for resistance is important to breeding programs. The objective of this study was to evaluate a detached leaf method to compare nine d...
Návrh a testování specifických primerů pro detekci karanténní bakterie Xanthomonas vesicatoria
Czech Academy of Sciences Publication Activity Database
Beran, Pavel; Mráz, Ivan
2011-01-01
Roč. 12, - (2011), s. 205-208 ISSN 0139-6013. [Aktuální poznatky v pěstování, šlechtění, ochraně rostlin a zpracování produktů. Brno, 15.11.2011-16.11.2011] R&D Projects: GA MZe QH71229 Institutional research plan: CEZ:AV0Z50510513 Keywords : Xanthomonas vesicatoria * PCR * detection * primers Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection
Directory of Open Access Journals (Sweden)
Francisco Ernesto Moreno-García
2014-12-01
Full Text Available El documento se basa en el desarrollo experimental de un sistema de medición y análisis de vibraciones para brindar un estudio de las más relevantes variables utilizadas en el análisis espectral de motores eléctricos, con el fin de detectar posibles fallas. Dicho sistema de análisis fue implementado en un banco de pruebas elaborado por el Grupo de Investigación en Automatización y Control (GIAC, de la Universidad Francisco de Paula Santander.
Uso de la técnica SSCP para detectar mutaciones puntuales del ADN mitocondrial humano
Directory of Open Access Journals (Sweden)
Alejandro Estrada-Cuzcano
2013-05-01
Full Text Available En el presente trabajo se evalúa la técnica de SSCP (polimorfismo de conformación de cadena individual de ADN para detectar mutaciones puntuales, tanto por su sensibilidad en la detección (alrededor 80% en condiciones ideales, como por su implementación fácil y económica. Se utilizaron como controles positivos y negativos, ADN de voluntarios caracterizados previamente para las mutaciones puntuales de 5 RFLPs mitocondriales. Para la optimización de la prueba fueron ensayadas concentraciones variables del tampón TBE (1X y 0,5X y del glicerol (10%, 5% y 0 en geles de poliacrilamida. Cuatro de los 5 RFLPs fueron detectados en las condiciones utilizadas y pueden ser usados en estudios de rutina sin usar enzimas de restricción. Además, la técnica SSCP permitió determinar mutaciones desconocidas en un segmento de 394 nucleótidos de la región hipervariable (HVI del ADNmt. Diferencias en correspondencia a los distintos haplotipos fueron detectados e incluso permitió discernir grupos dentro del mismo subtipo. La secuenciación de dos muestras del subtipo B1 con migración diferencial en SSCP, corroboró la existencia de siete nucleótidos distintos
Mutagenesis of Xanthomonas campestris and selection of strains with enhanced Xanthan production
International Nuclear Information System (INIS)
Kamal, F.; Mehrgan, H.; Mazaheri, M.; Mortazavi, A. R.
2003-01-01
Xanthan gum is microbial polysaccharide of great commercial importance as it has been unusual rheological properties in solution and consequent range of applications. In this study, a series of mutants were isolated from Xanthomonas PTSS 1473 by ethyl methanesulfonate mutagenesis. The polysaccharide yield of one mutant, XC1473E 2 , was 30% better than that of the parent strain. It also showed higher xanthan formation of glucose consumption rates compared to the parent strain. xanthan produced by the mutant and enhanced viscosity, higher pseudo plasticity and larger molecular weight. Since mutant XC1473E 2 appeared white on agar plates, it underwent pigment extraction with methanol. Contrary to the parent strain, the mutant showed no absorption at 443 nm, i.e. the wavelength related to yellow pigment. This finding suggested that yellow pigmentation and normal xanthan biosynthesis are not necessarily concurrent. In general, mutant ZC1473e 2 seems to be a strain with interesting characteristics for use in commercial production of Xanthan
Institute of Scientific and Technical Information of China (English)
Jifeng Zhu; Jing Wu; Lanfen Wang; Matthew W. Blair; Zhendong Zhu; Shumin Wang
2016-01-01
Common bacterial blight (CBB), caused by Xanthomonas axonopodis pv. phaseoli and Xanthomonas fuscans subsp. fuscans (Xff), is a worldwide disease of common bean (Phaseolus vulgaris L.). Longyundou 5, a Chinese cultivar in the Mesoamerican gene pool of common bean, displays resistance to the Xff strain XSC3-1. To identify the genetic mechanisms behind this resistance, we crossed Long 5 with a susceptible genotype to develop a mapping population of F2 plants. Plant resistance to CBB was identified at 14 and 21 days after inoculation with Xff strain XSC3-1. A major QTL at 14 and 21 days after inoculation was mapped on chromosome Pv10 with LOD scores of 6.41 and 5.35, respectively. This locus was associated with SAP6, a previously-identified and much-used dominant marker, but in a 4.2 cM interval between new codominant markers BMp10s174 and BMp10s244. Ten candidate genes were found between markers BMp10s174 and BMp10s244 on chromosome Pv10 and could encode defense response proteins responding to CBB pathogens. Four pairs each of epistatic QTL for CBB resistance were detected at 14 and 21 days after inoculation. Phenotypic variation explained by the epistatic QTL ranged from 7.19%to 12.15%and 7.72%to 8.80%at 14 and 21 days after inoculation, respectively. These results confirmed the importance of epistasis in CBB resistance in common bean. The adjacent markers found may be more efficient for marker assisted selection in common bean breeding for CBB resistance owing to their closer linkage to the target QTL.
Institute of Scientific and Technical Information of China (English)
Jifeng; Zhu; Jing; Wu; Lanfen; Wang; Matthew; W.Blair; Zhendong; Zhu; Shumin; Wang
2016-01-01
Common bacterial blight(CBB), caused by Xanthomonas axonopodis pv. phaseoli and Xanthomonas fuscans subsp. fuscans(Xff), is a worldwide disease of common bean(Phaseolus vulgaris L.).Longyundou 5, a Chinese cultivar in the Mesoamerican gene pool of common bean, displays resistance to the Xff strain XSC3-1. To identify the genetic mechanisms behind this resistance,we crossed Long 5 with a susceptible genotype to develop a mapping population of F2 plants.Plant resistance to CBB was identified at 14 and 21 days after inoculation with Xff strain XSC3-1.A major QTL at 14 and 21 days after inoculation was mapped on chromosome Pv10 with LOD scores of 6.41 and 5.35, respectively. This locus was associated with SAP6, a previouslyidentified and much-used dominant marker, but in a 4.2 cM interval between new codominant markers BMp10s174 and BMp10s244. Ten candidate genes were found between markers BMp10s174 and BMp10s244 on chromosome Pv10 and could encode defense response proteins responding to CBB pathogens. Four pairs each of epistatic QTL for CBB resistance were detected at 14 and 21 days after inoculation. Phenotypic variation explained by the epistatic QTL ranged from 7.19% to 12.15% and 7.72% to 8.80% at 14 and 21 days after inoculation, respectively. These results confirmed the importance of epistasis in CBB resistance in common bean. The adjacent markers found may be more efficient for marker assisted selection in common bean breeding for CBB resistance owing to their closer linkage to the target QTL.
Directory of Open Access Journals (Sweden)
Fábio Mathias Corrêa
2008-02-01
Full Text Available Para avaliar o efeito de métodos de inocuação de Xanthomonas vesicatoria (Doidge (9 em sementes de tomate sobre a qualidade da semente e transmissão da fitobactéria compararam-se os tratamentos: 1 inoculação a vácuo com suspensão de células de X. vesicatoria em STP (0,005M, pH 7,4 e NaCl 0,85%; 2 imersão por 24 horas em suspensão de células de X. vesicatoria em STP; 3 vácuo em solução STP; 4 imersão por 24 horas em STP; 5 imersão por 5 min. em álcool etílico e 6 semente original. As avaliações foram realizadas por testes de germinação e isolamentos em meio Nutriente Agar Modificado (NAM aos 1, 15, 30 e 45 dias após aplicação dos tratamentos. Em seguida, avaliou-se o efeito da umidade (4% e 8% e o armazenamento das sementes inoculadas e variações de umidade antes da realização dos testes sobre a sobrevivência e recuperação de X. vesicatoria. Os métodos de inoculação testados podem ser utilizados em trabalhos de rotina, porém, as sementes devem ser utilizadas até 30 dias após a inoculação a partir de quando ocorre uma redução acentuada na taxa de recuperação da fitobactéria. A umidade das sementes interfere na sobrevivência e na transmissão de X. vesicatoria pelas sementes de tomate.The efficiency of six methods of Xanthomonas vesicatoria (Doidge (9 inoculation on tomato seeds, and their effects on seed quality were tested : 1 vacuum inoculation with X. vesicatoria cell suspension in PB (0.005M, pH 7.4 e NaCl 0.85%; 2 immersion for 24 hours in with X. vesicatoria cell suspension and PB. 3 vacuum and saline solution in phosphate buffer; 4 immersion in PB for 24 hours; 5 seeds + ethanol; 6 control. Evaluations were performed for germination test and isolation in Modified Agar Nutrient (NAM at 1, 15, 30 and 45 days after treatments imposition. The moisture effect on the transmission of X. vesicatoria seeds inoculated under vacuum, followed or not by air drying at 30±1 ºC, until 4% and 8% moisture
DEFF Research Database (Denmark)
Wichmann, Fabienne; Asp, Torben; Widmer, Franko
2011-01-01
Xanthomonas translucens pv. graminis (Xtg) causes bacterial wilt, a severe disease of forage grasses such as Italian ryegrass (Lolium multiflorum Lam.). In order to gain a more detailed understanding of the genetic control of resistance mechanisms and to provide prerequisites for marker assisted...... selection, the partial transcriptomes of two Italian ryegrass genotypes, one resistant and one susceptible to bacterial wilt were compared at four time points after Xtg infection. A cDNA microarray developed from a perennial ryegrass (Lolium perenne) expressed sequence tag set consisting of 9,990 unique...
Robbins, Matthew D; Darrigues, Audrey; Sim, Sung-Chur; Masud, Mohammed Abu Taher; Francis, David M
2009-09-01
Bacterial spot of tomato is caused by four species of Xanthomonas. The accession PI 128216 (Solanum pimpinellifolium) displays a hypersensitive reaction (HR) to race T3 strains (predominantely Xanthomonas perforans). We developed an inbred backcross (IBC) population (BC(2)S(5), 178 families) derived from PI 128216 and OH88119 (S. lycopersicum) as the susceptible recurrent parent for simultaneous introgression and genetic analysis of the HR response. These IBC families were evaluated in the greenhouse for HR to race T3 strain Xcv761. The IBC population was genotyped with molecular markers distributed throughout the genome in order to identify candidate loci conferring resistance. We treated the IBC population as a hypothesis forming generation to guide validation in subsequent crosses. Nonparametric analysis identified an association between HR and markers clustered on chromosome 11 (P P > 0.002). Further analysis of the IBC population suggested that markers on chromosome 6 and 11 failed to assort independently, a phenomenon known as gametic phase disequilibrium. Therefore, to validate marker-trait linkages, resistant IBC plants were crossed with OH88119 and BC(3)F(2) progeny were evaluated for HR in the greenhouse. In these subsequent populations, the HR response was associated with the chromosome 11 markers (P 0.25). Independent F(2) families were developed by crossing resistant IBC lines to OH8245, OH88119, and OH7530. These populations were genotyped, organized into classes based on chromosome 11 markers, and evaluated for resistance in the field. The PI 128216 locus on chromosome 11 provided resistance that was dependent on gene dosage and genetic background. These results define a single locus, Rx-4, from PI 128216, which provides resistance to bacterial spot race T3, has additive gene action, and is located on chromosome 11.
Chamnongpol, S.; Mongkolsuk, S.; Vattanaviboon, P.; Fuangthong, M.
1995-01-01
The enzymes catalase and superoxide dismutase play major roles in protecting phytopathogenic bacteria from oxidative stress. In Xanthomonas species, these enzymes are regulated by both growth phase and oxygen tension. The highest enzyme levels were detected within 1 h of growth. Continued growth resulted in a decline of both enzyme activities. High oxygen tension was an inducing signal for both enzyme activities. An 80,000-Da monofunctional catalase and a manganese superoxide dismutase were t...
Phi, Quyet-Tien; Park, Yu-Mi; Seul, Keyung-Jo; Ryu, Choong-Min; Park, Seung-Hwan; Kim, Jong-Guk; Ghim, Sa-Youl
2010-12-01
Twenty-nine P. polymyxa strains isolated from rhizospheres of various crops were clustered into five genotypic groups on the basis of BOX-PCR analysis. The characteristics of several plant growth-promoting factors among the isolates revealed the distinct attributes in each allocated group. Under gnotobiotic conditions, inoculation of pepper roots with P. polymyxa isolates significantly increased the biomass in 17 of total 29 treated plants with untreated plants. Experiments on induced systemic resistance (ISR) against bacterial spot pathogen Xanthomonas axonopodis pv. vesicatoria in pepper by P. polymyxa strains were conducted and only one isolate (KNUC265) was selected. Further studies into ISR mediation by the KNUC265 strain against the soft-rot pathogen Erwinia carotovora subsp. carotovora in tobacco demonstrated that the tobacco seedlings exposed to either bacterial volatiles or diffusible metabolites exhibited a reduction in disease severity. In conclusion, ISR and plant growth promotion triggered by P. polymyxa isolates were systemically investigated on pepper for the first time. The P. polymyxa KNUC265 strain, which elicited both ISR and plant growth promotion, could be potentially used in improving the yield of pepper and possibly of other crops.
International Nuclear Information System (INIS)
Sittolin, I.M.
1982-04-01
A bacteriophage from the cabbage tissue infected with Xanthomonas campestris is described. The infection process is studied through a negative staining technique (PTA) and ultrathin section. The effect of Virazole, an antivirus agent, is tested. Radioautography showed that the phage presented a reasonable domain on the bacterial host genome since the beginning of the treatment. Sorological reactions indicated the induction of specific antibodies for the phage. (M.A.C.) [pt
Directory of Open Access Journals (Sweden)
Giuliano Degrassi
2014-12-01
Full Text Available The present work of nanocotoxicity wants to propose a new plant model starting from the rice plant. The model takes into consideration the impact of engineered nanoparticles (Ag, Co, Ni, CeO2, Fe3O4, TiO2 on rice plants that were weakened by infections of Xanthomonas oryzae pv oryzae bacteria. The results indicate that some NPs increase the rice sensitivity to the pathogen while others decrease the virulence of the pathogen towards rice. No-enrichment in component metal concentration is detected in above organs of rice, with exception of Ni-NPs treatment. An imbalance of major elements in infected rice crops treated with NPs was investigated.
Energy Technology Data Exchange (ETDEWEB)
Lim, Chan Ju; Lee, Ha Yeon; Kim, Woong Bom; Ahmad, Raza; Moon, Jae Sun; Kwon, Suk Yoon [Korea Research Institute of Beoscience and Biotechnology, Daejeon (Korea, Republic of); Kim, Dong Sub [Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of)
2010-09-15
Bacterial blight is one of the most serious diseases of rice (Oryza sativa L.), and it has been known that Xanthomonas oryzae pv. oryzae (Xoo) causes this disease symptom. To develop resistance rice cultivars against Xoo, 3,000 lines of M{sub 3}, which were irradiated with gamma ray, were tested by 'scissor-dip method' primarily, and 191 putative resistant lines were selected. In M{sub 4} generation, these lines were screened again with various ways such as measuring of symptom of bacterial blight in leaf, number of tiller, fresh weight, and phenotypic segregation ratio in next generation. Finally, six resistance lines were selected. RT-PCR analysis revealed that these lines displayed high level of R-genes such as Xa21, Pi36, and Pi-ta. These results indicate that mutations by gamma ray cause disruptions of regulatory signal transduction systems of these R-genes. Furthermore, these selected mutants could be useful for the development of rice cultivar resistant to Xoo.
Pathotype profile of Xanthomonas oryzae pv. oryzae isolates from North Sumatera
Noer, Z.; Hasanuddin; Lisnawita; Suryanto, D.
2018-02-01
The Bacterial blight disease caused by Xanthomonas oryzae pv. oryzae (Xoo) is one of the most important diseases and has caused crop failure in rice crops. This pathogen infects the leaves in all plant growth phases. The purpose of this study is to investigation 10 Xoo isolates pathotype obtained from North Sumatra based on their interactions with 10 near-isogenic rice lines (NIL) of IRRI. The results showed that there are 6 pathotypes of virulence in North Sumatra, they are; pathotype I with incompatible interaction to all Xa genes, pathotype II with compatible interaction to Xa1 and Xa3 genes, while it has incompatible interaction to other genes, pathotype III with compatible interaction to Xa1, Xa5, Xa7, Xa8, Xa10 and Xa11 genes, but it has incompatible interaction to other genes, pathotype IV with compatible interaction to all Xa genes, pathotype V with compatible interaction to Xa1 gene and incompatible interaction to other genes, and pathotype VI with compatible interaction to Xa3 gene and incompatible interaction to other genes. Based on the resistant genes in each individual Xa2, Xa4, and Xa21 genes are the combination of Xa genes which are most suitable for use in the development of rice cultivars in North Sumatra.
Directory of Open Access Journals (Sweden)
L. V. Brandão
2013-12-01
Full Text Available The production and rheological properties of xanthan gum from crude glycerin fermentation, a primary by-product of the biodiesel industry with environmental and health risks, were evaluated. Batch fermentations (28 °C/250 rpm /120 h were carried out using crude glycerin, 0.01% urea and 0.1% KH2PO4, (% w/v, and compared to a sucrose control under the same operational conditions, using Xanthomonas campestris strain 2103 isolate from Brazil. Its maximal production by crude glycerin fermentation was 7.23±0.1 g·L-1 at 120 h, with an apparent viscosity of 642.57 mPa·s, (2 % w/v, 25 °C, 25 s-1, 70% and 30% higher than from sucrose fermentation, respectively. Its molecular weight varied from 28.2 to 36.2×10(6 Da. The Ostwald-de-Waele model parameters (K and n indicated a pseudoplastic behavior at all concentrations (0.5 to 2.0 %, w/v and temperatures (25-85 °C, while its consistency index indicated promising rheological properties for drilling fluid applications. Therefore, crude glycerin has potential as a cost-effective and alternative substrate for non-food grade xanthan production.
Yu, Chao; Wang, Nu; Wu, Maosen; Tian, Fang; Chen, Huamin; Yang, Fenghuan; Yuan, Xiaochen; Yang, Ching-Hong; He, Chenyang
2016-11-08
To facilitate infection, Xanthomonas oryzae pv. oryzae (Xoo), the bacterial blight pathogen of rice, needs to degrade hydrogen peroxide (H 2 O 2 ) generated by the host defense response via a mechanism that is mediated by the transcriptional regulator OxyR. The catalase (CAT) gene catB has previously been shown to belong to the OxyR regulon in Xoo. However, its expression patterns and function in H 2 O 2 detoxification and bacterial pathogenicity on rice remain to be elucidated. The catB gene encodes a putative catalase and is highly conserved in the sequenced strains of Xanthomonas spp. β-galactosidase analysis and electrophoretic mobility shift assays (EMSA) showed that OxyR positively regulated the transcription of catB by directly binding to its promoter region. The quantitative real-time PCR (qRT-PCR) assays revealed that the expression levels of catB and oxyR were significantly induced by H 2 O 2 . Deletion of catB or oxyR drastically impaired bacterial viability in the presence of extracellular H 2 O 2 and reduced CAT activity, demonstrating that CatB and OxyR contribute to H 2 O 2 detoxification in Xoo. In addition, ΔcatB and ΔoxyR displayed shorter bacterial blight lesions and reduced bacterial growth in rice compared to the wild-type stain, indicating that CatB and OxyR play essential roles in the virulence of Xoo. Transcription of catB is enhanced by OxyR in response to exogenous H 2 O 2 . CatB functions as an active catalase that is required for the full virulence of Xoo in rice.
Pegos, Vanessa R.; Santos, Rodrigo M. L.; Medrano, Francisco J.
2017-01-01
In Escherichia coli, the ATP-Binding Cassette transporter for phosphate is encoded by the pstSCAB operon. PstS is the periplasmic component responsible for affinity and specificity of the system and has also been related to a regulatory role and chemotaxis during depletion of phosphate. Xanthomonas citri has two phosphate-binding proteins: PstS and PhoX, which are differentially expressed under phosphate limitation. In this work, we focused on PhoX characterization and comparison with PstS. The PhoX three-dimensional structure was solved in a closed conformation with a phosphate engulfed in the binding site pocket between two domains. Comparison between PhoX and PstS revealed that they originated from gene duplication, but despite their similarities they show significant differences in the region that interacts with the permeases. PMID:28542513
López Vázquez, José de Jesús
2013-01-01
La escaldadura de la hoja (Xanthomonas albilineans), es una de las enfermedades bacterianas de mayor importancia en el cultivo de caña de azúcar. Afecta la calidad del jugo y en variedades susceptibles ocasiona pérdidas estimadas entre el 90 y 100%. Con el objetivo fue caracterizar molecularmente el agente causal, evaluar el método apropiado de inoculación y evaluar la respuesta de 41 variedades de caña de azúcar a la escaldadura de la hoja. Las variedades fueron inoculadas en campo por tres ...
Directory of Open Access Journals (Sweden)
Herman Vildózola
2012-01-01
Full Text Available Objetivos: Determinar las diluciones y concentraciones optimas de una prueba de ELISA para detectar anticuerpos IgE, así como su sensibilidad, espécificidad y valor predictivo en pacientes con equinococosis quistica. Analizar si los niveles de anticuerpos IgE especificos se correlacionan con la respuesta al tratamiento médico con albendazol en un periodo mayor a un año de finalizado el tratamiento. Diseño: Estudio cuasiexperimental con grupo control. Institución: Instituto de Medicina Tropical Daniel A. Carrión, Facultad de Medicina, UNMSM, Lima, Perú. Material de estudio: Prueba de ELISA para anticuerpo IgE. Intervenciones: Estandarizacion de la prueba de ELISA para anticuerpo IgE y diseño preexperimento con preprueba y posprueba en un solo grupo, para evaluar su valor en el diagnóstico y seguimiento postratamiento de pacientes con quiste hidatidico hepatico tratados con albendazol. Para la estandarizacion de la prueba de ELISA, se utilizó suero de cinco pacientes con diagnóstico clínico de equinococosis quistica, y la sensibilidad y especificidad de la prueba se usó suero de 30 pacientes aparentemente sanos. Para determinar las reacciones cruzadas, se utilizó 16 muestras de suero de pacientes con otras helmintiasis (ascariasis, strongiloidiasis, toxocariosis, trichuriasis, himenolepiasis, cisticercosis y teniasis. Para el diagnóstico y seguimiento postratamiento de equinocococosis quística, se utilizó el suero de 17 pacientes. Principales medidas de resultados: Sensibilidad y especificidad de prueba estandarizada de ELISA para detectar anticuerpos IgE. Resultados: La prueba estandarizada de ELISA para detectar anticuerpos IgE tuvo una sensibilidad de 95,6% y una especificidad de 100%. En los pacientes con quiste hidatídico hepático considerados curados, uniformemente disminuyeron los niveles de anticuerpo tipo IgE hasta la negativización. Se obtuvo elevación de los niveles de IgE en los pacientes que presentaron
Directory of Open Access Journals (Sweden)
Vahideh Hasabi
2014-07-01
Full Text Available Asiatic citrus canker caused by Xanthomonas citri subsp. citri is becoming a disease of high economic impact, affecting all types of important citrus crops. In this study, the potential antibacterial activity of ten organic and inorganic salts on X. citri subsp. citri and on citrus canker disease development was evaluated. Among the salt compounds, copper, iron and zinc inorganic salts particularly zinc (with the highest diameter of inhibition, the lowest MIC and MBC values and the highest bacterial growth inhibitory effect had direct antibacterial activity and strongly reduced the development of canker disease and bacterial population of lime plants.
Directory of Open Access Journals (Sweden)
Andi Khaeruni
2013-06-01
Full Text Available Bacterial leaf blight caused by Xanthomonas oryzae pv. oryzae (Xoo is an important rice disease, and has caused significant economic losses. This research aimed to determine the pathotype grouping and the distribution of Xoo isolates of South and Southeast Sulawesi. In order to obtain the information, 61 Xoo isolates of South Sulawesi and 29 isolates of Southeast Sulawesi were evaluated for their pathotype grouping against 5 diffential varieties. Research results showed that in South Sulawesi there were 2 pathotype groups, namely pathotype IV (32.79% and pathotype VIII(67.21%. Pathotype VIII was widely distributed over the Western and Central areas of South Sulawesi, whereas pathotype IV was widely distributed over the Southern area. In Southeast Sulawesi, it was found 5 pathotypes, namely pathotypes IV (27.58%, VI (10.34%, VIII (13.79%, IX (20.68%, and X (27.58%, with a limited and scattered distribution pattern on several areas. These results indicate that Xoo pathotype groups in South Sulawesi and Southeast Sulawesi are varied and tend to sift to more virulent pathotypes.
Structure of a Novel N-acetyl-L-citrulline Deacetylase from Xanthomonas campestris
Energy Technology Data Exchange (ETDEWEB)
Shi,D.; Yu, X.; Roth, L.; Tuchman, M.; Allewell, N.
2007-01-01
The structure of a novel acetylcitrulline deacetylase from the plant pathogen Xanthomonas campestris has been solved by multiple-wavelength anomalous dispersion (MAD) using crystals grown from selenomethionine-substituted protein and refined at 1.75 {angstrom} resolution. The asymmetric unit of the crystal contains one monomer consisting of two domains, a catalytic domain and a dimerization domain. The catalytic domain is able to bind a single Co(II) ion at the active site with no change in confirmation. the dimerization domain forms an interface between two monomers related by a crystallographic two-fold symmetry axis. The interface is maintained by hydrophobic interactions between helices and hydrogen bonding between two {beta} strands that form a continuous {beta} sheet across the dimer interface. Because the dimers are also related by two-fold crystallographic axes, they pack together across the crystal via the dimerization domain, suggesting that higher order oligomers may form in solution. The polypeptide fold of the monomer is similar to the fold of Pseudomonas sp. carboxypeptidase G2 and Neisseria meningitidis succinyl diaminopimelate desuccinylase. Structural comparison among these enzymes allowed modeling of substrate binding and suggests a possible catalytic mechanism, in which Glu130 functions as a bifunctional general acid-base catalyst and the metal ion polarizes the carbonyl of the acetyl group.
Xanthan biosynthesis by Xanthomonas campestris ATCC 13951 on wastewaters from white grape processing
Directory of Open Access Journals (Sweden)
Rončević Zorana
2017-01-01
Full Text Available Wastewaters from grape processing in wineries are characterized by large seasonal fluctuations in volume and composition, and are often discarded into environment with little or no treatment. The biotechnological production of valuable products is the most promising alternative for reducing the negative environmental impact and recycling these effluents. Results from previous study show that mixed winery wastewaters, after additional optimization of the medium preparation, may be a suitable raw material for industrial xanthan production. Therefore, the aim of this work was to examine the possibility of xanthan production by Xanthomonas campestris ATCC 13951 on mixed wastewaters from different stages of white grape processing in winery with initial sugars content of 20 g/L. In addition to the media characteristics and indicators of biopolymer quality, raw xanthan yield and degree of sugars conversion into product were determined in order to examine the success of performed bioprocess. The results for biopolymer yield (14.66 g/L and sugars conversion into desired product (70.21% obtained in applied experimental conditions confirm that wastewaters from white grape processing have a great potential to be used as a substrate for xanthan biosynthesis.
Directory of Open Access Journals (Sweden)
Elaine Spindola Mantovani
2006-06-01
Full Text Available Falsa estria vermelha (FEV, uma nova doença causada por Xanthomonas sp., é diferente diferente de todas as outras doenças já descritas em cana-de-açúcar. Ela está distribuída por toda as principais regiões canavieiras do centro-sul do Brasil, mas ainda não foi detectada no norte e nordeste do Brasil nem em qualquer outro país. O presente estudo determinou a gama de culturas e plantas daninhas hospedeiras da bactéria dentre espécies pertencentes às gramíneas, através de inoculação por injeção e pulverização de suspensão bacteriana. Além da cana-de-açúcar, entre as 31 diferentes espécies estudadas, apenas sorgo, milho e aveia apresentaram sintomas, 15 dias após a inoculação. Em sorgo, no ponto de inoculação, apareceram estrias avermelhadas coalescentes. As folhas apresentaram típicas estrias vermelhas finas (1 mm, longas e paralelas às nervuras, com presença de exsudato bacteriano. Até mesmo as inflorescências apresentaram pontuações avermelhadas. Plantas de milho inoculadas com seringa apresentaram sintomas de anasarca e descoloração de tecidos ao redor do ponto de inoculação e estrias cloróticas (2-3 mm no limbo foliar; porém, sem exsudato de bactéria. Apenas folhas de cevada apresentaram sintomas quando inoculadas por pulverização. As lesões iniciais eram estrias e manchas de cor palha, evoluindo para uma necrose total das folhas, causando a morte das plantas. A partir de folhas sintomáticas de cana-de-açúcar, sorgo, milho e aveia, realizaram-se re-isolamentos, obtendo-se culturas puras de Xanthomonas sp. cuja identidade foi comprovada através de testes sorológicos e por Rep-PCR. Diante desses resultados, surge a necessidade de realização de inspeções e campos de cultivo de sorgo, milho e aveia para verificar a presença da bactéria da FEV e determinar se o patógeno pode infectar essas culturas naturalmente.False Red Stripe (FRS, a new disease caused by Xanthomonas sp., is different
Shedding light on the role of photosynthesis in pathogen colonization and host defense
Garavaglia, Betiana S.; Thomas, Ludivine; Gottig, Natalia; Zimaro, Tamara; Garofalo, Cecilia G.; Gehring, Christoph A; Ottado, Jorgelina
2010-01-01
The role of photosynthesis in plant defense is a fundamental question awaiting further molecular and physiological elucidation. To this end we investigated host responses to infection with the bacterial pathogen Xanthomonas axonopodis pv. citri, the pathogen responsible for citrus canker. This pathogen encodes a plant-like natriuretic peptide (XacPNP) that is expressed specifically during the infection process and prevents deterioration of the physiological condition of the infected tissue. Proteomic assays of citrus leaves infected with a XacPNP deletion mutant (DeltaXacPNP) resulted in a major reduction in photosynthetic proteins such as Rubisco, Rubisco activase and ATP synthase as a compared with infection with wild type bacteria. In contrast, infiltration of citrus leaves with recombinant XacPNP caused an increase in these host proteins and a concomitant increase in photosynthetic efficiency as measured by chlorophyll fluorescence assays. Reversion of the reduction in photosynthetic efficiency in citrus leaves infected with DeltaXacPNP was achieved by the application of XacPNP or Citrus sinensis PNP lending support to a case of molecular mimicry. Finally, given that DeltaXacPNP infection is less successful than infection with the wild type, it appears that reducing photosynthesis is an effective plant defense mechanism against biotrophic pathogens.
International Nuclear Information System (INIS)
Perez Quintero, Alvaro; Lopez, Camilo
2013-01-01
MicroRNAs (miRNAs) are a group of small non coding MAS involved in the control of gene expression through the degradation of miRNAs in a sequence specific manner, miRNAs expression is dependent on RNA polymerase ii as most of the coding protein genes. The regulation of miRNAs expression is under the coordinated and combinatorial control of transcription factors (TFS). A bioinformatics approach was carried out to identify transcription factor binding sites (TFBS) in the promoter of miRNAs genes in 17 different plant species and the possible involvement of TF in antibacterial response was analyzed. In nine of the plants studied significant differences in TFBS distribution in the promoter of miRNAs were observed when compare to the promoter of protein coding genes. TFBS as CCA1, T-box y SORLREP3 were present on the promoters of the cassava miRNAs induced in response to the infection by the bacteria Xanthomonas axonopodis pv. manihotis. These TFBS are also present in the promoter of genes coding for proteins involved in circadian rhythm and light responses, suggesting a crosstalk between these process and immune plant responses. Taken together, the results here described give insight about the transcriptional mechanisms involved in the expression of miRNAs.
Genetic diversity of citrus bacterial canker pathogens preserved in herbarium specimens.
Li, Wenbin; Song, Qijian; Brlansky, Ronald H; Hartung, John S
2007-11-20
Citrus bacterial canker (CBC) caused by Xanthomonas axonopodis pv. citri (Xac) was first documented in India and Java in the mid 19th century. Since that time, the known distribution of the disease has steadily increased. Concurrent with the dispersion of the pathogen, the diversity of described strains continues to increase, with novel strains appearing in Saudi Arabia, Iran, and Florida in the last decade. Herbarium specimens of infected plants provide an historical record documenting both the geographic distribution and genetic diversity of the pathogen in the past. However, no method was available to assess the genetic diversity within these herbarium samples. We have developed a method, insertion event scanning (IES), and applied the method to characterize the diversity present within CBC populations documented as herbarium specimens over the past century. IES is based on the specific amplification of junction fragments that define insertion events. The potential for IES in current forensic applications is demonstrated by finding an exact match of pathogen genotypes preserved in herbarium specimens from Japan and Florida, demonstrating the source of the original outbreak of citrus canker in Florida in 1911. IES is a very sensitive technique for differentiating bacterial strains and can be applied to any of the several hundred bacteria for which full genomic sequence data are available.
Shedding light on the role of photosynthesis in pathogen colonization and host defense
Garavaglia, Betiana S.
2010-09-01
The role of photosynthesis in plant defense is a fundamental question awaiting further molecular and physiological elucidation. To this end we investigated host responses to infection with the bacterial pathogen Xanthomonas axonopodis pv. citri, the pathogen responsible for citrus canker. This pathogen encodes a plant-like natriuretic peptide (XacPNP) that is expressed specifically during the infection process and prevents deterioration of the physiological condition of the infected tissue. Proteomic assays of citrus leaves infected with a XacPNP deletion mutant (DeltaXacPNP) resulted in a major reduction in photosynthetic proteins such as Rubisco, Rubisco activase and ATP synthase as a compared with infection with wild type bacteria. In contrast, infiltration of citrus leaves with recombinant XacPNP caused an increase in these host proteins and a concomitant increase in photosynthetic efficiency as measured by chlorophyll fluorescence assays. Reversion of the reduction in photosynthetic efficiency in citrus leaves infected with DeltaXacPNP was achieved by the application of XacPNP or Citrus sinensis PNP lending support to a case of molecular mimicry. Finally, given that DeltaXacPNP infection is less successful than infection with the wild type, it appears that reducing photosynthesis is an effective plant defense mechanism against biotrophic pathogens.
Strategy of gene silencing in cassava for validation of resistance genes
International Nuclear Information System (INIS)
Cortes, Simon; Lopez, Camilo
2010-01-01
Cassava (Manihot esculenta) is a major source of food for more than 1000 million people in the world and constitutes an important staple crop. Cassava bacterial blight, caused by the gram negative bacterium Xanthomonas axonopodis pv. manihotis, is one of the most important constraints for this crop. A candidate resistance gene against cassava bacterial blight, named RXam1, has been identified previously. In this work, we employed the gene silencing approach using the African cassava mosaic virus (ACMV) to validate the function of the RXam1 gene. We used as positive control the su gen, which produce photo blanching in leaves when is silenced. Plants from the SG10735 variety were bombardment with the ACMV-A-SU+ACMV-B y ACMV-A-RXam1+ACMV-B constructions. The silencing efficiency employing the su gene was low, only one of seven plants showed photo blanching. In the putative silenced plants for the RXam1 gene, no presence of siRNAs corresponding to RXam1 was observed; although a low diminution of the RXam1 gene expression was obtained. The growth curves for the Xam strain CIO136 in cassava plants inoculated showing a little but no significance difference in the susceptibility in the silenced plants compared to not silenced
Limpeza clonal de mudas de videira infectadas por Xanthomonas campestris pv. viticola
Directory of Open Access Journals (Sweden)
Adriano Márcio Freire Silva
2013-03-01
Full Text Available O cancro bacteriano da videira é causado por Xanthomonas campestris pv. viticola (Xcv. Visando à limpeza clonal de mudas de 'Red Globe', foram estudados: tamanho ideal de ápices e gemas axilares para cultivo em meio de Galzy modificado (MGM; efeito da termoterapia (38ºC/30 dias; e ação de antibióticos na eliminação de Xcv em videiras infectadas. Os percentuais de contaminação por Xcv e de regeneração foram analisados, e as plantas obtidas foram indexadas em meio ágar nutritivo-dextrose-extrato de levedura-ampicilina (NYDAM, seguindo-se teste de patogenicidade. O cultivo de explantes com 3 mm possibilitou a obtenção de plantas livres da bactéria, com regeneração 14,3 vezes maior que explantes com 1 mm. A termoterapia de mudas infectadas, associada ao cultivo in vitro, não eliminou o patógeno. O cultivo de explantes com 10 mm, durante 40 dias em MGM + cefotaxima (300 mg L-1, proporcionou limpeza clonal das mudas. A indexação de plantas de videira regeneradas in vitro, quanto à infecção por Xcv utilizando NYDAM, seguida de teste de patogenicidade, é uma alternativa econômica e eficiente para produção de mudas de alta qualidade fitossanitária.
Cerutti, Aude; Jauneau, Alain; Auriac, Marie-Christine; Lauber, Emmanuelle; Martinez, Yves; Chiarenza, Serge; Leonhardt, Nathalie; Berthomé, Richard; Noël, Laurent D
2017-06-01
Hydathodes are water pores found on leaves of a wide range of vascular plants and are the sites of guttation. We report here on the detailed anatomy of cauliflower ( Brassica oleracea ) and Arabidopsis ( Arabidopsis thaliana ) hydathodes. Hydathode surface presents pores resembling stomata giving access to large cavities. Beneath, the epithem is composed of a lacunar and highly vascularized parenchyma offering a direct connection between leaf surface and xylem vessels. Arabidopsis hydathode pores were responsive to ABA and light similar to stomata. The flg22 flagellin peptide, a well-characterized elicitor of plant basal immunity, did not induce closure of hydathode pores in contrast to stomata. Because hydathodes are natural infection routes for several pathogens, we investigated hydathode infection by the adapted vascular phytopathogenic bacterium Xanthomonas campestris pv campestris ( Xcc ), the causal agent of black rot disease of Brassicaceae. Microscopic observations of hydathodes six days postinoculation indicated a digestion of the epithem cells and a high bacterial multiplication. Postinvasive immunity was shown to limit pathogen growth in the epithem and is actively suppressed by the type III secretion system and its effector proteins. Altogether, these results give a detailed anatomic description of Brassicaceae hydathodes and highlight the efficient use of this tissue as an initial niche for subsequent vascular systemic dissemination of Xcc in distant plant tissues. © 2017 American Society of Plant Biologists. All Rights Reserved.
Directory of Open Access Journals (Sweden)
Bernadete Reis
2008-06-01
Full Text Available Porta-enxertos de citros podem exercer influência sobre a produção de frutos e suscetibilidade das plantas ao cancro cítrico. Este trabalho objetivou selecionar porta-enxertos que induzam elevado índice de produtividade e menor suscetibilidade das copas de laranjeiras-de-umbigo "Monte Parnaso"(Citrus sinensis à bactéria Xanthomonas axonopodis pv. citri, causadora do cancro cítrico (CC. O experimento foi desenvolvido em um pomar experimental com 10 anos de idade, plantado em espaçamento de 2,5 x 6,0m, no município de Butiá, no Estado do Rio Grande do Sul. O delineamento experimental foi em blocos ao acaso, com sete tratamentos e quatro repetições, usando duas plantas por parcela. Os tratamentos constaram dos seguintes porta-enxertos: limoeiros "Cravo" (C. limonia e "Volkameriano" (C. volkameriana., trifoliata "Flying Dragon" (Poncirus trifoliata., laranjeira "Caipira" (C. sinensis, citrangeiro "Troyer" (C. sinensis x P. trifoliata, tangerineira "Sunki" (C. sunki. e citrumeleiro "Swingle" (C. paradisi x P. trifoliata. Os parâmetros avaliados foram: incidência de CC em folhas e frutos em toda a planta e em ramos previamente selecionados, em diversas épocas. Verificou-se que as plantas enxertadas sobre citrumeleiro "Swingle" apresentaram o maior índice de produtividade e, à semelhança do "Flying Dragon", a menor incidência de CC, tanto nas folhas como nos frutos. Além disso, verificou-se também que as plantas enxertadas sobre os limoeiros "Cravo" e "Volkameriana", apesar de produzirem as mais elevadas cargas de frutos, foram as mais suscetíveis ao CC.Citrus rootstocks can exert some influences on fruit production and susceptibility of the plants to citrus canker (CC. This research was performed aiming to select rootstocks which induce higher productivity index and lower susceptibility of 'Monte Parnaso' navel orange (Citrus sinensis trees to the bacteria Xanthomonas axonopodis pv. citri. The research was carried out in an
International Nuclear Information System (INIS)
Chin, Ko-Hsin; Huang, Zhao-Wei; Wei, Kun-Chou; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Gao, Fei Philip; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A conserved hypothetical protein XC1692 from X. campestris pv. campestris has been overexpressed in E. coli. The purified recombinant protein crystallized in a variety of forms and diffracted to a resolution of at least 1.45 Å. Xanthomonas campestris pv. campestris strain 17 is a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. Its genome contains approximately 4500 genes, one third of which have no known structure and/or function yet are highly conserved among several different bacterial genuses. One of these gene products is XC1692 protein, containing 141 amino acids. It was overexpressed in Escherichia coli, purified and crystallized in a variety of forms using the hanging-drop vapour-diffusion method. The crystals diffract to at least 1.45 Å resolution. They are hexagonal and belong to space group P6 3 , with unit-cell parameters a = b = 56.9, c = 71.0 Å. They contain one molecule per asymmetric unit
Directory of Open Access Journals (Sweden)
Alejandra V. Quiroga
2013-01-01
Full Text Available El objetivo de este trabajo fue diseñar una evaluación diagnóstica que permita detectar tempranamente a aquellos alumnos con dificultades de aprendizaje e incluirlos en distintas instancias de apoyo ofrecidas por la Facultad de Ciencias Agrarias y Forestales de la Universidad Nacional de La Plata. La evaluación diagnóstica fue construida utilizando analogías de conceptos químicos que serán estudiados en el curso de Química General e Inorgánica. El uso de analogías es ampliamente utilizado en la enseñanza de la química y juega un papel importante en el proceso de enseñanza-aprendizaje de las ciencias. Se comparó el desempeño alcanzado en la evaluación diagnóstica con el resultado del primer parcial de Química General e Inorgánica y con el resultado obtenido en el examen de ingreso. Se puede concluir que la evaluación diagnóstica diseñada sería una herramienta fundamental para seleccionar potenciales participantes para el sistema de tutorías que se lleva a cabo en la Facultad de Ciencias Agrarias y Forestales.
Kim, Hong-Il; Noh, Tae-Hwan; Lee, Chang-Soo; Park, Young-Jin
2015-01-01
Xanthomonas oryzae pv. oryzae (Xoo) causes bacterial blight (BB) in rice. To study its function, a random insertion mutation library of Xoo was constructed using the Tn5 transposon. A mutant strain with decreased virulence against the susceptible rice cultivar IR24 was isolated from the library (aroE mutant), which also had extremely low pigment production. Thermal asymmetric interlaced-polymerase chain reaction (TAIL-PCR) and sequence analysis of the mutant revealed that the transposon was inserted into the aroE gene (encoding shikimate dehydrogenase). To investigate gene expression changes in the pigment- and virulence-deficient mutant, DNA microarray analysis was performed, which showed downregulation of 20 genes involved in the chemotaxis of Xoo. Our findings reveal that mutation of the aroE gene affects virulence and pigment production, as well as expression of genes involved in Xoo chemotaxis. Copyright © 2014 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Sayonara M.P. Assis
1999-07-01
Full Text Available Twenty yeast isolates, obtained from cabbage phylloplane, were evaluated for antagonistic activity against Xanthomonas campestris pv. campestris, in field. Plants of cabbage cv. Midori were pulverized simultaneously with suspensions of antagonists and pathogen. After 10 days, plants were evaluated through percentage of foliar area with lesions. Percentage of disease severity reduction (DSR% was also calculated. Yeast isolates LR32, LR42 and LR19 showed, respectively, 72, 75 and 79% of DSR. These antagonists were tested in seven different application periods in relation to pathogen inoculation (T1=4 d before; T2=simultaneously; T3=4 d after; T4=4 d before + simultaneously; T5=4 d after + simultaneously; T6=4 d before + 4 d after; T7=4 d before + simultaneously + 4 d after. The highest DSRs were showed by LR42 (71%, LR42 (67%, LR35 (69% and LR19 (68% in the treatments T7, T4, T5 and T6, which significantly differed from the others. The same yeast antagonists were also tested for black rot control using different cabbage cultivars (Fuyutoyo, Master-325, Matsukaze, Midori, Sekai I and Red Winner. The DSRs varied from 58 to 61%, and there was no significant difference among cultivars.Vinte isolados de leveduras, obtidos a partir do filoplano de repolho foram avaliados pela atividade antagônica contra Xanthomonas campestris pv. campestris, em condições de campo. Plantas de repolho cv. Midori foram pulverizadas simultaneamente com suspensões do antagonista e do patógeno. Após 10 dias, as plantas foram avaliadas através da porcentagem de área foliar infectada. A porcentagem de redução da severidade da doença (DSR%, também foi calculada. Os isolados de leveduras LR32, LR42 e LR19 apresentaram, respectivamente, 72, 75 e 79% de DSR. Estes isolados foram testados em sete diferentes períodos de aplicação dos antagonistas em relação a inoculação do patógeno. (T1=4d antes; T2=simultaneamente; T3=4 d após; T4=4 d antes + simultaneamente; T5
Directory of Open Access Journals (Sweden)
Tian Xia
Full Text Available Xanthomonas citri subsp. citri causes citrus canker disease, which is characterized by the formation of water-soaked lesions, white or yellow spongy pustules and brown corky canker. In this work, we report the contribution of extracellular endoglucanase to canker development during infection. The ectopic expression of nine putative cellulases in Escherichia coli indicated that two endoglucanases, BglC3 and EngXCA, show carboxymethyl cellulase activity. Both bglC3 and engXCA genes were transcribed in X. citri subsp. citri, however, only BglC3 protein was detected outside the cell in western blot analysis. The deletion of bglC3 gene resulted in complete loss of extracellular carboxymethyl cellulase activity and delayed the onset of canker symptoms in both infiltration- and wound-inoculation assays. When growing in plant tissue, the cell density of bglC3 mutant was lower than that of the wild type. Our data demonstrated that BglC3 is an extracellular endoglucanase required for the full virulence of X. citri subsp. citri.
International Nuclear Information System (INIS)
Watanabe, Minoru; Samejima, Shin-ichi; Hosokawa, Daijiro
1980-01-01
Accumulation of 14 C-photosynthetic assimilates in rice leaves infected with Xanthomonas campestris pv. oryzae was studied by using autoradiography for the purpose of elucidating the movement of nutrients from healthy tissues to the infected parts. When rice plants were exposed to 14 CO 2 immediately after inoculation, 14 C-photosynthetic assimilates did not accumulate in and around the inoculated spots of leaves until the lesions became visible, i.e., approximately 7 days after inoculation. When the leaves were exposed to 14 CO 2 before visible lesions appeared, 2 and 5 days after inoculation, the assimilates did not accumulate in the inoculated areas, but apparently accumulated in the lesions 24 hr later on from the exposure of leaves with visible lesions. In the newly formed lesions, accumulation site corresponded to the yellow streak parts of lesions along leaf veins. In the large and old lesions, assimilates hardly any accumulated in the center of lesions, grayish-white in color, but accumulated in the border parts of lesions adjacent to healthy tissues which are developing and yellow streak in symptoms. (author)
Directory of Open Access Journals (Sweden)
SOLANGE TERESINHA CARPES
2009-12-01
Full Text Available
A descoberta de que certos alimentos podem prevenir doenças iniciou uma revolução nas áreas de nutrição, farmácia, medicina e ciência de alimentos. Dentro deste contexto, o pólen apÃcola é considerado uma excelente fonte nutricional benéfi ca a saúde, principalmente pela presença de compostos fenólicos com atividade antioxidante. Poucos estudos têm sido feitos sobre o seu potencial antimicrobiano. Neste estudo, extratos de 36 amostras de pólen apÃcola desidratado de diferentes localidades da região Sul do Brasil foram submetidos à análise da atividade antimicrobiana por difusão em ágar, concentração inibitória mÃnima (CIM e concentração bactericida mÃnima (CBM. Nesses testes foram utilizados nove microorganismos (Bacillus subitilis ATCC 21.332, Pseudomonas aeruginosa ATCC 15.442, Streptococcus mutans Ingbritt 1600, Staphylococcus aureus ATCC 25.923, Klebsiella pneumoniae, Agrobacterium tumefaciens, Xanthomonas vesicatoria pv vesicatoria, Xanthomonas axonopodis pv. vesicatoria e Pseudomonas syringae pv. tomato. Nenhum dos extratos etanólicos de pólen apÃcola inibiu o crescimento dos micro-organismos no teste de difusão ágar. Os extratos também não apresentaram atividade inibitória nem bactericida pelos testes de CIM e CBM. Apesar dos extratos de pólen apÃcola da região Sul do Brasil apresentar alto teor de compostos fenólicos e fl avonóides, estes não foram capazes de inibir o crescimento dos micro-organismos pelos métodos utilizados.
Cerutti, Aude; Jauneau, Alain; Auriac, Marie-Christine; Lauber, Emmanuelle; Martinez, Yves; Chiarenza, Serge
2017-01-01
Hydathodes are water pores found on leaves of a wide range of vascular plants and are the sites of guttation. We report here on the detailed anatomy of cauliflower (Brassica oleracea) and Arabidopsis (Arabidopsis thaliana) hydathodes. Hydathode surface presents pores resembling stomata giving access to large cavities. Beneath, the epithem is composed of a lacunar and highly vascularized parenchyma offering a direct connection between leaf surface and xylem vessels. Arabidopsis hydathode pores were responsive to ABA and light similar to stomata. The flg22 flagellin peptide, a well-characterized elicitor of plant basal immunity, did not induce closure of hydathode pores in contrast to stomata. Because hydathodes are natural infection routes for several pathogens, we investigated hydathode infection by the adapted vascular phytopathogenic bacterium Xanthomonas campestris pv campestris (Xcc), the causal agent of black rot disease of Brassicaceae. Microscopic observations of hydathodes six days postinoculation indicated a digestion of the epithem cells and a high bacterial multiplication. Postinvasive immunity was shown to limit pathogen growth in the epithem and is actively suppressed by the type III secretion system and its effector proteins. Altogether, these results give a detailed anatomic description of Brassicaceae hydathodes and highlight the efficient use of this tissue as an initial niche for subsequent vascular systemic dissemination of Xcc in distant plant tissues. PMID:28184011
Ocsoy, Ismail; Paret, Mathews L; Ocsoy, Muserref Arslan; Kunwar, Sanju; Chen, Tao; You, Mingxu; Tan, Weihong
2013-10-22
Bacterial spot caused by Xanthomonas perforans is a major disease of tomatoes, leading to reduction in production by 10-50%. While copper (Cu)-based bactericides have been used for disease management, most of the X. perforans strains isolated from tomatoes in Florida and other locations worldwide are Cu-resistant. We have developed DNA-directed silver (Ag) nanoparticles (NPs) grown on graphene oxide (GO). These Ag@dsDNA@GO composites effectively decrease X. perforans cell viability in culture and on plants. At the very low concentration of 16 ppm of Ag@dsDNA@GO, composites show excellent antibacterial capability in culture with significant advantages in improved stability, enhanced antibacterial activity, and stronger adsorption properties. Application of Ag@dsDNA@GO at 100 ppm on tomato transplants in a greenhouse experiment significantly reduced the severity of bacterial spot disease compared to untreated plants, giving results similar to those of the current grower standard treatment, with no phytotoxicity.
Volatile antimicrobials from Muscodor crispans, a novel endophytic fungus.
Mitchell, Angela M; Strobel, Gary A; Moore, Emily; Robison, Richard; Sears, Joe
2010-01-01
Muscodor crispans is a recently described novel endophytic fungus of Ananas ananassoides (wild pineapple) growing in the Bolivian Amazon Basin. The fungus produces a mixture of volatile organic compounds (VOCs); some of the major components of this mixture, as determined by GC/MS, are propanoic acid, 2-methyl-, methyl ester; propanoic acid, 2-methyl-; 1-butanol, 3-methyl-;1-butanol, 3-methyl-, acetate; propanoic acid, 2-methyl-, 2-methylbutyl ester; and ethanol. The fungus does not, however, produce naphthalene or azulene derivatives as has been observed with many other members of the genus Muscodor. The mixture of VOCs produced by M. crispans cultures possesses antibiotic properties, as does an artificial mixture of a majority of the components. The VOCs of the fungus are effective against a wide range of plant pathogens, including the fungi Pythium ultimum, Phytophthora cinnamomi, Sclerotinia sclerotiorum and Mycosphaerella fijiensis (the black sigatoka pathogen of bananas), and the serious bacterial pathogen of citrus, Xanthomonas axonopodis pv. citri. In addition, the VOCs of M. crispans killed several human pathogens, including Yersinia pestis, Mycobacterium tuberculosis and Staphylococcus aureus. Artificial mixtures of the fungal VOCs were both inhibitory and lethal to a number of human and plant pathogens, including three drug-resistant strains of Mycobacterium tuberculosis. The gaseous products of Muscodor crispans potentially could prove to be beneficial in the fields of medicine, agriculture, and industry.
Defense reactions of bean genotypes to bacterial pathogens in controlled conditions
Uysal, B.; Bastas, K. K.
2018-03-01
This study was focused on the role of antioxidant enzymes and total protein in imparting resistance against common bacterial blight caused by Xanthomonas axonopodis pv. phaseoli (Xap) and halo blight caused by Pseudomonas syringae pv. phaseolicola (Psp) in bean. Activities of Ascorbate peroxidase (APX), Catalase (CAT) and total protein were studied in resistant and susceptible bean genotypes. Five-day-old seedlings were inoculated with a bacterial suspension (108 CFU ml-1) and harvested at different time intervals (0, 12, 24 and 36 up to 72 h) under controlled growing conditions and assayed for antioxidant enzymes and total protein. Temporal increase of CAT, APX enzymes activities showed maximum activity at 12 h after both pathogens inoculation (hpi) in resistant cultivar, whereas in susceptible it increased at 72 h after both pathogens inoculation for CAT and 12, 24 h for APX enzymes. Maximum total protein activities were observed at 12 h and 24 h respectively after Xap, Psp inoculation (hpi) in resistant and maximum activities were observed at 24 h and 72 h respectively after Xap, Psp inoculation (hpi) in susceptible. Increase of antioxidant enzyme and total protein activities might be an important component in the defense strategy of resistance and susceptible bean genotypes against the bacterial infection. These findings suggest that disease protection is proportional to the amount of enhanced CAT, APX enzyme and total protein activity.
Directory of Open Access Journals (Sweden)
Elízabeth Contreras
2011-07-01
Abstract Cassava is a staple food for more than a billion people. One of the major diseases of cassava which could compromise food security is known as cassava bacterial blight, caused by the bacterium Xanthomonas axonopodis pv. manihotis (Xam. The RXam2 resistance gene candidate encodes a protein with Nucleotide Binding Site and Leucine Rich Repeats domains, and colocalizes with a QTL (Quantitative Trait Loci that accounts for 61.6% of the resistance to the Xam strain CIO151. In this work we sequenced 1816 bp corresponding to a partial sequence of this gene in three cassava varieties with the aim of having a preliminary overview of the degree of Single Nucleotide Polymorphisms (SNPs. The sequenced regions included 507 bp of the promotor and 1309 bp of the coding sequence. It was possible to identify five and 31 intravarietal SNPs in MCOL2246 and TMS60444, respectively. In addition, the number of SNPs between varieties was 44, 34 and 23 for MCOL2246-TMS60444, TMS60444-SG107-35 and MCOL2246-SG107-35, respectively. The largest number of SNPs was located in the promoter region -500 to -300 bp. This study may help to develop alternatives to identify SNPs in a more diverse group of cassava varieties, and possibly associate them with resistance/susceptible phenotypes. Key words: Cassava; resistance; polymorphisms; SNP.
Rational Design of Cyclic Antimicrobial Peptides Based on BPC194 and BPC198
Directory of Open Access Journals (Sweden)
Anna D. Cirac
2017-06-01
Full Text Available A strategy for the design of antimicrobial cyclic peptides derived from the lead compounds c(KKLKKFKKLQ (BPC194 and c(KLKKKFKKLQ (BPC198 is reported. First, the secondary β-structure of BPC194 and BPC198 was analyzed by carrying out molecular dynamics (MD simulations. Then, based on the sequence pattern and the β-structure of BPC194 or BPC198, fifteen analogues were designed and synthesized on solid-phase. The best peptides (BPC490, BPC918, and BPC924 showed minimum inhibitory concentration (MIC values <6.2 μM against Pseudomonas syringae pv. syringae and Xanthomonas axonopodis pv. vesicatoria, and an MIC value of 12.5 to 25 μM against Erwinia amylovora, being as active as BPC194 and BPC198. Interestingly, these three analogues followed the structural pattern defined from the MD simulations of the parent peptides. Thus, BPC490 maintained the parallel alignment of the hydrophilic pairs K1–K8, K2–K7, and K4–K5, whereas BPC918 and BPC924 included the two hydrophilic interactions K3–Q10 and K5–K8. In short, MD simulations have proved to be very useful for ascertaining the structural features of cyclic peptides that are crucial for their biological activity. Such approaches could be further employed for the development of new antibacterial cyclic peptides.
INFLUENCIA DEL GÉNERO Y LA EDAD EN LA CAPACIDADDE DETECTAR DIFERENCIAS FACIALES
Directory of Open Access Journals (Sweden)
JENNIFER BLANCO MARTÍNEZ
2009-01-01
Full Text Available RESUMEN Se evaluó el efecto del sexo y la edad de un grupo de personas en la capacidad de detectar cambios faciales ligeros en pares de fotografías. Las fotografías estuvieron expuestas ante la persona durante 1,5 s. Se utilizaron dos tratamientos; uno sin entrenamiento y otro con entrenamiento, donde se presentaba a la persona justo antes de la prueba una pareja de fotografías como ejemplo de los cambios que podrían esperarse. Los hombres y mujeres presentaron diferencias significativas en los resultados de la prueba; siendo las mujeres las que obtuvieron mayor número de aciertos indicando una mayor percepción visual detallada de los rostros. Igualmente, se encontró efecto de la edad sobre la percepción, registrándose un mayor número de aciertos entre los 21 y 30 años; antes de este rango, los valores son menores posiblemente debido a que la capacidad perceptual está en proceso de desarrollo; mientras que después, los valores disminuyen por el patrón normal de envejecimiento. Se encontró un mayor número de aciertos para el tratamiento con entrenamiento, sugiriendo que este método (demostración y ejemplo es eficaz en facilitar la capacidad de percepción de diferencias faciales. Palabras clave: cognición, edad, percepción visual, entrenamiento, sexo. ABSTRACT The sex and age effect on the capacity to detect slight facial changes in a pair of photographs was evaluated in a group of people. Each pair of photographs was displayed during 1.5 s. Two treatments were used; with and without training. Theformer consisted of a pair of photographs that were exhibited to the person before the test like an example of the changes that could be expected to see in the trial. Men and women showed meaningful differences in the test results; women obtained higher scores indicating an upper detailed visual perception of human faces. Furthermore, age effect over perception was found, where the greater number of correct choices was presented
Lee, Gun Woong; Chung, Moon-Soo; Kang, Mihyung; Chung, Byung Yeoup; Lee, Sungbeom
2016-05-01
Rice bacterial blight, caused by Xanthomonas oryzae pv. oryzae (Xoo), is a severe disease of rice plants. Upon pathogen infection, rice biosynthesizes phytoalexins, including diterpenoids such as momilactones, phytocassanes, and oryzalexins. However, information on headspace volatiles in response to Xoo infection is limited. We have examined headspace volatile terpenes, induced by the infection of Xoo, and investigated their biological roles in the rice plant. Monoterpenes α-thujene, α-pinene, sabinene, myrcene, α-terpene, and (S)-limonene and sesquiterpenes cyclosativene, α-copaene, and β-elemene were detected from 1-week-old Xoo-infected rice seedlings, by solid-phase microextraction-gas chromatography-mass spectrometry. All monoterpenes were constitutively released from rice seedlings before Xoo infection. However, (S)-limonene emission was further elicited after exposure of the seedlings to Xoo in coincidence with upregulation of limonene synthase gene (OsTPS20) transcripts. Only the stereospecific (S)-limonene [and not (R)-limonene or other monoterpenes] severely inhibited Xoo growth, as confirmed by disc diffusion and liquid culture assays. Rice seedlings showed suppressed pathogenic symptoms suggestive of resistance to Xoo infection after foliar treatment with (S)-limonene. Collectively, our findings suggest that (S)-limonene is a volatile phytoanticipin, which plays a significant role in suppressing Xoo growth in rice seedlings.
Directory of Open Access Journals (Sweden)
Gilvaine Ciavareli Lucas
2012-03-01
Full Text Available The objective of this work was to evaluate the effects of plant essential oils (EOs on the growth of Xanthomonas vesicatoria, on bacterial morphology and ultrastructure, and on the severity of tomato bacterial spot. EOs from citronella, clove, cinnamon, lemongrass, eucalyptus, thyme, and tea tree were evaluated in vitro at concentrations of 0.1, 1.0, 10, and 100% in 1.0% powdered milk. The effect of EOs, at 0.1%, on the severity of tomato bacterial spot was evaluated in tomato seedlings under greenhouse conditions. The effects of citronella, lemongrass, clove, and tea tree EOs, at 0.1%, on X. vesicatoria cells were evaluated by transmission electron microscopy. All EOs showed direct toxic effect on the bacteria at a 10%-concentration in vitro. Under greenhouse conditions, the EOs of clove, citronella, tea tree, and lemongrass reduced disease severity. EOs of clove and tea tree, and streptomycin sulfate promoted loss of electron-dense material and alterations in the cytoplasm, whereas EO of tea tree promoted cytoplasm vacuolation, and those of citronella, lemongrass, clove, and tea tree caused damage to the bacterial cell wall. The EOs at a concentration of 0.1% reduce the severity of the disease.
Action of Chitosan Against Xanthomonas Pathogenic Bacteria Isolated from Euphorbia pulcherrima
Directory of Open Access Journals (Sweden)
Yanli Wang
2012-06-01
Full Text Available The antibacterial activity and mechanism of two kinds of chitosan were investigated against twelve Xanthomonas strains recovered from Euphorbia pulcherrima. Results indicated that both chitosans markedly inhibited bacterial growth based on OD loss. Furthermore, the release of DNA and RNA from three selected strains was increased by both chitosans. However, the release of intracellular proteins was inhibited by both chitosans at different concentration and incubation times, except chitosan A at 0.1 mg/mL for 0.5 h incubation and 0.2 mg/mL for 2.0 h incubation increased the release of proteins, indicating the complexity of the interaction and cell membranes, which was affected by incubation time, bacterial species, chitosan type and concentration. Transmission electron microscopic observations revealed that chitosan caused changes in protoplast concentration and surface morphology. In some cells, the membranes and walls were badly distorted and disrupted, while other cells were enveloped by a thick and compact ribbon-like layer. The contrary influence on cell morphology may explain the differential effect in the release of material. In addition, scanning electron microscope and biofilm formation test revealed that both chitosans removed biofilm biomass. Overall, this study showed that membrane and biofilm play an important role in the antibacterial mechanism of chitosan.
Directory of Open Access Journals (Sweden)
Juan Camilo Ochoa
2012-07-01
Full Text Available Título en ingles: Somatic Embryogenesis and friable embryogenic callus production in two cassava cultivars (Manihot esculenta Crantz Resumen: La yuca (Manihot esculenta Crantz es un cultivo de alta importancia en países tropicales. La transformación genética de yuca ha sido posible desde hace 15 años mediante la producción que callo embriogénico friable (CEF a partir de embriones somáticos. En el presente trabajo se evalúan la inducción de embriones somáticos usando tres diferentes auxinas sintéticas y la producción de CEF a partir de éstos en los cultivares de yuca SG107-35 y BRA685. Estos cultivares son resistentes a la bacteriosis vascular de yuca cuyo agente causal es Xanthomonas axonopodis pv. manihotis, una de las principales limitantes del cultivo. Los resultados obtenidos muestran que en ambos cultivares la hormona Picloram a una concentración de 12 mg/l fue más eficiente que 2,4-D y Dicamba para producir embriones somáticos. Adicionalmente se consiguió la producción de CEF y la regeneración de plantas mediante embriogénesis somática en el cultivar BRA685. Los resultados del presente trabajo son importantes para evaluar la transformabilidad de distintos cultivares de yuca. Actualmente este número es bastante reducido principalmente porque la producción de CEF es fuertemente influenciada por el genotipo. Por tal razón solo se transforma de manera rutinaria y eficiente en el cultivar 60444. La posibilidad de transformación de distintos cultivares de yuca permitirá explotar la enorme variabilidad del cultivo, invitándonos a aumentar los esfuerzos para mejorar y universalizar los protocolos de transformación de yuca. Palabras clave: Picloram, regeneración, dependencia del genotipo. Abstract: The cassava (Manihot esculenta Crantz crop has a very important role as a food, feed and a raw material in developing countries; therefore it is a priority to develop technologies oriented to the solution of problems and
International Nuclear Information System (INIS)
Chin, Ko-Hsin; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A putative ApaG gene product from X. campestris pv. campestris was overexpressed in E. coli, purified and crystallized. The crystals diffracted to a resolution of at least 2.3 Å. Xanthomonas campestris pv. campestris is the causative agent of black rot, one of the major worldwide diseases of cruciferous crops. Its genome encodes approximately 4500 proteins, roughly one third of which have unknown function. XC2382 is one such protein, with a MW of 14.2 kDa. Based on a bioinformatics study, it was annotated as an ApaG gene product that serves multiple functions. The ApaG protein has been overexpressed in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method. The crystals diffracted to a resolution of at least 2.30 Å. They are tetragonal and belong to space group P4 1/3 , with unit-cell parameters a = b = 57.6, c = 122.9 Å. There are two, three or four molecules in the asymmetric unit
Directory of Open Access Journals (Sweden)
Kai-Huai Li
2017-12-01
Full Text Available In bacteria, the metabolism of branched-chain amino acids (BCAAs is tightly associated with branched-chain fatty acids (BCFAs synthetic pathways. Although previous studies have reported on BCFAs biosynthesis, more detailed associations between BCAAs metabolism and BCFAs biosynthesis remain to be addressed. In this study, we deleted the ilvC gene, which encodes ketol-acid reductoisomerase in the BCAAs synthetic pathway, from the Xanthomonas campestris pv. campestris (Xcc genome. We characterized gene functions in BCFAs biosynthesis and production of the diffusible signal factor (DSF family signals. Disruption of ilvC caused Xcc to become auxotrophic for valine and isoleucine, and lose the ability to synthesize BCFAs via carbohydrate metabolism. Furthermore, ilvC mutant reduced the ability to produce DSF-family signals, especially branched-chain DSF-family signals, which might be the main reason for Xcc reduction of pathogenesis toward host plants. In this report, we confirmed that BCFAs do not have major functions in acclimatizing Xcc cells to low temperatures.
Energy Technology Data Exchange (ETDEWEB)
Malin, E; Belden, E L; Roth, D
1985-09-01
A radioimmunoassay (RIA), an indirect competitive enzyme-linked immunosorbent assay (ELISA), and a dot-blot modification of the ELISA were evaluated for detection and identification of Xanthomonas campestris pv. phaseoli (X. c. pv. phaseoli). RIA and the dot blot tests were specific for X. c. pv. phaseoli; however, significant cross reactions occurred in the indirect competitive ELISA when using anti-X. c. pv. phaseoli antiserum against other closely related bacteria. The sensitivity level of all procedures for X. c. pv. phaseoli was approximately l0/sup 5/ colony forming unitsmL. All procedures were unsatisfactory in reliably detecting low levels of X. c. pv. phaseoli directly from extracts of bean seed. However when used in conjunction with ilution plating the dot blot assay and the RIA would be useful in specifically identifying X. c. pv. phaseoli. The relative merits of these tests for identification of X. c. pv. phaseoli are discussed.
Directory of Open Access Journals (Sweden)
Niehaus Karsten
2008-06-01
Full Text Available Abstract Background Outer membrane vesicles (OMVs are released from the outer membrane of many Gram-negative bacteria. These extracellular compartments are known to transport compounds involved in cell-cell signalling as well as virulence associated proteins, e.g. the cytolysine from enterotoxic E. coli. Results We have demonstrated that Xanthomonas campestris pv. campestris (Xcc releases OMVs into the culture supernatant during growth. A proteome study identified 31 different proteins that associate with the OMV fraction of which half are virulence-associated. A comparison with the most abundant outer membrane (OM proteins revealed that some proteins are enriched in the OMV fraction. This may be connected to differences in the LPS composition between the OMVs and the OM. Furthermore, a comparison of the OMV proteomes from two different culture media indicated that the culture conditions have an impact on the protein composition. Interestingly, the proteins that are common to both culture conditions are mainly involved in virulence. Conclusion Outer membrane vesicles released from the OM of Xcc contain membrane- and virulence-associated proteins. Future experiments will prove whether these structures can serve as "vehicles" for the transport of virulence factors into the host membrane.
International Nuclear Information System (INIS)
Hu, R.-M.; Yang, T.-C.; Yang, S.-H.; Tseng, Y.-H.
2005-01-01
Xanthomonas campestris pv. campestris (Xcc), a close relative to Pseudomonas aeruginosa, is the pathogen causing black rot in cruciferous plants. In P. aeruginosa, FleQ serves as a cognate activator of σ 54 in transcription from several σ 54 -dependent promoters of flagellar genes. These P. aeruginosa promoters have been analyzed for FleQ-binding sequences; however, no consensus was deduced. Xcc, although lacks fleSR, has a fleQ homologue residing among over 40 contiguously clustered flagellar genes. A fleQ mutant, Xc17fleQ, constructed by insertional mutation is deficient in FleQ protein, non-flagellated, and immobile. Transcriptional fusion assays on six putative σ 54 -dependent promoters of the flagellar genes, fliE, fliQ, fliL, flgG, flgB, and flhF, indicated that each of them is also FleQ dependent. Each of these promoters has a sequence with weak consensus to 5'-gaaacCCgccgCcgctTt-3', immediately upstream of the predicted σ 54 -binding site, with an imperfect inverted repeat containing a GC-rich center flanked by several A and T at 5'- and 3'-ends, respectively. Replacing this region in fliE promoter with a HindIII recognition sequence abolished the transcription, indicating that this region responds to transcription activation by FleQ
Zimaro, Tamara
2014-04-18
Background: Several bacterial plant pathogens colonize their hosts through the secretion of effector proteins by a Type III protein secretion system (T3SS). The role of T3SS in bacterial pathogenesis is well established but whether this system is involved in multicellular processes, such as bacterial biofilm formation has not been elucidated. Here, the phytopathogen Xanthomonas citri subsp. citri (X. citri) was used as a model to gain further insights about the role of the T3SS in biofilm formation. Results: The capacity of biofilm formation of different X. citri T3SS mutants was compared to the wild type strain and it was observed that this secretion system was necessary for this process. Moreover, the T3SS mutants adhered proficiently to leaf surfaces but were impaired in leaf-associated growth. A proteomic study of biofilm cells showed that the lack of the T3SS causes changes in the expression of proteins involved in metabolic processes, energy generation, exopolysaccharide (EPS) production and bacterial motility as well as outer membrane proteins. Furthermore, EPS production and bacterial motility were also altered in the T3SS mutants. Conclusions: Our results indicate a novel role for T3SS in X. citri in the modulation of biofilm formation. Since this process increases X. citri virulence, this study reveals new functions of T3SS in pathogenesis. 2014 Zimaro et al.; licensee BioMed Central Ltd.
Directory of Open Access Journals (Sweden)
Da-Ran Kim
2016-08-01
Full Text Available Strawberry bacterial angular leaf spot (ALS disease, caused by Xanthomonas fragariae has become increasingly problematic in the strawberry agro-industry. ALS causes small angular water-soaked lesions to develop on the abaxial leaf surface. Studies reported optimum temperature conditions for X. fragariae are 20°C and the pathogen suffers mortality above 32°C. However, at the nursery stage, disease symptoms have been observed under high temperature conditions. In the present study, results showed X. fragariae transmission was via infected maternal plants, precipitation, and sprinkler irrigation systems. Systemic infections were detected using X. fragariae specific primers 245A/B and 295A/B, where 300-bp and 615-bp were respectively amplified. During the nursery stage (from May to August, the pathogen was PCR detected only in maternal plants, but not in soil or irrigation water through the nursery stage. During the cultivation period, from September to March, the pathogen was detected in maternal plants, progeny, and soil, but not in water. Additionally, un-infected plants, when planted with infected plants were positive for X. fragariae via PCR at the late cultivation stage. Chemical control for X. fragariae with oxolinic acid showed 87% control effects against the disease during the nursery period, in contrast to validamycin-A, which exhibited increased efficacy against the disease during the cultivation stage (control effect 95%. To our knowledge, this is the first epidemiological study of X. fragariae in Korean strawberry fields.
Directory of Open Access Journals (Sweden)
Peter Henry
2016-10-01
Full Text Available In commercial production settings, few options exist to prevent or treat angular leaf spot of strawberry, a disease of economic importance and caused by the bacterial pathogen Xanthomonas fragariae (Xfr. In the process of isolating and identifying Xfr bacteria from symptomatic plants, we observed growth inhibition of Xfr by bacterial isolates from the same leaf macerates. Identified as species of Pseudomonas and Rhizobium, these isolates were confirmed to suppress growth of Xfr in agar overlay plates and in microtiter plate cultures, as did our reference strain Pseudomonas putida KT2440. Screening of a transposon mutant library of KT2440 revealed that disruption of the biosynthetic pathway for the siderophore pyoverdine resulted in complete loss of Xfr antagonism, suggesting iron competition as a mode of action. Antagonism could be replicated on plate and in culture by addition of purified pyoverdine or by addition of the chelating agents tannic acid and dipyridyl, while supplementing the medium with iron negated the inhibitory effects of pyoverdine, tannic acid and dipyridyl. When co-inoculated with tannic acid onto strawberry plants, Xfr’s ability to cause foliar symptoms was greatly reduced, suggesting a possible opportunity for iron-based management of angular leaf spot. We discuss our findings in the context of ‘nutritional immunity’, the idea that plant hosts restrict pathogens access to iron, either directly, or indirectly through their associated microbiota.
Directory of Open Access Journals (Sweden)
Yusely Ruiz Gonzalez
2012-02-01
Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} Se propone que las funciones cognitivas complejas son organizadas a nivel global en el cerebro y que ocurren debido a la actividad sincronizada de las diferentes áreas de la corteza. Un "cuadro" es un segmento temporal de EEG definido por una portadora de frecuencia que ocupa un espacio en el dominio espacial en el cual las oscilaciones están sincronizadas. Existen resultados experimentales que sustentan que los cuadros poseen un patrón estable modulado en amplitud. El ajuste de conos a las estructuras de fase de la señal cerebral es la metodología usualmente utilizada para detectarlos. Debido a que él es una herramienta que consume mucho tiempo, un nuevo método más rápido para detectar cuadros estables es desarrollado. Ambos métodos son comparados demostrando su coincidencia temporal y que al usar los cuadros detectados por el nuevo método como marcadores temporales del surgimiento de los patrones los niveles de clasificación son mejores.
Directory of Open Access Journals (Sweden)
Ofir Bahar
2014-01-01
Full Text Available Pattern recognition receptors (PRRs play an important role in detecting invading pathogens and mounting a robust defense response to restrict infection. In rice, one of the best characterized PRRs is XA21, a leucine rich repeat receptor-like kinase that confers broad-spectrum resistance to multiple strains of the bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo. In 2009 we reported that an Xoo protein, called Ax21, is secreted by a type I-secretion system and that it serves to activate XA21-mediated immunity. This report has recently been retracted. Here we present data that corrects our previous model. We first show that Ax21 secretion does not depend on the predicted type I secretion system and that it is processed by the general secretion (Sec system. We further show that Ax21 is an outer membrane protein, secreted in association with outer membrane vesicles. Finally, we provide data showing that ax21 knockout strains do not overcome XA21-mediated immunity.
Ayyachamy, M; Khelawan, K; Pillay, D; Permaul, K; Singh, S
2007-10-01
To access inulinase production by Xanthomonas campestris pv phaseoli using the submerged and solid state cultivation (SSC) methods. Various carbon sources, inulin-rich solid substrates and pure synthetic inulin were tested for their efficiency in inulinase induction. The highest inulinase production (17.42 IU ml(-1)) in submerged cultures of X. campestris was observed with inulin as a carbon source with an initial pH, temperature and agitation of 7.0, 37 degrees C and 150 rev min(-1) respectively. Among the various substrates, garlic peels (117 IU gds(-1)) and onion peels (101 IU gds(-1)) were found to be the best for inulinase production. The inulinase production level of X. campestris was 6.7-fold higher in garlic and 5.8-fold in onion, under optimized SSC conditions compared with the submerged culture. This is the first report on inulinase production from garlic and onion peels by X. campestris using SSC. SSC is an efficient method for inulinase production by X. campestris for commercial applications.
Directory of Open Access Journals (Sweden)
Sheo Shankar Pandey
2016-11-01
Full Text Available Abilities of bacterial pathogens to adapt to the iron limitation present in hosts is critical to their virulence. Bacterial pathogens have evolved diverse strategies to coordinately regulate iron metabolism and virulence associated functions to maintain iron homeostasis in response to changing iron availability in the environment. In many bacteria the ferric uptake regulator (Fur functions as transcription factor that utilize ferrous form of iron as cofactor to regulate transcription of iron metabolism and many cellular functions. However, mechanisms of fine-tuning and coordinated regulation of virulence associated function beyond iron and Fur-Fe2+ remain undefined. In this study, we show that a novel transcriptional regulator XibR (named Xanthomonas iron binding regulator of the NtrC family, is required for fine-tuning and co-coordinately regulating the expression of several iron regulated genes and virulence associated functions in phytopathogen Xanthomonas campestris pv. campestris (Xcc. Genome wide expression analysis of iron-starvation stimulon and XibR regulon, GUS assays, genetic and functional studies of xibR mutant revealed that XibR positively regulates functions involved in iron storage and uptake, chemotaxis, motility and negatively regulates siderophore production, in response to iron. Furthermore, chromatin immunoprecipitation followed by quantitative real-time PCR indicated that iron promoted binding of the XibR to the upstream regulatory sequence of operon's involved in chemotaxis and motility. Circular dichroism spectroscopy showed that purified XibR bound ferric form of iron. Electrophoretic mobility shift assay revealed that iron positively affected the binding of XibR to the upstream regulatory sequences of the target virulence genes, an effect that was reversed by ferric iron chelator deferoxamine. Taken together, these data revealed that how XibR coordinately regulates virulence associated and iron metabolism functions in
Directory of Open Access Journals (Sweden)
C. D. Borges
2008-06-01
Full Text Available Production, viscosity, and chemical composition of xanthan synthesized by bacterium Xanthomonas campestris pv pruni strain 101 were evaluated in bioreactor systems. During the process, the volumetric oxygen mass transfer coefficient (kLa and the biomass were determined and the pH was monitored. The cultures were grown in a 3 l bioreactor, with aeration and agitation varying as follows: conditions (A 300 rpm, 3 vvm and (B 200 rpm, 2 vvm, at 28 °C. Our results showed that gum production was dependent on kLa, with a maximum yield of 8.15 g/l at 300 rpm, 3 vvm, 54 h of fermentation, kLa 21.4/h, while biomass was not affected. All aqueous solutions of 3% (w/v xanthans synthesized showed a pseudoplastic behavior. The highest viscosity was reached under the strongest aeration/agitation conditions. All xanthan samples contained glucose, mannose, rhamnose, and glucuronic acid as their main components. The highest agitation and aeration rates used under condition A (300 rpm and 3 vvm favorably influenced the yield and viscosity of the xanthan produced by bacterium X. campestris pv pruni 101 at different fermentation times.Se evaluó la producción, viscosidad y composición química del xantano sintetizado por la bacteria Xanthomonas campestris pv. pruni cepa 101 en un fermentador. Durante el proceso se controló el pH y se determinaron el coeficiente de transferencia de masa de oxígeno (kLa y la producción de masa celular seca. Los cultivos se realizaron en un fermentador de 3 l variando la aireación y la agitación, en las siguientes condiciones: (A 300 rpm, 3 vvm y (B 200 rpm, 2 vvm; a 28 °C. Nuestros resultados mostraron que la producción de goma fue dependiente del kLa, con un rendimiento máximo de 8,15 g/l a 300 rpm y 3 vvm a las 54 h de fermentación, kLa de 21,4/h, mientras que la producción de biomasa no se afectó. Todas las soluciones acuosas de xantano al 3% (m/v sintetizadas presentaron comportamiento pseudoplástico. La mayor
Zeng, Hongqiu; Xie, Yanwei; Liu, Guoyin; Lin, Daozhe; He, Chaozu; Shi, Haitao
2018-06-01
MeGAPCs were identified as negative regulators of plant disease resistance, and the interaction of MeGAPCs and MeATG8s was highlighted in plant defense response. As an important enzyme of glycolysis metabolic pathway, glyceraldehyde-3-P dehydrogenase (GAPDH) plays important roles in plant development, abiotic stress and immune responses. Cassava (Manihot esculenta) is most important tropical crop and one of the major food crops, however, no information is available about GAPDH gene family in cassava. In this study, 14 MeGAPDHs including 6 cytosol GAPDHs (MeGAPCs) were identified from cassava, and the transcripts of 14 MeGAPDHs in response to Xanthomonas axonopodis pv manihotis (Xam) indicated their possible involvement in immune responses. Further investigation showed that MeGAPCs are negative regulators of disease resistance against Xam. Through transient expression in Nicotiana benthamiana, we found that overexpression of MeGAPCs led to decreased disease resistance against Xam. On the contrary, MeGAPCs-silenced cassava plants through virus-induced gene silencing (VIGS) conferred improved disease resistance. Notably, MeGAPCs physically interacted with autophagy-related protein 8b (MeATG8b) and MeATG8e and inhibited autophagic activity. Moreover, MeATG8b and MeATG8e negatively regulated the activities of NAD-dependent MeGAPDHs, and are involved in MeGAPCs-mediated disease resistance. Taken together, this study highlights the involvement of MeGAPCs in plant disease resistance, through interacting with MeATG8b and MeATG8e.
Ruiz, Cristina; Nadal, Anna; Montesinos, Emilio; Pla, Maria
2018-02-01
Fruit crops are regarded as important health promoters and constitute a major part of global agricultural production, and Rosaceae species are of high economic impact. Their culture is threatened by bacterial diseases, whose control is based on preventative treatments using compounds of limited efficacy and negative environmental impact. One of the most economically relevant examples is the pathogen Xanthomonas arboricola pv. pruni (Xap) affecting Prunus spp. The plant immune response against pathogens can be triggered and amplified by plant elicitor peptides (Peps), perceived by specific receptors (PEPRs). Although they have been described in various angiosperms, scarce information is available on Rosaceae species. Here, we identified the Pep precursor (PROPEP), Pep and PEPR orthologues of 10 Rosaceae species and confirmed the presence of the Pep/PEPR system in this family. We showed the perception and elicitor activity of Rosaceae Peps using the Prunus-Xap pathosystem as proof-of-concept. Treatment with nanomolar doses of Peps induced the corresponding PROPEP and a set of defence-related genes in Prunus leaves, and enhanced resistance against Xap. Peps from the same species had the highest efficiencies. Rosaceae Peps could potentially be used to develop natural, targeted and environmentally friendly strategies to enhance the resistance of Prunus species against biotic attackers. © 2017 BSPP AND JOHN WILEY & SONS LTD.
Jingbo, Xia; Silan, Zhang; Feng, Shi; Huijuan, Xiong; Xuehai, Hu; Xiaohui, Niu; Zhi, Li
2011-09-07
To evaluate the possibility of an unknown protein to be a resistant gene against Xanthomonas oryzae pv. oryzae, a different mode of pseudo amino acid composition (PseAAC) is proposed to formulate the protein samples by integrating the amino acid composition, as well as the Chaos games representation (CGR) method. Some numerical comparisons of triangle, quadrangle and 12-vertex polygon CGR are carried to evaluate the efficiency of using these fractal figures in classifiers. The numerical results show that among the three polygon methods, triangle method owns a good fractal visualization and performs the best in the classifier construction. By using triangle + 12-vertex polygon CGR as the mathematical feature, the classifier achieves 98.13% in Jackknife test and MCC achieves 0.8462. Copyright © 2011 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Dragana Radunović
2012-01-01
Full Text Available Brassicas form the most important group of vegetable crops in Montenegro. The cabbage(Brassica oleracea var. capitata is most commonly grown, although other brassicas,particularly kale, Brussels sprout, cauliflower and broccoli, have been increasingly producedsince recently. One of the specialties of vegetable production in Montenegro is growing ofcollard (Brassica oleracea var. acephala, which is the simplest variety of the Brassica oleraceaspecies and in the nearest relation with their wild ancestor – the sylvestris variety.Diseases are the main restrictive factors for successful production of these vegetables.Susceptibility of the cultivars and inadequate control often result in more or less damagedcrops in some plots.Causal agents of brassica diseases, especially bacterial, have not been investigated inMontenegro until 2009. Since the symptoms observed in 2009 were „V” shaped leaf edgenecrosis and black rot of vascular tissue, it was assumed that they were caused by plantpathogenic bacterium Xanthomonas campestris pv. campestris.Samples of the infected plants were collected from different localities in Montenegro.Isolation and identification of the bacterium were performed using laboratory methodsaccording to Schaad (1980, Lelliott and Stead (1987 and Arsenijević (1997. Examinationof chosen bacterial isolates was conducted using both, classical bacteriological methods(examination of their pathogenic, morphological, cultivation and biochemical and physiologicalcharacteristics, and ELISA test.The obtained results confirmed the presence of X.campestris pv. campestris (Pammel,1895 Dowson 1939, on cabbage, kale, broccoli and collard in Montenegro. This is the firstexperimental evidence that collard is the host of X. campestris pv. campestris in Montenegro.
Shimada, Takehiko; Endo, Tomoko; Rodríguez, Ana; Fujii, Hiroshi; Goto, Shingo; Matsuura, Takakazu; Hojo, Yuko; Ikeda, Yoko; Mori, Izumi C; Fujikawa, Takashi; Peña, Leandro; Omura, Mitsuo
2017-05-01
In order to clarify whether high linalool content in citrus leaves alone induces strong field resistance to citrus canker caused by Xanthomonas citri subsp. citri (Xcc), and to assess whether this trait can be transferred to a citrus type highly sensitive to the bacterium, transgenic 'Hamlin' sweet orange (Citrus sinensis L. Osbeck) plants over-expressing a linalool synthase gene (CuSTS3-1) were generated. Transgenic lines (LIL) with the highest linalool content showed strong resistance to citrus canker when spray inoculated with the bacterium. In LIL plants inoculated by wounding (multiple-needle inoculation), the linalool level was correlated with the repression of the bacterial titer and up-regulation of defense-related genes. The exogenous application of salicylic acid, methyl jasmonate or linalool triggered responses similar to those constitutively induced in LIL plants. The linalool content in Ponkan mandarin leaves was significantly higher than that of leaves from six other representative citrus genotypes with different susceptibilities to Xcc. We propose that linalool-mediated resistance might be unique to citrus tissues accumulating large amounts of volatile organic compounds in oil cells. Linalool might act not only as a direct antibacterial agent, but also as a signal molecule involved in triggering a non-host resistance response against Xcc. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
María E. Romero
2008-06-01
Full Text Available Zymomonas mobilis mobilis (Zm produce factores antimicrobianos que actúan sobre un amplio espectro de microorganismos patógenos para el hombre, animales y plantas. Un problema importante a resolver en los tratamientos con antimicrobianos, es el desarrollo de resistencia a compuestos empleados actualmente, no siendo las bacterias fitopatógenas una excepción. En el presente trabajo se realizaron ensayos de antagonismo con células (pruebas de estrías cruzadas y sobrenadantes concentrados (Sc (por difusión en agar preparados a partir de cultivos de Zm (aislada de jugo de caña de azúcar producido en Tucumán, frente a la bacteria causal de la cancrosis: Xanthomonas citri subsp. citri. Se evaluaron aislamientos de Xcc sensibles (Xc y resistentes (Xcr a compuestos a base de cobre. Los resultados obtenidos mostraron que la bacteria testigo fue inhibida totalmente por las células de Zm, ejerciendo un efecto bactericida. En los ensayos de difusión en el agar se observó que tanto Xc, como Xcr fueron sensibles al Sc de Zm. Se sabe, por estudios anteriores, que los metabolitos de Zymomonas tienen un efecto deletéreo en la membrana celular de E. coli AB1133, inhibiéndose la respiración de la bacteria inmediatamente de agregado Sc (60 UA. En el presente trabajo se observó el mismo efecto, inhibición total de la respiración en Xc, luego del agregado del Sc (60 UA. Por lo observado, se deduce que el blanco de acción de los metabolitos antimicrobianos de Sc en Xc, sería el mismo que el de E. coli AB1133. Con los resultados obtenidos se considera de interés encarar el estudio de los compuestos de Zm para ser empleados en el control de enfermedades que afectan los cultivos de valor económico de la región, como es el caso de la cancrosis, como así también profundizar acerca de la acción de dichos metabolitos en la membrana de Xanthomonas citri subsp. citri.Zymomonas mobilis mobilis (Zm produces antimicrobial factors, which have an effect on
Directory of Open Access Journals (Sweden)
Rosa Navarrete
2000-01-01
Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas
International Nuclear Information System (INIS)
Watanabe, Minoru; Samejima, Shin-ichi; Hayashi, Nobuo; Hosokawa, Daijiro
1980-01-01
The translocation and accumulation of 14 C-photosynthetic assimilates in rice plants infected with Xanthomonas campestris pv. oryzae were investigated. Approximately the same quantities of assimilates were detected in healthy and infected leaves 1 day after photosynthesis, but 1.7 times as much as healthy leaves assimilates were still remained in infected leaves 7 days after photosynthesis. Much more 14 C-photosynthetic assimilates were generally detected in leaf blade than in leaf sheath or in root within 1 day after photosynthesis, but detected in leaf sheath than in leaf blade later than 2 days after photosynthesis. The rates of translocation of 14 C-assimilates from leaf blade to leaf sheath were lower in inoculated rice plants than in healthy ones. In both healthy and inoculated leaves of susceptible and resistant cultivars, there was a tendency that 14 C-sugar contents decreased, but 14 C-organic acid and -amino acid contents increased gradually after photosynthesis. Incorporation of 14 C-photosynthetic assimilates into invading bacterial cells which were separated from leaf tissues by the methods of leakage and Millipore filtration was not detected immediately after photosynthesis, but became apparent 5 days after photosynthesis. The leakage of 14 C-photosynthetic assimilates from leaf tissues into bathing solution was about 4 times higher in infected leaves than in healthy ones 5 days after photosynthesis, suggesting that the permeability in infected leaf tissues would increase. (author)
Energy Technology Data Exchange (ETDEWEB)
Aparna, Gudlur; Chatterjee, Avradip; Jha, Gopaljee; Sonti, Ramesh V.; Sankaranarayanan, Rajan, E-mail: sankar@ccmb.res.in [Centre for Cellular and Molecular Biology, Uppal Road, Hyderabad 500 007 (India)
2007-08-01
The crystallization and preliminary crystallographic studies of LipA, a lipase/esterase secreted by X. oryzae pv. oryzae during its infection of rice plants, are reported. Xanthomonas oryzae pv. oryzae is the causal agent of bacterial leaf blight, a serious disease of rice. Several enzymes that are secreted through the type II secretion system of this bacterium play an important role in the plant–microbe interaction, being important for virulence and also being able to induce potent host defence responses. One of these enzymes is a secretory lipase/esterase, LipA, which shows a very weak homology to other bacterial lipases and gives a positive tributyrin plate assay. In this study, LipA was purified from the culture supernatant of an overexpressing clone of X. oryzae pv. oryzae and two types of crystals belonging to space group C2 but with two different unit-cell parameters were obtained using the hanging-drop vapour-diffusion method. Type I crystals diffract to a maximum resolution of 1.89 Å and have unit-cell parameters a = 93.1, b = 62.3, c = 66.1 Å, β = 90.8°. Type II crystals have unit-cell parameters a = 103.6, b = 54.6, c = 66.3 Å, β = 92.6° and diffract to 1.86 Å. Solvent-content analysis shows one monomer in the asymmetric unit in both the crystal forms.
International Nuclear Information System (INIS)
Naqvi, S.F.; Haq, M.I.U.; Tahir, M.I.; Khan, M.A.; Ali, Z.
2013-01-01
Isolates of Xanthomonas campestris (Pammel) Dawson pv. sesami (Xcs) were collected from various locations in Pakistan and were characterized using several biochemical tests including; (KOH) string test, gram staining, H/sub 2/S production, catalase activity, oxidation/fermentation of glucose, oxidase activity and nitrate reduction. The isolates were positive in tests for KOH string assay, H/sub 2/S, catalase and showed negative reactions in gram staining, oxidase test and nitrate reduction while oxidative utilization of glucose was observed. To develop biological control for the pathogen we isolated numerous bacteria from the rhizosphere of sesame plants and screened them for antagonism against the pathogen using the zone inhibition method. Out of 87 isolates, 9 isolates were inhibitory to the pathogen in vitro. Pseudomonas fluorescens ID-3 exhibited the highest zone of inhibition i.e. 7.97mm. All antagonistic isolates were tested for disease control under greenhouse conditions. Four sesame lines that were found to be moderately resistant in previous studies (i.e. 95001, 96007, 96019, and 20003) were selected for evaluating biocontrol efficacy. The isolates were found to control the disease and reduced severity to 3% compared to untreated plants. The isolate P. fluorescens ID-3 was considered to provide the best disease control with each cultivar. Average biocontrol efficiency (BE) of ID-3 was 78.25% while the best BE was obtained in line 96019, i.e. 81%. (author)
Ficarra, Florencia A; Grandellis, Carolina; Galván, Estela M; Ielpi, Luis; Feil, Regina; Lunn, John E; Gottig, Natalia; Ottado, Jorgelina
2017-06-01
Xanthomonas citri ssp. citri (Xcc) causes canker disease in citrus, and biofilm formation is critical for the disease cycle. OprB (Outer membrane protein B) has been shown previously to be more abundant in Xcc biofilms compared with the planktonic state. In this work, we showed that the loss of OprB in an oprB mutant abolishes bacterial biofilm formation and adherence to the host, and also compromises virulence and efficient epiphytic survival of the bacteria. Moreover, the oprB mutant is impaired in bacterial stress resistance. OprB belongs to a family of carbohydrate transport proteins, and the uptake of glucose is decreased in the mutant strain, indicating that OprB transports glucose. Loss of OprB leads to increased production of xanthan exopolysaccharide, and the carbohydrate intermediates of xanthan biosynthesis are also elevated in the mutant. The xanthan produced by the mutant has a higher viscosity and, unlike wild-type xanthan, completely lacks pyruvylation. Overall, these results suggest that Xcc reprogrammes its carbon metabolism when it senses a shortage of glucose input. The participation of OprB in the process of biofilm formation and virulence, as well as in metabolic changes to redirect the carbon flux, is discussed. Our results demonstrate the importance of environmental nutrient supply and glucose uptake via OprB for Xcc virulence. © 2016 BSPP AND JOHN WILEY & SONS LTD.
Directory of Open Access Journals (Sweden)
Janine Kirchberg
Full Text Available The aerobic plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria (Xcv colonizes the intercellular spaces of pepper and tomato. One enzyme that might contribute to the successful proliferation of Xcv in the host is the iron-sulfur protein aconitase, which catalyzes the conversion of citrate to isocitrate in the tricarboxylic acid (TCA cycle and might also sense reactive oxygen species (ROS and changes in cellular iron levels. Xcv contains three putative aconitases, two of which, acnA and acnB, are encoded by a single chromosomal locus. The focus of this study is aconitase B (AcnB. acnB is co-transcribed with two genes, XCV1925 and XCV1926, encoding putative nucleic acid-binding proteins. In vitro growth of acnB mutants was like wild type, whereas in planta growth and symptom formation in pepper plants were impaired. While acnA, XCV1925 or XCV1926 mutants showed a wild-type phenotype with respect to bacterial growth and in planta symptom formation, proliferation of the acnB mutant in susceptible pepper plants was significantly impaired. Furthermore, the deletion of acnB led to reduced HR induction in resistant pepper plants and an increased susceptibility to the superoxide-generating compound menadione. As AcnB complemented the growth deficiency of an Escherichia coli aconitase mutant, it is likely to be an active aconitase. We therefore propose that optimal growth and survival of Xcv in pepper plants depends on AcnB, which might be required for the utilization of citrate as carbon source and could also help protect the bacterium against oxidative stress.
Danna, Cristian H; Millet, Yves A; Koller, Teresa; Han, Sang-Wook; Bent, Andrew F; Ronald, Pamela C; Ausubel, Frederick M
2011-05-31
Detection of microbes by plants relies in part on an array of pattern-recognition receptors that recognize conserved microbial signatures, so-called "microbe-associated molecular patterns." The Arabidopsis thaliana receptor-like kinase FLS2 is the pattern-recognition receptor for bacterial flagellin. Similarly to FLS2, the rice transmembrane protein XA21 is the receptor for the sulfated form of the Xanthomonas oryzae pv. oryzae secreted protein Ax21. Here we show that Ax21-derived peptides activate Arabidopsis immunity, triggering responses similar to those elicited by flagellin, including an oxidative burst, induction of defense-response genes, and enhanced resistance to bacterial pathogens. To identify Arabidopsis Xa21 functional homologs, we used a reverse genetics approach to screen T-DNA insertion mutants corresponding to all 47 of the Arabidopsis genes encoding non-RD kinases belonging to the interleukin-1 receptor-associated kinase (IRAK) family. Surprisingly, among all of these mutant lines, only fls2 mutants exhibited a significant loss of response to Ax21-derived peptides. Ax21 peptides also failed to activate defense-related responses in an fls2-24 mutant that does not bind Flg22. Moreover, a Flg22Δ2 variant of Flg22 that binds to FLS2 but does not activate FLS2-mediated signaling suppressed Ax21-derived peptide signaling, indicating mutually exclusive perception of Flg22 or Ax21 peptides by FLS2. The data indicate that FLS2 functions beyond flagellin perception to detect other microbe-associated molecular patterns.
Energy Technology Data Exchange (ETDEWEB)
Tambascia, C.; Balan, A. [Laboratorio Nacional de Biociencias - LNBIO, Campinas, SP (Brazil)
2012-07-01
Full text: Microorganisms require sulfur for growth and obtain it either for inorganic sulfate or organosulfur compounds. ATP-Binding Cassete (SulT family) or major facilitator superfamily-type (SulP) transporters are responsible for the sulfate transport into the cell. In Xanthomonas citri, the phytopathogenic bacterium that causes the canker citrus disease, there are no reports related to the importance of these transporters during in vitro or in vivo infection. We identified in X. citri genome all the genes that belong to the well-characterized cys regulon from Escherichia coli and Salmonella typhimurium, which includes three ABC transporters and all the enzymes necessary for sulfate oxide reduction to sulfide and cysteine. Once these genes have been shown to be extremely important for bacteria growth and development in different environments, we chose the sbpcysWUA and cysDNCHIJG operons, which encodes the ABC inorganic sulfate ABC transporter and all the enzymes necessary for conversion of sulfate in cysteine, respectively. As a step for crystallization trials and resolution of their tridimensional structures, the referred genes were amplified and cloned into the cloning vector pGEM T-easy. In addition, using bioinformatics tools and molecular modeling we characterized all the protein functions as well as built tridimensional models of their structure for determination of the active sites. The importance of each protein is discussed aiming the discovery of a good target for development of inhibitors that could block the bacterium growth. (author)
International Nuclear Information System (INIS)
Tambascia, C.; Balan, A.
2012-01-01
Full text: Microorganisms require sulfur for growth and obtain it either for inorganic sulfate or organosulfur compounds. ATP-Binding Cassete (SulT family) or major facilitator superfamily-type (SulP) transporters are responsible for the sulfate transport into the cell. In Xanthomonas citri, the phytopathogenic bacterium that causes the canker citrus disease, there are no reports related to the importance of these transporters during in vitro or in vivo infection. We identified in X. citri genome all the genes that belong to the well-characterized cys regulon from Escherichia coli and Salmonella typhimurium, which includes three ABC transporters and all the enzymes necessary for sulfate oxide reduction to sulfide and cysteine. Once these genes have been shown to be extremely important for bacteria growth and development in different environments, we chose the sbpcysWUA and cysDNCHIJG operons, which encodes the ABC inorganic sulfate ABC transporter and all the enzymes necessary for conversion of sulfate in cysteine, respectively. As a step for crystallization trials and resolution of their tridimensional structures, the referred genes were amplified and cloned into the cloning vector pGEM T-easy. In addition, using bioinformatics tools and molecular modeling we characterized all the protein functions as well as built tridimensional models of their structure for determination of the active sites. The importance of each protein is discussed aiming the discovery of a good target for development of inhibitors that could block the bacterium growth. (author)
Dutta, B; Langston, D B; Luo, X; Carlson, S; Kichler, J; Gitaitis, R
2017-11-01
The phytopathogenic bacterium Xanthomonas euvesicatoria causes bacterial leaf spot (BLS) of pepper and has a worldwide distribution. BLS is difficult to control and an integrated management strategy that incorporates crop rotation, use of clean seed and clean plants, weed control, resistant varieties, applications of bactericides, biocontrol agents, and systemic acquired resistance (SAR) inducers is generally recommended. However, even with that arsenal of weapons, BLS can still be responsible for severe losses under favorable environmental conditions. Thus, additional tools need to be added to an overall integrated management strategy to combat BLS. In this article, we developed several models from 2012 to 2014 that were based on how macronutrients, micronutrients, and micronutrient ratios affect BLS severity. Factors used to select a model for validation included highly significant P values, high adjusted R 2 values, low variance inflation factor values (macronutrient and micronutrient concentrations affect plant disease resistance genes in the SAR pathway.
International Nuclear Information System (INIS)
Pegos, V.R.; Oliveira, P.S.L.; Balan, A.
2012-01-01
Full text: In Xanthomonas citri, the phytopathogen responsible for the canker citrus disease, we identified in the ssuABCDE operon, genes encoding the alkanesulfonate ABC transporter as well as the two enzymes responsible for oxido reduction of the respective substrates. SsuD and SsuE proteins represent a two-component system that can be assigned to the group of FMNH 2 -dependent monooxygenases. How- ever, despite of the biochemical information about SsuD and SsuE orthologs from Escherichia coli, there is no structural information of how the two proteins work together. In this work, we used ultracentrifugation, SAXS data and molecular modeling to construct a structural/functional model, which consists of eight molecules organized in a weathervane shape. Through this model, SsuD ligand-binding site for NADPH 2 and FMN substrates is clearly exposed, in a way that might allow the protein-protein interactions with SsuE. Moreover, based on molecular dynamics simulations of SsuD in apo state, docked with NADPH 2 , FMN or both substrates, we characterized the residues of the pocket, the mechanism of substrate interaction and transfer of electrons from NADPH 2 to FMN. This is the first report that links functional and biochemical data with structural analyses. (author)
Tariq, Rezwan; Wang, Chunlian; Qin, Tengfei; Xu, Feifei; Tang, Yongchao; Gao, Ying; Ji, Zhiyuan; Zhao, Kaijun
2018-03-02
Bacterial blight, caused by Xanthomonas oryzae pv. oryzae ( Xoo ), is an overwhelming disease in rice-growing regions worldwide. Our previous studies revealed that the executor R gene Xa23 confers broad-spectrum disease resistance to all naturally occurring biotypes of Xoo . In this study, comparative transcriptomic profiling of two near-isogenic lines (NILs), CBB23 (harboring Xa23 ) and JG30 (without Xa23 ), before and after infection of the Xoo strain, PXO99 A , was done by RNA sequencing, to identify genes associated with the resistance. After high throughput sequencing, 1645 differentially expressed genes (DEGs) were identified between CBB23 and JG30 at different time points. Gene Ontlogy (GO) analysis categorized the DEGs into biological process, molecular function, and cellular component. KEGG analysis categorized the DEGs into different pathways, and phenylpropanoid biosynthesis was the most prominent pathway, followed by biosynthesis of plant hormones, flavonoid biosynthesis, and glycolysis/gluconeogenesis. Further analysis led to the identification of differentially expressed transcription factors (TFs) and different kinase responsive genes in CBB23, than that in JG30. Besides TFs and kinase responsive genes, DEGs related to ethylene, jasmonic acid, and secondary metabolites were also identified in both genotypes after PXO99 A infection. The data of DEGs are a precious resource for further clarifying the network of Xa23 -mediated resistance.
Institute of Scientific and Technical Information of China (English)
ZHAO Baimei; CAO Haipeng; DUAN Junjie; YANG Wencai
2015-01-01
Three crosses,Hawaii7981×PI128216,Hawaii7981×LA1589,and PI128216×LA1589,were made to develop F2 populations for testing allelism among three genes Xv3,Rx4,and RxLA1589 conferring resistance to bacterial spot caused by Xanthomonas perforans race T3 in tomato. Each population consisted of 535–1 655 individuals. An infiltration method was used to inoculate the leaves of the parental and F2 plants as well as the susceptible control OH88119 for detecting hypersensitive resistance(HR). The results showed that all the tomato plants except OH88119 had HR to race T3,indicating that Xv3,Rx4,and RxLA1589 were allelic genes. Genomic DNA fragments of the Rx4 alleles from Hawaii7981,PI128216,and LA1589 were amplified using gene-specific primers and sequenced. No sequence variation was observed in the coding region of Rx4 in the three resistant lines. Based on the published map positions of these loci as well as the allelic tests and sequence data obtained in this study,we speculated that Xv3,Rx4,and RxLA1589 were the same gene. The results will provide useful information for understanding the mechanism of resistance to race T3 and developing resistant tomato varieties.
Report on the development of putative functional SSR and SNP markers in passion fruits.
da Costa, Zirlane Portugal; Munhoz, Carla de Freitas; Vieira, Maria Lucia Carneiro
2017-09-06
Passionflowers Passiflora edulis and Passiflora alata are diploid, outcrossing and understudied fruit bearing species. In Brazil, passion fruit cultivation began relatively recently and has earned the country an outstanding position as the world's top producer of passion fruit. The fruit's main economic value lies in the production of juice, an essential exotic ingredient in juice blends. Currently, crop improvement strategies, including those for underexploited tropical species, tend to incorporate molecular genetic approaches. In this study, we examined a set of P. edulis transcripts expressed in response to infection by Xanthomonas axonopodis, (the passion fruit's main bacterial pathogen that attacks the vines), aiming at the development of putative functional markers, i.e. SSRs (simple sequence repeats) and SNPs (single nucleotide polymorphisms). A total of 210 microsatellites were found in 998 sequences, and trinucleotide repeats were found to be the most frequent (31.4%). Of the sequences selected for designing primers, 80.9% could be used to develop SSR markers, and 60.6% SNP markers for P. alata. SNPs were all biallelic and found within 15 gene fragments of P. alata. Overall, gene fragments generated 10,003 bp. SNP frequency was estimated as one SNP every 294 bp. Polymorphism rates revealed by SSR and SNP loci were 29.4 and 53.6%, respectively. Passiflora edulis transcripts were useful for the development of putative functional markers for P. alata, suggesting a certain level of sequence conservation between these cultivated species. The markers developed herein could be used for genetic mapping purposes and also in diversity studies.
Directory of Open Access Journals (Sweden)
Gregory E. Perry
2013-08-01
Full Text Available Resistance to common bacterial blight, caused by Xanthomonas axonopodis pv. phaseoli, in Phaseolus vulgaris is conditioned by several loci on different chromosomes. Previous studies with OAC-Rex, a CBB-resistant, white bean variety of Mesoamerican origin, identified two resistance loci associated with the molecular markers Pv-CTT001 and SU91, on chromosome 4 and 8, respectively. Resistance to CBB is assumed to be derived from an interspecific cross with Phaseolus acutifolius in the pedigree of OAC-Rex. Our current whole genome sequencing effort with OAC-Rex provided the opportunity to compare its genome in the regions associated with CBB resistance with the v1.0 release of the P. vulgaris line G19833, which is a large seeded bean of Andean origin, and (assumed to be CBB susceptible.. In addition, the genomic regions containing SAP6, a marker associated with P. vulgaris-derived CBB-resistance on chromosome 10, were compared. These analyses indicated that gene content was highly conserved between G19833 and OAC-Rex across the regions examined (>80%. However, fifty-nine genes unique to OAC Rex were identified, with resistance gene homologues making up the largest category (10 genes identified. Two unique genes in OAC-Rex located within the SU91 resistance QTL have homology to P. acutifolius ESTs and may be potential sources of CBB resistance. As the genomic sequence assembly of OAC-Rex is completed, we expect that further comparisons between it and the G19833 genome will lead to a greater understanding of CBB resistance in bean.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available as ... axonopodis pv. citri str. 306] ... Length = 221 ... Query: 40 ... VLATDAHGYLENQQLPDSVQLVPPPPQ...DGSAALANDEAVAKAMLALRGTPRWELAAQDAV 99 ... VLATDAHGYLENQQLPDSVQLVPPPPQDGSAAL...ANDEAVAKAMLALRGTPRWELAAQDAV Sbjct: 3 ... VLATDAHGYLENQQLPDSVQLVPPPPQDGSAALANDEAVAKAMLALRGTPRWELAAQDAV 62 ... Quer
Boudon, Sylvain; Manceau, Charles; Nottéghem, Jean-Loup
2005-09-01
ABSTRACT Xanthomonas arboricola pv. pruni, the causal agent of bacterial spot on stone fruit, was found in 1995 in several orchards in southeastern France. We studied population genetics of this emerging pathogen in comparison with populations from the United States, where the disease was first described, and from Italy, where the disease has occurred since 1920. Four housekeeping genes (atpD, dnaK, efp, and glnA) and the intergenic transcribed spacer region were sequenced from a total of 3.9 kb of sequences, and fluorescent amplified fragment length polymorphism (FAFLP) analysis was performed. A collection of 64 X. arboricola pv. pruni strains, including 23 strains from France, was analyzed. The X. arboricola pv. pruni population had a low diversity because no sequence polymorphisms were observed. Population diversity revealed by FAFLP was lower for the West European population than for the American population. The same bacterial genotype was detected from five countries on three continents, a geographic distribution that can be explained by human-aided migration of bacteria. Our data support the hypothesis that the pathogen originated in the United States and subsequently has been disseminated to other stone-fruit-growing regions of the world. In France, emergence of this disease was due to a recent introduction of the most prevalent genotype of the bacterium found worldwide.
Thomas, Nicholas C; Oksenberg, Nir; Liu, Furong; Caddell, Daniel; Nalyvayko, Alina; Nguyen, Yen; Schwessinger, Benjamin; Ronald, Pamela C
2018-01-01
Rice ( Oryza sativa ) plants expressing the XA21 cell-surface receptor kinase are resistant to Xanthomonas oryzae pv. oryzae (Xoo) infection. We previously demonstrated that expressing a chimeric protein containing the ELONGATION FACTOR Tu RECEPTOR (EFR) ectodomain and the XA21 endodomain (EFR:XA21) in rice does not confer robust resistance to Xoo . To test if the XA21 ectodomain is required for Xoo resistance, we produced transgenic rice lines expressing a chimeric protein consisting of the XA21 ectodomain and EFR endodomain (XA21:EFR) and inoculated these lines with Xoo . We also tested if the XA21:EFR rice plants respond to a synthetic sulfated 21 amino acid derivative (RaxX21-sY) of the activator of XA21-mediated immunity, RaxX. We found that five independently transformed XA21:EFR rice lines displayed resistance to Xoo as measured by lesion length analysis, and showed that five lines share characteristic markers of the XA21 defense response (generation of reactive oxygen species and defense response gene expression) after treatment with RaxX21-sY. Our results indicate that expression of the XA21:EFR chimeric receptor in rice confers resistance to Xoo . These results suggest that the endodomain of the EFR and XA21 immune receptors are interchangeable and the XA21 ectodomain is the key determinant conferring robust resistance to Xoo .
Directory of Open Access Journals (Sweden)
Barros CHN
2018-03-01
Full Text Available Caio Henrique Nasi de Barros, Guilherme Crispim Faria Cruz, Willian Mayrink, Ljubica Tasic Laboratory of Chemical Biology, Department of Organic Chemistry, Instituto de Química da Universidade Estadual de Campinas–Unicamp, Campinas, SP, Brazil Purpose: Despite the numerous reports on biological syntheses of silver nanoparticles (AgNPs, little is known about the composition of their capping agents, protein corona of plant extract-mediated synthesis, and their influence on the properties of AgNPs. Here, orange (Citrus sinensis waste was utilized as a source of an extract for AgNP synthesis (the protein corona composition of which was elucidated, and also as a starting material for hesperidin and nanocellulose extraction, which were used for bio-based AgNP synthesis. A comparison of the results using the two methods of synthesis is presented. Methods: AgNPs were synthesized using orange (C. sinensis peel extract (Or-AgNPs in a biological route, and using hesperidin (Hsd-AgNPs and nanocellulose (extracted from oranges in a green chemical route. Characterization of nanoparticles was carried out using zeta potential and hydrodynamic size measurements, transmission electron microscopy, and X-ray diffraction. Elucidation of proteins from protein corona was performed via ultra performance liquid chromatography-tandem mass spectrometer experiments. Antimicrobial activity was assessed via minimum inhibitory concentration assays against Xanthomonas axonopodis pv. citri (Xac, the bacterium that causes citric canker in oranges. Results: Or-AgNPs were not completely uniform in morphology, having a size of 48.1±20.5 nm and a zeta potential of −19.0±0.4 mV. Stabilization was performed mainly by three proteins, which were identified by tandem mass spectrometry (MS/MS experiments. Hsd-AgNPs were smaller (25.4±12.5 nm and had uniform morphology. Nanocellulose provided a strong steric and electrostatic (−28.2±1.0 mV stabilization to the nanoparticles
International Nuclear Information System (INIS)
Lin, Chien-Hung; Chin, Ko-Hsin; Gao, Fei Philip; Lyu, Ping-Chiang; Shr, Hui-Lin; Wang, Andrew H.-J.; Chou, Shan-Ho
2006-01-01
A probable copper-ion tolerance protein from the plant pathogen X. campestris has been overexpressed in E. coli, purified and crystallized. Divalent metal ions play key roles in all living organisms, serving as cofactors for many proteins involved in a variety of electron-transfer activities. However, copper ions are highly toxic when an excessive amount is accumulated in a cell. CutA1 is a protein found in all kingdoms of life that is believed to participate in copper-ion tolerance in Escherichia coli, although its specific function remains unknown. Several crystal structures of multimeric CutA1 with different rotation angles and degrees of interaction between trimer interfaces have been reported. Here, the cloning, expression, crystallization and preliminary X-ray analysis of XC2981, a possible CutA1 protein present in the plant pathogen Xanthomonas campestris, are reported. The XC2981 crystals diffracted to a resolution of 2.6 Å. They are cubic and belong to space group I23, with unit-cell parameters a = b = c = 130.73 Å
International Nuclear Information System (INIS)
Faria, J.N.; Balan, A.; Paes Leme, A.F.
2012-01-01
Full text: Xanthomonas citri is a phytopathogenic bacterium that infects citrus plants causing significant losses for the economy. In our group, we have focused on the identification and characterization of ABC transport proteins of this bacterium, in order to determinate their function for growth in vitro and in vivo, during infection. ABC transporters represent one of the largest families of proteins, which transport since small molecules as ions up to oligopeptides and sugars. In prokaryotic cells many works have reported the ABC transport function in pathogenesis, resistance, biofilm formation, infectivity and DNA repair, but until our knowledge, there is no data related to these transporters and X. citri. So, In order to determinate which transporters are expressed in X. citri, we started a proteomic analysis based on mono and bi-dimensional gels associated to mass spectrometry analyses. After growing X. citri and two different mutants deleted for ssuA and nitA genes in LB and minimum media, cellular extracts were obtained and used for preparation of mono and bi-dimensional gels. Seven bands covering the expected mass of ABC transporter components (20 kDa to 50 kDa) in SDS-PAGE were cut off the gel, treated with trypsin and submitted to the MS for protein identification. The results of 2D gels were good enough and will serve as a standard for development of similar experiments in large scale. (author)
Directory of Open Access Journals (Sweden)
Xing-Zheng Fu
Full Text Available Citrus canker disease caused by Xanthomonas citri subsp. citri (Xcc is one of the most devastating biotic stresses affecting the citrus industry. Meiwa kumquat (Fortunella crassifolia is canker-resistant, while Newhall navel orange (Citrus sinensis Osbeck is canker-sensitive. To understand the molecular mechanisms underlying the differences in responses to Xcc, transcriptomic profiles of these two genotypes following Xcc attack were compared by using the Affymetrix citrus genome GeneChip. A total of 794 and 1324 differentially expressed genes (DEGs were identified as canker-responsive genes in Meiwa and Newhall, respectively. Of these, 230 genes were expressed in common between both genotypes, while 564 and 1094 genes were only significantly expressed in either Meiwa or Newhall. Gene ontology (GO annotation and Singular Enrichment Analysis (SEA of the DEGs showed that genes related to the cell wall and polysaccharide metabolism were induced for basic defense in both Meiwa and Newhall, such as chitinase, glucanase and thaumatin-like protein. Moreover, apart from inducing basic defense, Meiwa showed specially upregulated expression of several genes involved in the response to biotic stimulus, defense response, and cation binding as comparing with Newhall. And in Newhall, abundant photosynthesis-related genes were significantly down-regulated, which may be in order to ensure the basic defense. This study revealed different molecular responses to canker disease in Meiwa and Newhall, affording insight into the response to canker and providing valuable information for the identification of potential genes for engineering canker tolerance in the future.
International Nuclear Information System (INIS)
Tu, Zhi-Le; Li, Juo-Ning; Chin, Ko-Hsin; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Lyu, Ping-Chiang; Gao, Fei Philip; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A putative repressor for the multiple antibiotic resistance operon from a plant pathogen X. campestris pv. campestris has been overexpressed in E. coli, purified and crystallized. The crystals diffracted to 2.3 Å with good quality. The multiple antibiotic resistance operon (marRAB) is a member of the multidrug-resistance system. When induced, this operon enhances resistance of bacteria to a variety of medically important antibiotics, causing a serious global health problem. MarR is a marR-encoded protein that represses the transcription of the marRAB operon. Through binding with salicylate and certain antibiotics, however, MarR can derepress and activate the marRAB operon. In this report, the cloning, expression, crystallization and preliminary X-ray analysis of XC1739, a putative MarR repressor protein present in the Xanthomonas campestris pv. campestris, a Gram-negative bacterium causing major worldwide disease of cruciferous crops, are described. The XC1739 crystals diffracted to a resolution of at least 1.8 Å. They are orthorhombic and belong to space group P2 1 2 1 2 1 , with unit-cell parameters a = 39.5, b = 54.2 and c = 139.5 Å, respectively. They contain two molecules in the asymmetric unit from calculation of the self-rotation function
Structural and functional analyses of the putrescine binding protein PotF from Xanthomonas citri
International Nuclear Information System (INIS)
Santana, L.D.F.; Balan, A.
2012-01-01
Full text: The focus of our group is to determinate the role of ABC transporters in the physiology and growth of Xanthomonas citri, a phytopathogenic bacteria that infects citrus plants causing significant losses for the economy. One of the ABC transporters identified in the X. citri genome and that was showed to be active during the infection in Citrus sinensis plants was the putrescine transporter. This transporter consists of two internal membrane proteins PotG and PotH that form a pore, a cytoplasmic protein that gives energy for the transport and the periplasmic-binding protein PotF, which is responsible for the affinity and specificity of the system. Its function is associated to the microbial carcinogenesis, biofilm formation, escape from phagolysosomes, bacteriocin production, toxin activity and protection from oxidative and acid stress. In this work, we show for the first time, the expression, purification, functional and structural analyses of the X. citri PotF protein. The PotF was expressed from Escherichia coli cells strain Arctic, as a 40 kDa soluble protein, after induction of IPTG for twenty four hours at thirteen deg C. Using immobilized metal affinity chromatography for purification, the protein was eluted in the fractions with 10-500 mM of imidazole. To test the folding and cability to bind putrescine, spectroscopic analyses were performed using circular dichroism and intrinsic fluorescence. The data showed that PotF suffers conformational changes in presence of ligands and in different pH, suggesting a possible interaction with the tested ligand. Moreover, based on bioinformatics studies and molecular modeling analyses, we showed that X. citri PotF is highly conserved when compared to orthologs present in other bacteria, including the residues that form the ligand-binding site. The production of PotF in a soluble and stable form will allow us to start the crystallization trials in attempt to solve its structure. (author)
In planta gene expression analysis of Xanthomonas oryzae pathovar oryzae, African strain MAI1
Directory of Open Access Journals (Sweden)
Verdier Valérie
2010-06-01
Full Text Available Abstract Background Bacterial leaf blight causes significant yield losses in rice crops throughout Asia and Africa. Although both the Asian and African strains of the pathogen, Xanthomonas oryzae pv. oryzae (Xoo, induce similar symptoms, they are nevertheless genetically different, with the African strains being more closely related to the Asian X. oryzae pv. oryzicola (Xoc. Results Changes in gene expression of the African Xoo strain MAI1 in the susceptible rice cultivar Nipponbare were profiled, using an SSH Xoo DNA microarray. Microarray hybridization was performed comparing bacteria recovered from plant tissues at 1, 3, and 6 days after inoculation (dai with bacteria grown in vitro. A total of 710 bacterial genes were found to be differentially expressed, with 407 up-regulated and 303 down-regulated. Expression profiling indicated that less than 20% of the 710 bacterial transcripts were induced in the first 24 h after inoculation, whereas 63% were differentially expressed at 6 dai. The 710 differentially expressed genes were one-end sequenced. 535 sequences were obtained from which 147 non-redundant sequences were identified. Differentially expressed genes were related to metabolism, secretion and transport, pathogen adherence to plant tissues, plant cell-wall degradation, IS elements, and virulence. In addition, various other genes encoding proteins with unknown function or showing no similarity to other proteins were also induced. The Xoo MAI1 non-redundant set of sequences was compared against several X. oryzae genomes, revealing a specific group of genes that was present only in MAI1. Numerous IS elements were also found to be differentially expressed. Quantitative real-time PCR confirmed 86% of the identified profile on a set of 14 genes selected according to the microarray analysis. Conclusions This is the first report to compare the expression of Xoo genes in planta across different time points during infection. This work shows that
Structural and functional analyses of the putrescine binding protein PotF from Xanthomonas citri
Energy Technology Data Exchange (ETDEWEB)
Santana, L.D.F.; Balan, A. [Laboratorio Nacional de Biociencias - LNBIO, Campinas, SP (Brazil)
2012-07-01
Full text: The focus of our group is to determinate the role of ABC transporters in the physiology and growth of Xanthomonas citri, a phytopathogenic bacteria that infects citrus plants causing significant losses for the economy. One of the ABC transporters identified in the X. citri genome and that was showed to be active during the infection in Citrus sinensis plants was the putrescine transporter. This transporter consists of two internal membrane proteins PotG and PotH that form a pore, a cytoplasmic protein that gives energy for the transport and the periplasmic-binding protein PotF, which is responsible for the affinity and specificity of the system. Its function is associated to the microbial carcinogenesis, biofilm formation, escape from phagolysosomes, bacteriocin production, toxin activity and protection from oxidative and acid stress. In this work, we show for the first time, the expression, purification, functional and structural analyses of the X. citri PotF protein. The PotF was expressed from Escherichia coli cells strain Arctic, as a 40 kDa soluble protein, after induction of IPTG for twenty four hours at thirteen deg C. Using immobilized metal affinity chromatography for purification, the protein was eluted in the fractions with 10-500 mM of imidazole. To test the folding and cability to bind putrescine, spectroscopic analyses were performed using circular dichroism and intrinsic fluorescence. The data showed that PotF suffers conformational changes in presence of ligands and in different pH, suggesting a possible interaction with the tested ligand. Moreover, based on bioinformatics studies and molecular modeling analyses, we showed that X. citri PotF is highly conserved when compared to orthologs present in other bacteria, including the residues that form the ligand-binding site. The production of PotF in a soluble and stable form will allow us to start the crystallization trials in attempt to solve its structure. (author)
Directory of Open Access Journals (Sweden)
Kelly Davelois
Full Text Available Objetivo. Determinar el rendimiento diagnóstico de la técnica de Western Blot para detectar simultáneamente anticuerpos en pacientes con cisticercosis, hidatidosis y fascioliasis humana. Materiales y métodos. Estudio transversal de evaluación de prueba diagnóstica. Se obtuvieron los antígenos de excreción-secreción de las larvas de Taenia solium, quistes de Echinococcus granulosus; y la forma adulta de Fasciola hepática; que luego fueron separados electroforéticamente en geles de poliacrilamida individuales, transferidos y fijados a una membrana de nitrocelulosa para ser enfrentados con sueros de pacientes con las tres parasitosis. La sensibilidad de la técnica se evaluó empleando 300 sueros individuales, 60 pools de dos parasitosis y 20 pools de tres parasitosis y la especificidad con 75 sueros de pacientes con otras parasitosis, 10 de pacientes con otras enfermedades y 15 sueros de personas no parasitadas. Resultados. La técnica reconoció trece glicoproteínas (GP: GP 35, 31, 24, 23, 18, 17, 14 y 13 kDa para cisticercosis, GP 8,16 y 21 kDa para hidatidosis y GP: 17 y 23 kDa para fascioliasis. La prueba detectó la presencia de anticuerpos alcanzando una sensibilidad de 96% (IC95%: 94,62-98,54% en la detección de una o las trece bandas, una especificidad de 100% (IC95%: 99,50 - 100,00%; individualmente, se tuvo una sensibilidad para cisticercosis de 97% (IC95%: 93,16-100%, para hidatidosis de 94% (IC95%: 88,85-99,15% y para fascioliasis de 96% (IC95%: 91,66-100%. Conclusiones. La prueba de Western blot es eficaz en la detección, simultanea de anticuerpos en pacientes con cisticercosis, hidatidosis y fascioliasis humana, y puede ser utilizada como prueba de descarte o confirmatoria en zonas endémicas.
Utilidad de los índices de memoria verbal para detectar simulación en población española
Directory of Open Access Journals (Sweden)
Raquel Vilar López
2013-01-01
Full Text Available Introducción. A pesar de que la literatura internacional ha demostrado la utilidad de diversos índices de las pruebas neuropsicológicas tradicionales de memoria verbal para ayudar en la detección de la simulación de problemas cognitivos, ningún estudio similar ha sido realizado todavía en nuestro contexto. Metodología. Este estudio ha incluido a 84 participantes divididos en 4 grupos: tres grupos de pacientes con traumatismo craneoencefálico leve (30 participantes que no buscan compensación económica, 14 participantes que buscan compensación económica pero no son sospechosos de simulación y un grupo de 10 participantes que busca una compensación económica y es sospechoso de simulación atendiendo a diversas pruebas específicas de simulación, además de un grupo de 30 análogos. Todos los participantes realizaron una extensa batería neuropsicológica en la que estaba incluido el Test de Aprendizaje Verbal España Complutense (TAVEC además de distintas pruebas específicas de simulación (Victoria Symptom Validity Test, Test of Memory Malingering, Dot Counting Test, el Test de la b y el Test de los 15 ítems de Rey. Resultados. Se han encontrado diferencias estadísticamente significativas entre los grupos para todos los índices del TAVEC propuestos como indicativos de simulación y tamaño del efecto elevado. Con una especificidad superior al 90%, algunos índices del TAVEC han mostrado una sensibilidad adecuada para detectar simulación: 50% el total de palabras recordadas en los cinco ensayos, el recuerdo a largo plazo y el reconocimiento, 40% el recuerdo libre a corto plazo y 60% la discriminabilidad Conclusiones. Algunos índices del TAVEC han mostrado su utilidad para ser empleados como un apoyo más en el complejo proceso de toma de decisiones que supone el diagnóstico de simulación, si bien nunca deberían interpretarse de modo aislado
Directory of Open Access Journals (Sweden)
RATIH DEWI HASTUTI
2012-12-01
Full Text Available Xanthomonas oryzae pv. oryzae (Xoo, a causal agent of bacterial leaf blight (BLB, is one of the most important pathogens of rice. The effectiveness of ten Streptomyces spp. isolates in suppressing Xoo disease was assessed in planta and in vitro. In planta experiments were carried out in a greenhouse and arranged in a randomized completely block design (RCBD with three replications. Twenty treatments were tested which included plants inoculated with both Streptomyces spp. and Xoo, and plants inoculated with only Streptomyces spp. Plants inoculated with Xoo and sprayed with a chemical bactericide, and plants inoculated with only Xoo served as positive controls, whereas plants not inoculated with either Streptomyces spp. or Xoo were used as negative controls. The results showed that the effect of endophytic Streptomyces spp. on BLB disease expressed as area under disease progress curve (AUDPC was not significantly different to that on control plants (P > 0.05. However, plants inoculated with endophytic Streptomyces spp. were significantly taller and produced higher tiller number than control plants (P < 0.05. Streptomyces spp. isolate AB131-1 gave the highest plant height. In vitro studies on biocontrol mechanisms of selected Streptomyces spp. isolates showed that isolate LBR02 gave the highest inhibition activity on Xoo growth, followed by AB131-1 and AB131-2. Two isolates (AB131-1 and LBR02 were able to produce chitinase, phosphatase, and siderophore which included biocontrol characteristics. Morphological and colonization studies under SEM and light microscopy confirmed that the three isolates were endophytic Streptomyces spp. from different species. These studies found that the paddy plant which was inoculated with endophytic Streptomyces spp. AB131-1 and infected by Xoo could increase the height of plant and number of tillers.
Directory of Open Access Journals (Sweden)
Fabio Gervasi
Full Text Available Bacterial spot caused by Xanthomonas arboricola pv. pruni (Xap is a major threat to Prunus species worldwide. The molecular mechanisms of peach resistance to Xap during early leaf infection were investigated by RNA-Seq analysis of two Prunus persica cultivars, 'Redkist' (resistant, and 'JH Hale' (susceptible at 30 minutes, 1 and 3 hours-post-infection (hpi. Both cultivars exhibited extensive modulation of gene expression at 30 mpi, which reduced significantly at 1 hpi, increasing again at 3 hpi. Overall, 714 differentially expressed genes (DEGs were detected in 'Redkist' (12% at 30 mpi and 1 hpi and 88% at 3 hpi. In 'JH Hale', 821 DEGs were identified (47% at 30 mpi and 1 hpi and 53% at 3 hpi. Highly up-regulated genes (fold change > 100 at 3 hpi exhibited higher fold change values in 'Redkist' than in 'JH Hale'. RNA-Seq bioinformatics analyses were validated by RT-qPCR. In both cultivars, DEGs included genes with putative roles in perception, signal transduction, secondary metabolism, and transcription regulation, and there were defense responses in both cultivars, with enrichment for the gene ontology terms, 'immune system process', 'defense response', and 'cell death'. There were particular differences between the cultivars in the intensity and kinetics of modulation of expression of genes with putative roles in transcriptional activity, secondary metabolism, photosynthesis, and receptor and signaling processes. Analysis of differential exon usage (DEU revealed that both cultivars initiated remodeling their transcriptomes at 30 mpi; however, 'Redkist' exhibited alternative exon usage for a greater number of genes at every time point compared with 'JH Hale'. Candidate resistance genes (WRKY-like, CRK-like, Copper amine oxidase-like, and TIR-NBS-LRR-like are of interest for further functional characterization with the aim of elucidating their role in Prunus spp. resistance to Xap.
Deng, Yinyue; Liu, Xiaoling; Wu, Ji'en; Lee, Jasmine; Chen, Shaohua; Cheng, Yingying; Zhang, Chunyan; Zhang, Lian-Hui
2015-04-01
Plant pathogen Xanthomonas campestris pv. campestris produces cis-11-methyl-2-dodecenoic acid (diffusible signal factor [DSF]) as a cell-cell communication signal to regulate biofilm dispersal and virulence factor production. Previous studies have demonstrated that DSF biosynthesis is dependent on the presence of RpfF, an enoyl-coenzyme A (CoA) hydratase, but the DSF synthetic mechanism and the influence of the host plant on DSF biosynthesis are still not clear. We show here that exogenous addition of host plant juice or ethanol extract to the growth medium of X. campestris pv. campestris could significantly boost DSF family signal production. It was subsequently revealed that X. campestris pv. campestris produces not only DSF but also BDSF (cis-2-dodecenoic acid) and another novel DSF family signal, which was designated DSF-II. BDSF was originally identified in Burkholderia cenocepacia to be involved in regulation of motility, biofilm formation, and virulence in B. cenocepacia. Functional analysis suggested that DSF-II plays a role equal to that of DSF in regulation of biofilm dispersion and virulence factor production in X. campestris pv. campestris. Furthermore, chromatographic separation led to identification of glucose as a specific molecule stimulating DSF family signal biosynthesis in X. campestris pv. campestris. (13)C-labeling experiments demonstrated that glucose acts as a substrate to provide a carbon element for DSF biosynthesis. The results of this study indicate that X. campestris pv. campestris could utilize a common metabolite of the host plant to enhance DSF family signal synthesis and therefore promote virulence. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
Directory of Open Access Journals (Sweden)
Didier Socquet-Juglard
Full Text Available Xanthomonas arboricola pv. pruni is a quarantine bacterial pathogen that threatens peach production by causing necrotic spots on leaves and fruits, thus with the potential of severely reducing yields. The current understanding of the host plant defense responses to the pathogen is very limited. Using whole transcriptome sequencing, differential gene expression was analyzed at two time points, 2 h and 12 h post inoculation (hpi, by comparing the inoculated samples to their respective controls. On the total of 19,781 known peach genes that were expressed in all time points and conditions, 34 and 263 were differentially expressed at 2 and 12 hpi, respectively. Of those, 82% and 40% were up-regulated, respectively; and 18% and 60% were down-regulated, respectively. The functional annotation based on gene ontology (GO analysis highlighted that genes involved in metabolic process and response to stress were particularly represented at 2 hpi whereas at 12 hpi cellular and metabolic processes were the categories with the highest number of genes differentially expressed. Of particular interest among the differentially expressed genes identified were several pathogen-associated molecular pattern (PAMP receptors, disease resistance genes including several RPM1-like and pathogenesis related thaumatin encoding genes. Other genes involved in photosynthesis, in cell wall reorganization, in hormone signaling pathways or encoding cytochrome were also differentially expressed. In addition, novel transcripts were identified, providing another basis for further characterization of plant defense-related genes. Overall, this study gives a first insight of the peach defense mechanisms during the very early stages of infection with a bacterial disease in the case of a compatible interaction.
Directory of Open Access Journals (Sweden)
James Amor Smith
Full Text Available The branched-chain sugar apiose was widely assumed to be synthesized only by plant species. In plants, apiose-containing polysaccharides are found in vascularized plant cell walls as the pectic polymers rhamnogalacturonan II and apiogalacturonan. Apiosylated secondary metabolites are also common in many plant species including ancestral avascular bryophytes and green algae. Apiosyl-residues have not been documented in bacteria. In a screen for new bacterial glycan structures, we detected small amounts of apiose in methanolic extracts of the aerobic phototroph Geminicoccus roseus and the pathogenic soil-dwelling bacteria Xanthomonas pisi. Apiose was also present in the cell pellet of X. pisi. Examination of these bacterial genomes uncovered genes with relatively low protein homology to plant UDP-apiose/UDP-xylose synthase (UAS. Phylogenetic analysis revealed that these bacterial UAS-like homologs belong in a clade distinct to UAS and separated from other nucleotide sugar biosynthetic enzymes. Recombinant expression of three bacterial UAS-like proteins demonstrates that they actively convert UDP-glucuronic acid to UDP-apiose and UDP-xylose. Both UDP-apiose and UDP-xylose were detectable in cell cultures of G. roseus and X. pisi. We could not, however, definitively identify the apiosides made by these bacteria, but the detection of apiosides coupled with the in vivo transcription of bUAS and production of UDP-apiose clearly demonstrate that these microbes have evolved the ability to incorporate apiose into glycans during their lifecycles. While this is the first report to describe enzymes for the formation of activated apiose in bacteria, the advantage of synthesizing apiose-containing glycans in bacteria remains unknown. The characteristics of bUAS and its products are discussed.
Fu, Xing-Zheng; Chen, Chuan-Wu; Wang, Yin; Liu, Ji-Hong; Moriguchi, Takaya
2011-03-28
Enormous work has shown that polyamines are involved in a variety of physiological processes, but information is scarce on the potential of modifying disease response through genetic transformation of a polyamine biosynthetic gene. In the present work, an apple spermidine synthase gene (MdSPDS1) was introduced into sweet orange (Citrus sinensis Osbeck 'Anliucheng') via Agrobacterium-mediated transformation of embryogenic calluses. Two transgenic lines (TG4 and TG9) varied in the transgene expression and cellular endogenous polyamine contents. Pinprick inoculation demonstrated that the transgenic lines were less susceptible to Xanthomonas axonopodis pv. citri (Xac), the causal agent of citrus canker, than the wild type plants (WT). In addition, our data showed that upon Xac attack TG9 had significantly higher free spermine (Spm) and polyamine oxidase (PAO) activity when compared with the WT, concurrent with an apparent hypersensitive response and the accumulation of more H₂O₂. Pretreatment of TG9 leaves with guazatine acetate, an inhibitor of PAO, repressed PAO activity and reduced H₂O₂ accumulation, leading to more conspicuous disease symptoms than the controls when both were challenged with Xac. Moreover, mRNA levels of most of the defense-related genes involved in synthesis of pathogenesis-related protein and jasmonic acid were upregulated in TG9 than in the WT regardless of Xac infection. Our results demonstrated that overexpression of the MdSPDS1 gene prominently lowered the sensitivity of the transgenic plants to canker. This may be, at least partially, correlated with the generation of more H₂O₂ due to increased production of polyamines and enhanced PAO-mediated catabolism, triggering hypersensitive response or activation of defense-related genes.
Estrategia de silenciamiento génico en yuca para la validación de genes de resistencia.
Directory of Open Access Journals (Sweden)
Camilo Ernesto Lopez
2010-05-01
Full Text Available La yuca (Manihot esculenta constituye la base de la alimentación para mas de 1000 millones de personas en el mundo considerándose por esta razón un cultivo primordial para la seguridad alimentaria. La bacteriosis vascular ocasionada por la bacteria gram negativa Xanthomonas axonopodis pv. manihotis (Xam es uno de las factores mas limitantes para la producción en este cultivo. Un gen de resistencia candidato de yuca a la bacteriosis vascular, denominado RXam1, ha sido previamente identificado. En este trabajo se empleó la estrategia de silenciamiento génico mediado por el geminivirus ACMV (del ingles African Cassava Mosaic Virus para validar la función del gen RXam1. Como control positivo se utilizó el gen su, cuyo silenciamiento produce blanqueamiento en las hojas. Plantas de la variedad SG10735 fueron bombardeadas con las construcciones ACMV-A-SU + ACMV-B y ACMV-A-RXam1 + ACMV-B. La eficiencia de silenciamiento empleando el gen su fue baja, observándose un fenotipo de blanqueamiento en solo una de las siete plantas. En las plantas posiblemente silenciadas en el gen RXam1, no se logró identificar siRNAs correspondientes a este gen, aunque si se observó una leve disminución en la expresión de RXam1 en una de las plantas evaluadas. Las curvas de crecimiento para la cepa Xam CIO136 en plantas de yuca inoculadas mostraron una leve pero no significativa diferencia en la susceptibilidad de las plantas silenciadas con respecto a las no silenciadas.
International Nuclear Information System (INIS)
Doan, Thanh Thi Ngoc; Kim, Jin-Kwang; Kim, Hyesoon; Ahn, Yeh-Jin; Kim, Jeong-Gu; Lee, Byoung-Moo; Kang, Lin-Woo
2008-01-01
Xoo0352, which encodes d-alanine-d-alanine ligase A (DdlA), from X. oryzae pv. oryzae was cloned, purified and crystallized. Preliminary X-ray crystallographic analysis of DdlA crystals was performed. Xanthomonas oryzae pv. oryzae (Xoo) causes bacterial blight (BB), which is one of the most devastating diseases of rice in most rice-growing countries. d-Alanine-d-alanine ligase A (DdlA), coded by the Xoo0352 gene, was expressed, purified and crystallized. DdlA is an enzyme that is involved in d-alanine metabolism and the biosynthesis of an essential bacterial peptidoglycan precursor, in which it catalyzes the formation of d-alanyl-d-alanine from two d-alanines, and is thus an attractive antibacterial drug target against Xoo. The DdlA crystals diffracted to 2.3 Å resolution and belonged to the primitive tetragonal space group P4 3 2 1 2, with unit-cell parameters a = b = 83.0, c = 97.6 Å. There is one molecule in the asymmetric unit, with a corresponding V M of 1.88 Å 3 Da −1 and a solvent content of 34.6%. The initial structure was determined by molecular replacement using d-alanine-d-alanine ligase from Staphylococcus aureus as a template model
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... axonopodis pv. citri str. 306] ... Length = 131 ... Query: 1 ... MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHD...GYVV 60 ... MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHD...GYVV Sbjct: 1 ... MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHDGYVV 60 ... Query: 121 AFFRRLGFAVE 131 ... AFFRRLGFAVE Sbjct: 121 AFFRRLGFAVE 131
Jin, Yuan; Goodman, Richard E; Tetteh, Afua O; Lu, Mei; Tripathi, Leena
2017-11-01
Banana Xanthomonas wilt (BXW) disease threatens banana production and food security throughout East Africa. Natural resistance is lacking among common cultivars. Genetically modified (GM) bananas resistant to BXW disease were developed by inserting the hypersensitive response-assisting protein (Hrap) or/and the plant ferredoxin-like protein (Pflp) gene(s) from sweet pepper (Capsicum annuum). Several of these GM banana events showed 100% resistance to BXW disease under field conditions in Uganda. The current study evaluated the potential allergenicity and toxicity of the expressed proteins HRAP and PFLP based on evaluation of published information on the history of safe use of the natural source of the proteins as well as established bioinformatics sequence comparison methods to known allergens (www.AllergenOnline.org and NCBI Protein) and toxins (NCBI Protein). The results did not identify potential risks of allergy and toxicity to either HRAP or PFLP proteins expressed in the GM bananas that might suggest potential health risks to humans. We recognize that additional tests including stability of these proteins in pepsin assay, nutrient analysis and possibly an acute rodent toxicity assay may be required by national regulatory authorities. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Yew,W.; Fedorov, A.; Fedorov, E.; Rakus, J.; Pierce, R.; Almo, S.; Gerlt, J.
2006-01-01
Many members of the mechanistically diverse enolase superfamily have unknown functions. In this report the authors use both genome (operon) context and screening of a library of acid sugars to assign the L-fuconate dehydratase (FucD) function to a member of the mandelate racemase (MR) subgroup of the superfamily encoded by the Xanthomonas campestris pv. campestris str. ATCC 33913 genome (GI: 21233491). Orthologues of FucD are found in both bacteria and eukaryotes, the latter including the rTS beta protein in Homo sapiens that has been implicated in regulating thymidylate synthase activity. As suggested by sequence alignments and confirmed by high-resolution structures in the presence of active site ligands, FucD and MR share the same active site motif of functional groups: three carboxylate ligands for the essential Mg2+ located at the ends of th third, fourth, and fifth-strands in the (/)7-barrel domain (Asp 248, Glu 274, and Glu 301, respectively), a Lys-x-Lys motif at the end of the second-strand (Lys 218 and Lys 220), a His-Asp dyad at the end of the seventh and sixth-strands (His 351 and Asp 324, respectively), and a Glue at the end of the eighth-strand (Glu 382). The mechanism of the FucD reaction involves initial abstraction of the 2-proton by Lys 220, acid catalysis of the vinylogous-elimination of the 3-OH group by His 351, and stereospecific ketonization of the resulting 2-keto-3-deoxy-L-fuconate product. Screening of the library of acid sugars revealed substrate and functional promiscuity: In addition to L-fuconate, FucD also catalyzes the dehydration of L-galactonate, D-arabinonate, D-altronate, L-talonate, and D-ribonate. The dehydrations of L-fuconate, L-galactonate, and D-arabinonate are initiated by abstraction of the 2-protons by Lys 220. The dehydrations of L-talonate and D-ribonate are initiated by abstraction of the 2-protons by His 351; however, protonation of the enediolate intermediates by the conjugate acid of Lys 220 yields L
Structure of XC6422 from Xanthomonas campestris at 1.6 Å resolution: a small serine α/β-hydrolase
Energy Technology Data Exchange (ETDEWEB)
Yang, Chao-Yu; Chin, Ko-Hsin [Institute of Biochemistry, National Chung-Hsing University, Taichung 40227,Taiwan (China); Chou, Chia-Cheng; Wang, Andrew H.-J. [Institute of Biological Chemistry, Academia Sinica, Nankang, Taipei,Taiwan (China); Core Facility for Protein Crystallography, Academia Sinica, Nankang, Taipei,Taiwan (China); Chou, Shan-Ho, E-mail: shchou@nchu.edu.tw [Institute of Biochemistry, National Chung-Hsing University, Taichung 40227,Taiwan (China)
2006-06-01
The crystal structure of a conserved hypothetical protein from X. campestris has been determined to a resolution of 1.6 Å. The determined X. campestris structure shows that it belongs to the superfamily of serine α/β hydrolase, with an extra strand preceding the first β-strand to lead to extensive subunit interactions in the crystal. XC6422 is a conserved hypothetical protein from Xanthomonas campestris pathovar campestris (Xcc), a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. The protein consists of 220 amino acids and its structure has been determined to 1.6 Å resolution using the multi-wavelength anomalous dispersion (MAD) method. Although it has very low sequence identity to protein sequences in the PDB (less than 20%), the determined structure nevertheless shows that it belongs to the superfamily of serine α/β-hydrolases, with an active site that is fully accessible to solvent owing to the absence of a lid domain. Modelling studies with the serine esterase inhibitor E600 indicate that XC6422 adopts a conserved Ser-His-Asp catalytic triad common to this superfamily and has a preformed oxyanion hole for catalytic activation. These structural features suggest that XC6422 is most likely to be a hydrolase active on a soluble ester or a small lipid. An extra strand preceding the first β-strand in the canonical α/β-hydrolase fold leads to extensive subunit interactions between XC6422 monomers, which may explain why XC6422 crystals of good diffraction quality can grow to dimensions of up to 1.5 mm in a few days.
Park, Chang-Jin; Wei, Tong; Sharma, Rita; Ronald, Pamela C
2017-12-01
The rice immune receptor XA21 confers resistance to the bacterial pathogen, Xanthomonas oryzae pv. oryzae (Xoo). To elucidate the mechanism of XA21-mediated immunity, we previously performed a yeast two-hybrid screening for XA21 interactors and identified XA21 binding protein 21 (XB21). Here, we report that XB21 is an auxilin-like protein predicted to function in clathrin-mediated endocytosis. We demonstrate an XA21/XB21 in vivo interaction using co-immunoprecipitation in rice. Overexpression of XB21 in rice variety Kitaake and a Kitaake transgenic line expressing XA21 confers a necrotic lesion phenotype and enhances resistance to Xoo. RNA sequencing reveals that XB21 overexpression results in the differential expression of 8735 genes (4939 genes up- and 3846 genes down-regulated) (≥2-folds, FDR ≤0.01). The up-regulated genes include those predicted to be involved in 'cell death' and 'vesicle-mediated transport'. These results indicate that XB21 plays a role in the plant immune response and in regulation of cell death. The up-regulation of genes controlling 'vesicle-mediated transport' in XB21 overexpression lines is consistent with a functional role for XB21 as an auxilin.
Directory of Open Access Journals (Sweden)
Areli Herrera Diaz
Full Text Available Antimicrobial peptides (AMPs are small peptides with less than 50 amino acids and are part of the innate immune response in almost all organisms, including bacteria, vertebrates, invertebrates and plants. AMPs are active against a broad-spectrum of pathogens. The inducible expression of AMPs in plants is a promising approach to combat plant pathogens with minimal negative side effects, such as phytotoxicity or infertility. In this study, inducible expression of the de-novo designed AMP SP1-1 in Micro Tom tomato protected tomato fruits against bacterial spot disease caused by Xanthomonas campestris pv. vesicatoria. The peptide SP1-1 was targeted to the apoplast which is the primary infection site for plant pathogens, by fusing SP1-1 peptide to the signal peptide RsAFP1 of radish (Raphanus sativus. The pathogen inducibility of the expression was enabled by using an optimized inducible 4XW2/4XS promoter. As a result, the tomato fruits of independently generated SP1-1 transgenic lines were significantly more resistant to X. campestris pv. vesicatoria than WT tomato fruits. In transgenic lines, bacterial infection was reduced up to 65% in comparison to the infection of WT plants. Our study demonstrates that the combination of the 4XW2/4XS cis-element from parsley with the synthetic antimicrobial peptide SP1-1 is a good alternative to protect tomato fruits against infections with X. campestris pv. vesicatoria.
Directory of Open Access Journals (Sweden)
Abdjad Asih Nawangsih
2011-04-01
Full Text Available Xanthomonas oryzae pv oryzae the Causal Agent of Bacterial Leaf Blight of rice: Isolation, Characterization, and Study of Transposon Mutagenesis. X. oryzae pv. oryzae (Xoo causes bacterial leaf blight (BLB of rice (Oryza sativa L., a major disease that constrains production of the staple crop in many countries of the world. Identification of X. oryzae pv. oryzae (Xoo was conducted based on the disease symptoms, pathogenicity, morphological, physiological, and genetic characteristics of bacterial cultures isolated from the infected plants. Fifty bacterial isolates predicted as Xoo have been successfully isolated. They are aerobic, rod shaped, and Gram negative bacteria. The isolates were evaluated for their hypersensitivity in tobacco and pathogenicity in rice plant. Fifty isolates induced hypersensitive reaction in tobacco and showed pathogenicity symptom in rice in different length. Based on physiological test, hypersensitivity and pathogenicity reactions, three bacterial isolates strongly predicted as Xoo, i.e. STG21, STG42, and STG46, were non indole formation, non pigment fluorescent, hydrolyzed casein, catalase activity positive, but negative oxidase. Partial sequencing of 16S rRNA genes of STG21 and STG42 showed 80% and 82% homology with X. oryzae, respectively, while STG46 showed 84% homology with X. campestris. Mini-Tn5 transposon mutagenesis of STG21 generated one of the mutants (M5 lossed it’s ability to induce hypersensitive reaction in tobacco plant and deficient in pathogenicity on rice. The lesion length of rice leaf caused by the mutant M5 decreased up to 80%.
Institute of Scientific and Technical Information of China (English)
Hong-Jing Li; Xiang-Hua Li; Jing-Hua Xiao; Rod A. Wing; Shi-Ping Wang
2012-01-01
The rice disease resistance (R) gene Xa3/Xa26 (having also been named Xa3 and Xa26) against Xanthomonas oryzae pv.oryzae (Xoo),which causes bacterial blight disease,belongs to a multiple gene family clustered in chromosome 11 and is from an AA genome rice cultivar (Oryza sativa L.).This family encodes leucine-rich repeat (LRR) receptor kinasetype proteins.Here,we show that the orthologs (alleles) of Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3,from wild Oryza species O.officinalis (CC genome) and O.minuta (BBCC genome),respectively,were also R genes against Xoo.Xa3/Xa26-2 and Xa3/Xa26-3 conferred resistance to 16 of the 18 Xoo strains examined.Comparative sequence analysis of the Xa3/Xa26 families in the two wild Oryza species showed that Xa3/Xa26-3 appeared to have originated from the CC genome of O.minuta.The predicted proteins encoded by Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3 share 91-99% sequence identity and 94-99% sequence similarity.Transgenic plants carrying a single copy of Xa3/Xa26,Xa3/Xa26-2,or Xa3/Xa26-3,in the same genetic background,showed a similar resistance spectrum to a set of Xoo strains,although plants carrying Xa3/Xa26-2 or Xa3/Xa26-3 showed lower resistance levels than the plants carrying Xa3/Xa26.These results suggest that the Xa3/Xa26 locus predates the speciation of A and C genome,which is approximately 7.5 million years ago.Thus,the resistance specificity of this locus has been conserved for a long time.
Directory of Open Access Journals (Sweden)
Wang Yin
2011-03-01
Full Text Available Abstract Background Enormous work has shown that polyamines are involved in a variety of physiological processes, but information is scarce on the potential of modifying disease response through genetic transformation of a polyamine biosynthetic gene. Results In the present work, an apple spermidine synthase gene (MdSPDS1 was introduced into sweet orange (Citrus sinensis Osbeck 'Anliucheng' via Agrobacterium-mediated transformation of embryogenic calluses. Two transgenic lines (TG4 and TG9 varied in the transgene expression and cellular endogenous polyamine contents. Pinprick inoculation demonstrated that the transgenic lines were less susceptible to Xanthomonas axonopodis pv. citri (Xac, the causal agent of citrus canker, than the wild type plants (WT. In addition, our data showed that upon Xac attack TG9 had significantly higher free spermine (Spm and polyamine oxidase (PAO activity when compared with the WT, concurrent with an apparent hypersensitive response and the accumulation of more H2O2. Pretreatment of TG9 leaves with guazatine acetate, an inhibitor of PAO, repressed PAO activity and reduced H2O2 accumulation, leading to more conspicuous disease symptoms than the controls when both were challenged with Xac. Moreover, mRNA levels of most of the defense-related genes involved in synthesis of pathogenesis-related protein and jasmonic acid were upregulated in TG9 than in the WT regardless of Xac infection. Conclusion Our results demonstrated that overexpression of the MdSPDS1 gene prominently lowered the sensitivity of the transgenic plants to canker. This may be, at least partially, correlated with the generation of more H2O2 due to increased production of polyamines and enhanced PAO-mediated catabolism, triggering hypersensitive response or activation of defense-related genes.
Wei, Yunxie; Liu, Guoyin; Bai, Yujing; Xia, Feiyu; He, Chaozu; Shi, Haitao; Foyer, Christine
2017-10-13
Similar to the situation in animals, melatonin biosynthesis is regulated by four sequential enzymatic steps in plants. Although the melatonin synthesis genes have been identified in various plants, the upstream transcription factors of them remain unknown. In this study on cassava (Manihot esculenta), we found that MeWRKY79 and heat-shock transcription factor 20 (MeHsf20) targeted the W-box and the heat-stress elements (HSEs) in the promoter of N-acetylserotonin O-methyltransferase 2 (MeASMT2), respectively. The interaction between MeWRKY79, MeHsf20, and the MeASMT2 promoter was evidenced by the activation of promoter activity and chromatin immunoprecipitation (ChIP) in cassava protoplasts, and by an in vitro electrophoretic mobility shift assay (EMSA). The transcripts of MeWRKY79, MeHsf20, and MeASMT2 were all regulated by a 22-amino acid flagellin peptide (flg22) and by Xanthomonas axonopodis pv manihotis (Xam). In common with the phenotype of MeASMT2, transient expression of MeWRKY79 and MeHsf20 in Nicotiana benthamiana leaves conferred improved disease resistance. Through virus-induced gene silencing (VIGS) in cassava, we found that MeWRKY79- and MeHsf20-silenced plants showed lower transcripts of MeASMT2 and less accumulation of melatonin, which resulted in disease sensitivity that could be reversed by exogenous melatonin. Taken together, these results indicate that MeASMT2 is a target of MeWRKY79 and MeHsf20 in plant disease resistance. This study identifies novel upstream transcription factors of melatonin synthesis genes in cassava, thus extending our knowledge of the complex modulation of melatonin synthesis in plant defense. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Pan, Xiayan; Wu, Jian; Xu, Shu; Duan, Yabing; Zhou, Mingguo
2017-02-01
Rice bacterial leaf blight, caused by Xanthomonas oryzae pv. oryzae, and rice bacterial leaf streak, caused by X. oryzae pv. oryzicola, are major diseases of rice. Phenazine-1-carboxylic acid (PCA) is a natural product that is isolated from Pseudomonas spp. and is used to control many important rice diseases in China. We previously reported that PCA disturbs the redox balance, which results in the accumulation of reactive oxygen species in X. oryzae pv. oryzae. In this study, we found that PCA significantly upregulated the transcript levels of catB and katE, which encode catalases, and that PCA sensitivity was reduced when X. oryzae pvs. oryzae and oryzicola were cultured with exogenous catalase. Furthermore, catB deletion mutants of X. oryzae pvs. oryzae and oryzicola showed dramatically decreased total catalase activity, increased sensitivity to PCA, and reduced virulence in rice. In contrast, deletion mutants of srpA and katG, which also encode catalases, exhibited little change in PCA sensitivity. The results indicate that catB in both X. oryzae pvs. oryzae and oryzicola encodes a catalase that helps protect the bacteria against PCA-induced stress.
Hamza, A A; Robene-Soustrade, I; Jouen, E; Lefeuvre, P; Chiroleu, F; Fisher-Le Saux, M; Gagnevin, L; Pruvost, O
2012-05-01
MultiLocus Sequence Analysis (MLSA) and Amplified Fragment Length Polymorphism (AFLP) were used to measure the genetic relatedness of a comprehensive collection of xanthomonads pathogenic to solaneous hosts to Xanthomonas species. The MLSA scheme was based on partial sequences of four housekeeping genes (atpD, dnaK, efp and gyrB). Globally, MLSA data unambiguously identified strains causing bacterial spot of tomato and pepper at the species level and was consistent with AFLP data. Genetic distances derived from both techniques showed a close relatedness of (i) X. euvesicatoria, X. perforans and X. alfalfae and (ii) X. gardneri and X. cynarae. Maximum likelihood tree topologies derived from each gene portion and the concatenated data set for species in the X. campestris 16S rRNA core (i.e. the species cluster comprising all strains causing bacterial spot of tomato and pepper) were not congruent, consistent with the detection of several putative recombination events in our data sets by several recombination search algorithms. One recombinant region in atpD was identified in most strains of X. euvesicatoria including the type strain. Copyright © 2012 Elsevier GmbH. All rights reserved.
Vieira, F C F; Gonçalves, A M; Mendoza, E F R; Ferreira, R M; Costa, M L M; Balbuena, T S; Sebinelli, H G; Ciancaglini, P; Pizauro Junior, J M; Ferro, J A
2017-08-31
Citrus canker, caused by the Gram-negative bacterium Xanthomonas citri subsp citri (Xac), severely affects most economically important citrus varieties worldwide. A previous study showed that disruption of the ORF XAC1201 from the Xac 306 strain by transposon Tn5 decreased bacterium virulence in the Rangpur lime host (Citrus limonia L. Osbeck). However, little is known regarding the possible function of the hypothetical protein XAC1201 and how it affects the virulence of Xac 306. Here, we confirmed that disruption of ORF XAC1201 reduces Xac 306 virulence in two different hosts, delaying the onset of typical symptoms. In silico analysis suggested that XAC1201 interacts with the flagellar proteins FliM and FliL, known to be an important factor for virulence. In fact, motility assays revealed that the XAC1201 mutant has a significant difference in motility compared to the wild-type Xac 306. Also, a 3-D structure model revealed modified cofactor binding sites and suggested that XAC1201 has a non-functional HD domain. This hypothesis was confirmed by enzymatic assays performed in purified, XAC1201 recombinant protein expressed in Escherichia coli, which revealed no significant activities previously associated with HD domains for the tested substrates. Thus, the role of the XAC1201 protein in Xac 306 virulence seems to be related to flagellar motility, although a non-classic role for the HD domain cannot be dismissed.
Zhuo, Tao; Rou, Wei; Song, Xue; Guo, Jing; Fan, Xiaojing; Kamau, Gicharu Gibson; Zou, Huasong
2015-10-23
The carA and carB genes code the small and large subunits of carbamoyl-phosphate synthase (CPS) that responsible for arginine and pyrimidine production. The purpose of this work was to study the gene organization and expression pattern of carAB operon, and the biological functions of carA and carB genes in Xanthomonas citri subsp. citri. RT-PCR method was employed to identify the full length of carAB operon transcript in X. citri subsp. citri. The promoter of carAB operon was predicted and analyzed its activity by fusing a GUS reporter gene. The swimming motility was tested on 0.25% agar NY plates with 1% glucose. Biofilm was measured by cell adhesion to polyvinyl chloride 96-well plate. The results indicated that carAB operon was composed of five gene members carA-orf-carB-greA-rpfE. A single promoter was predicted from the nucleotide sequence upstream of carAB operon, and its sensitivity to glutamic acid, uracil and arginine was confirmed by fusing a GUS reporter gene. Deletion mutagenesis of carB gene resulted in reduced abilities in swimming on soft solid media and in forming biofilm on polystyrene microtiter plates. From these results, we concluded that carAB operon was involved in multiple biological processes in X. citri subsp. citri.
Directory of Open Access Journals (Sweden)
Rebecca S Bart
2010-09-01
Full Text Available Rice NH1 (NPR1 homolog 1 is a key mediator of innate immunity. In both plants and animals, the innate immune response is often accompanied by rapid cell death at the site of pathogen infection. Over-expression of NH1 in rice results in resistance to the bacterial pathogen, Xanthomonas oryzae pv. oryzae (Xoo, constitutive expression of defense related genes and enhanced benzothiadiazole (BTH- mediated cell death. Here we describe a forward genetic screen that identified a suppressor of NH1-mediated lesion formation and resistance, snl6. Comparative genome hybridization and fine mapping rapidly identified the genomic location of the Snl6 gene. Snl6 is a member of the cinnamoyl-CoA reductase (CCR-like gene family. We show that Snl6 is required for NH1-mediated resistance to Xoo. Further, we show that Snl6 is required for pathogenesis-related gene expression. In contrast to previously described CCR family members, disruption of Snl6 does not result in an obvious morphologic phenotype. Snl6 mutants have reduced lignin content and increased sugar extractability, an important trait for the production of cellulosic biofuels. These results suggest the existence of a conserved group of CCR-like genes involved in the defense response, and with the potential to alter lignin content without affecting development.
Nagel, Raimund; Turrini, Paula C G; Nett, Ryan S; Leach, Jan E; Verdier, Valérie; Van Sluys, Marie-Anne; Peters, Reuben J
2017-05-01
Phytopathogens have developed elaborate mechanisms to attenuate the defense response of their host plants, including convergent evolution of complex pathways for production of the GA phytohormones, which were actually first isolated from the rice fungal pathogen Gibberella fujikuroi. The rice bacterial pathogen Xanthomonas oryzae pv. oryzicola (Xoc) has been demonstrated to contain a biosynthetic operon with cyclases capable of producing the universal GA precursor ent-kaurene. Genetic (knock-out) studies indicate that the derived diterpenoid serves as a virulence factor for this rice leaf streak pathogen, serving to reduce the jasmonic acid-mediated defense response. Here the functions of the remaining genes in the Xoc operon are elucidated and the distribution of the operon in X. oryzae is investigated in over 100 isolates. The Xoc operon leads to production of the bioactive GA 4 , an additional step beyond production of the penultimate precursor GA 9 mediated by the homologous operons recently characterized from rhizobia. Moreover, this GA biosynthetic operon was found to be widespread in Xoc (> 90%), but absent in the other major X. oryzae pathovar. These results indicate selective pressure for production of GA 4 in the distinct lifestyle of Xoc, and the importance of GA to both fungal and bacterial pathogens of rice. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Suayib Üstün
Full Text Available The phytopathogenic bacterium Xanthomonas campestris pv. vesicatoria (Xcv requires type III effector proteins (T3Es for virulence. After translocation into the host cell, T3Es are thought to interact with components of host immunity to suppress defence responses. XopJ is a T3E protein from Xcv that interferes with plant immune responses; however, its host cellular target is unknown. Here we show that XopJ interacts with the proteasomal subunit RPT6 in yeast and in planta to inhibit proteasome activity. A C235A mutation within the catalytic triad of XopJ as well as a G2A exchange within the N-terminal myristoylation motif abolishes the ability of XopJ to inhibit the proteasome. Xcv ΔxopJ mutants are impaired in growth and display accelerated symptom development including tissue necrosis on susceptible pepper leaves. Application of the proteasome inhibitor MG132 restored the ability of the Xcv ΔxopJ to attenuate the development of leaf necrosis. The XopJ dependent delay of tissue degeneration correlates with reduced levels of salicylic acid (SA and changes in defence- and senescence-associated gene expression. Necrosis upon infection with Xcv ΔxopJ was greatly reduced in pepper plants with reduced expression of NPR1, a central regulator of SA responses, demonstrating the involvement of SA-signalling in the development of XopJ dependent phenotypes. Our results suggest that XopJ-mediated inhibition of the proteasome interferes with SA-dependent defence response to attenuate onset of necrosis and to alter host transcription. A central role of the proteasome in plant defence is discussed.
Directory of Open Access Journals (Sweden)
Md. Tabibul Islam
2017-12-01
Full Text Available This study aimed to directly elucidate cultivar variation in disease susceptibility and disease responses in relation to hormonal status in the interaction of Brassica napus cultivars and Xanthomonas campestris pv. campestris (Xcc, the causal agent of black rot disease. Fully expanded leaves of six B. napus cultivars (cvs. Capitol, Youngsan, Saturnin, Colosse, Tamra, and Mosa were inoculated with Xcc. At 14 days post-inoculation with Xcc, cultivar variation in susceptibility or resistance was interpreted with defense responses as estimated by redox status, defensive metabolites, and expression of phenylpropanoid synthesis-related genes in relation to endogenous hormonal status. Disease susceptibility of six cultivars was distinguished by necrotic lesions in the Xcc-inoculated leaves and characterized concurrently based on the higher increase in reactive oxygen species and lipid peroxidation. Among these cultivars, as the susceptibility was higher, the ratios of abscisic acid (ABA/jasmonic acid (JA and salicylic acid (SA/JA tended to increase with enhanced expression of SA signaling regulatory gene NPR1 and transcriptional factor TGA1 and antagonistic suppression of JA-regulated gene PDF 1.2. In the resistant cultivar (cv. Capitol, accumulation of defensive metabolites with enhanced expression of genes involved in flavonoids (chalcone synthase, proanthocyanidins (anthocyanidin reductase, and hydroxycinnamic acids (ferulate-5-hydroxylase biosynthesis and higher redox status were observed, whereas the opposite results were obtained for susceptible cultivars (cvs. Mosa and Tamra. These results clearly indicate that cultivar variation in susceptibility to infection by Xcc was determined by enhanced alteration of the SA/JA ratio, as a negative regulator of redox status and phenylpropanoid synthesis in the Brasica napus–Xcc pathosystem.
NCBI nr-aa BLAST: CBRC-TNIG-22-0185 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0185 ref|YP_451103.1| manganese transport protein [Xanthomonas oryzae ...pv. oryzae MAFF 311018] dbj|BAE68829.1| manganese transport protein [Xanthomonas oryzae pv. oryzae MAFF 311018] YP_451103.1 0.030 28% ...
Santacruz-Perez, Carolina; Pegos, Vanessa Rodrigues; Honorato, Rodrigo V; Verli, Hugo; Lindahl, Erik; Barbosa, João Alexandre Ribeiro Gonçalves; Balan, Andrea
2013-11-01
The periplasmic-binding proteins in ATP-binding cassette systems (ABC Transporters) are responsible for the capture and delivery of ligands to their specific transporters, triggering a series of ATP-driven conformational changes that leads to the transport of the ligand. Structurally consisting of two lobes, the proteins change conformation after interaction with the ligand. The structure of the molybdate-binding protein (ModA) from Xanthomonas citri, bound to molybdate, was previously solved by our group and an interdomain interaction, mediated by a salt bridge between K127 and D59, apparently supports the binding properties and keeps the domains closed. To determinate the importance of this interaction, we built two ModA mutants, K127S and D59A, and analysed their functional and structural properties. Based on a set of spectroscopic experiments, crystallisation trials, structure determination and molecular dynamics (MD) simulations, we showed that the salt bridge is essential to maintain the structure and binding properties. Additionally, the MD simulations revealed that this mutant adopted a more compact structure that packed down the ligand-binding pocket. From the closed bound to open structure, the positioning of the helices forming the dipole and the salt bridge are essential to induce an intermediate state. Copyright © 2013 Elsevier Inc. All rights reserved.
Evaluación de dos métodos biológicos (Subcutáneo e Intradérmico para detectar Toxina Diftérica
Directory of Open Access Journals (Sweden)
Esther María Fajardo
2004-04-01
Full Text Available Los Requisitos de la Organización Mundial de la Salud establecen los ensayos de toxicidad específica y reversión a la toxicidad de la anatoxina diftérica purificada como controles obligatorios del proceso productivo. El método propuesto para evaluar la toxicidad específica consiste en inocular curieles por vía subcutánea (método subcutáneo con 1 mL del producto conteniendo 500 Lf/mL; señalan como posibles el ensayo en cultivos celulares y la inoculación intradérmica (método intradérmico de 20 Lf en curieles o conejos. Para la reversión a la toxicidad no se propone un método determinado, sólo que debe aprobarlo la Autoridad Reguladora Nacional y ser suficientemente sensible para detectar pequeñas cantidades de toxina. Por la importancia de estos ensayos que garantizan la seguridad del producto, se evaluaron ambos métodos, fundamentalmente sobre la base de su límite de detección (empleando concentraciones conocidas de una toxina diftérica de referencia, pero también con relación al cumplimiento del principio ético de las “tres Erres” (Reemplazo, Reducción, Refinamiento y el tiempo requerido para obtener resultados. El método intradérmico resultó más sensible que el subcutáneo (límite de detección de 0,0067 x 10-4 Lf/mL vs 4,17 x 10-4 Lf/mL, requiere menos animales (2 vs 5 por muestra, su punto final es una reacción local (eritema, sin muerte (cumple con 2 “Erres”, es más corto (48 h vs 6 semanas y por tanto, más económico. Se recomienda realizar los estudios correspondientes para introducirlo en los ensayos rutinarios de toxicidad específica y reversión a la toxicidad de la anatoxina diftérica purificada obtenida en el Instituto Finlay
Directory of Open Access Journals (Sweden)
Lavanya Tayi
Full Text Available Xanthomonas oryzae pv.oryzae (Xoo causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bioinformatics analysis indicated the presence of four pectin homogalacturonan (HG degrading genes in the genome of Xoo. The four HG degrading genes include one polygalacturonase (pglA, one pectin methyl esterase (pmt and two pectate lyases (pel and pelL. There was no difference in the expression of pglA, pmt and pel genes by laboratory wild type Xoo strain (BXO43 grown in either nutrient rich PS medium or in plant mimic XOM2 medium whereas the expression of pelL gene was induced in XOM2 medium as indicated by qRT-PCR experiments. Gene disruption mutations were generated in each of these four genes. The polygalacturonase mutant pglA- was completely deficient in degrading the substrate Na-polygalacturonicacid (PGA. Strains carrying mutations in the pmt, pel and pelL genes were as efficient as wild type Xoo (BXO43 in cleaving PGA. These observations clearly indicate that PglA is the major pectin degrading enzyme produced by Xoo. The pectin methyl esterase, Pmt, is the pectin de-esterifying enzyme secreted by Xoo as evident from the enzymatic activity assay performed using pectin as the substrate. Mutations in the pglA, pmt, pel and pelL genes have minimal effects on virulence. This suggests that, as compared to cellulases and xylanases, the HG degrading enzymes may not have a major role in the pathogenicity of Xoo.
Directory of Open Access Journals (Sweden)
Carine Rosa Naue
2014-12-01
Full Text Available A disseminação de Xanthomonas campestris pv. viticola (Xcv, agente do cancro bacteriano da videira, ocorre, dentre outras formas, por meio de mudas e bacelos infectados. Foi estudada a obtenção de material propagativo livre do patógeno, testando a eficiência do tratamento de bacelos com termoterapia, bactericidas e sanitizantes. Os isolados de Xcv foram testados quanto à patogenicidade e realizado o teste de sensibilidade in vitro aos produtos, em diferentes concentrações. A erradicação de Xcv em bacelos de videira foi testada em experimentos com termoterapia (50ºC por 30 e 40 min; 53ºC por 5 e 10 min; bactericidas [oxitetraciclina+sulfato de cobre (150+2.000; 165+2.200; 180+2.400 e 195+2.600 mg L-1 de H2O e oxitetraciclina (600; 700; 800 e 900 mg L-1]; e sanitizantes [cloreto de dodecildimetil amônio (600; 1.200; 1.800; 2.400 e 3.000 µL L-1; hipoclorito de sódio (5.000; 10.000; 20.000; 30.000 e 40.000 µL L-1 e cloreto de benzalcônio (125; 167;250; 334 e 500 µL L-1]. Foram avaliados período de incubação, incidência e severidade da doença. O bactericida oxitetraciclina e os sanitizantes cloreto de dodecildimetil amônio e hipoclorito de sódio proporcionaram os maiores halos de inibição de Xcv in vitro. No entanto, apesar dos diversos tratamentos testados, não foi possível recomendar tratamento termoterápico ou produto que erradicasse Xcv de bacelos infectados. Porém, ficou confirmada a grande importância destes na disseminação do agente do cancro bacteriano da videira.
Tayi, Lavanya; Maku, Roshan V; Patel, Hitendra Kumar; Sonti, Ramesh V
2016-01-01
Xanthomonas oryzae pv.oryzae (Xoo) causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs) like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bioinformatics analysis indicated the presence of four pectin homogalacturonan (HG) degrading genes in the genome of Xoo. The four HG degrading genes include one polygalacturonase (pglA), one pectin methyl esterase (pmt) and two pectate lyases (pel and pelL). There was no difference in the expression of pglA, pmt and pel genes by laboratory wild type Xoo strain (BXO43) grown in either nutrient rich PS medium or in plant mimic XOM2 medium whereas the expression of pelL gene was induced in XOM2 medium as indicated by qRT-PCR experiments. Gene disruption mutations were generated in each of these four genes. The polygalacturonase mutant pglA- was completely deficient in degrading the substrate Na-polygalacturonicacid (PGA). Strains carrying mutations in the pmt, pel and pelL genes were as efficient as wild type Xoo (BXO43) in cleaving PGA. These observations clearly indicate that PglA is the major pectin degrading enzyme produced by Xoo. The pectin methyl esterase, Pmt, is the pectin de-esterifying enzyme secreted by Xoo as evident from the enzymatic activity assay performed using pectin as the substrate. Mutations in the pglA, pmt, pel and pelL genes have minimal effects on virulence. This suggests that, as compared to cellulases and xylanases, the HG degrading enzymes may not have a major role in the pathogenicity of Xoo.
NCBI nr-aa BLAST: CBRC-PMAR-01-0384 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0384 ref|YP_200844.1| putative manganese transport protein MntH [Xanth...omonas oryzae pv. oryzae KACC10331] gb|AAW75459.1| manganese transport protein [Xanthomonas oryzae pv. oryzae KACC10331] YP_200844.1 1.7 33% ...
NCBI nr-aa BLAST: CBRC-TNIG-22-0185 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0185 ref|YP_200844.1| putative manganese transport protein MntH [Xanth...omonas oryzae pv. oryzae KACC10331] gb|AAW75459.1| manganese transport protein [Xanthomonas oryzae pv. oryzae KACC10331] YP_200844.1 0.030 28% ...
Directory of Open Access Journals (Sweden)
Romina Cartoceti
2016-01-01
Full Text Available La comprensión de textos es una de las com petencias fundamentales para el desarrollo social y educativo de los seres humanos y constituye un tema esencial en la agenda educativa. Sin em bargo, el estudio y la sistematización de los efec tos de programas que buscan mejorar la com prensión lectora, sobre todo en el caso de alum nos pertenecientes a entornos sociales desfavo recidos, son todavía escasos. Se presentan los re sultados de una intervención realizada en un grupo de alumnos de primero y segundo año de nivel medio y de contexto desfavorecido de una escuela de gestión social de la Provincia de Bue nos Aires (Argentina. Dicha intervención es tuvo basada en la habilidad metacognitiva de de tectar errores e incongruencias, fundamental para el proceso de comprensión de un texto. Inicial mente fueron evaluados 50 adolescentes con un test de eficacia lectora, una prueba estandari zada de comprensión de textos y una prueba es pecífica que evalúa la habilidad de detectar erro res e incongruencias. Se conformó un grupo control con 23 participantes y un grupo experi mental con los 27 restantes. El entrenamiento se llevó a cabo durante tres meses, con una fre cuencia de una hora semanal y una vez finali zado, ambos grupos fueron reevaluados. Los re sultados muestran un efecto positivo de la intervención sobre el grupo experimental, que alcanzó una diferencia estadísticamente significativa entre la cantidad de respuestas correctas de la evaluación inicial y de la evaluación final.
Ma, Wenxiu; Zou, Lifang; Ji, Zhiyuan; Xu, Xiameng; Xu, Zhengyin; Yang, Yangyang; Alfano, James R; Chen, Gongyou
2018-04-28
Xanthomonas oryzae pv. oryzae (Xoo), causal agent of bacterial blight (BB) of rice, uses transcription activator-like effectors (TALEs) to interact with the basal transcription factor gama subunit OsTFIIAγ5 (Xa5) and activates transcription of host genes. However, how OsTFIIAγ1, the other OsTFIIAγ protein, functions in the presence of TALEs remains unclear. In this study, we show that OsTFIIAγ1 plays a compensatory role in the absence of Xa5. The expression of OsTFIIAγ1, which is activated by TALE PthXo7, increased the expression of host genes targeted by avirulent and virulent TALEs. Defective OsTFIIAγ1 rice lines showed reduced expression of the TALE-targeted susceptibility (S) genes, OsSWEET11 and OsSWEET14, which resulted in increased BB resistance. Selected TALEs (PthXo1, AvrXa7, and AvrXa27) were evaluated for interactions with OsTFIIAγ1, Xa5 and xa5 (naturally-occurring mutant form of Xa5) using biomolecular fluorescence complementation (BiFC) and microscale thermophoresis (MST). BiFC and MST demonstrated that the three TALEs bind Xa5 and OsTFIIAγ1 with a stronger affinity than xa5. These results provide insight into the complex roles of OsTFIIAγ1 and OsTFIIAγ5 in TALE-mediated host gene transcription. This article is protected by copyright. All rights reserved. © 2018 BSPP and John Wiley & Sons Ltd.
extraction of high quality dna from polysaccharides-secreting ...
African Journals Online (AJOL)
cistvr
A DNA extraction method using CTAB was used for the isolation of genomic DNA from ten. Xanthomonas campestris pathovars, ten isolates of Xanthomonas albilineans and one isolate of. Pseudomonas rubrisubalbicans. High quality DNA was obtained that was ideal for molecular analy- ses. Extracellular polysaccharides ...
Vattanaviboon, Paiboon; Whangsuk, Wirongrong; Mongkolsuk, Skorn
2003-01-01
We isolated menadione-resistant mutants of Xanthomonas campestris pv. phaseoli oxyR (oxyRXp). The oxyRR2Xp mutant was hyperresistant to the superoxide generators menadione and plumbagin and was moderately resistant to H2O2 and tert-butyl hydroperoxide. Analysis of enzymes involved in oxidative-stress protection in the oxyRR2Xp mutant revealed a >10-fold increase in AhpC and AhpF levels, while the levels of superoxide dismutase (SOD), catalase, and the organic hydroperoxide resistance protein (Ohr) were not significantly altered. Inactivation of ahpC in the oxyRR2Xp mutant resulted in increased sensitivity to menadione killing. Moreover, high levels of expression of cloned ahpC and ahpF in the oxyRXp mutant complemented the menadione hypersensitivity phenotype. High levels of other oxidant-scavenging enzymes such as catalase and SOD did not protect the cells from menadione toxicity. These data strongly suggest that the toxicity of superoxide generators could be mediated via organic peroxide production and that alkyl hydroperoxide reductase has an important novel function in the protection against the toxicity of these compounds in X. campestris. PMID:12591894
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_006834 gi|58582167 >1iwlA 2 180 70 254 2e-49 ... ref|YP_201183.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas oryzae pv. oryzae KAC... carrier protein precursor [Xanthomonas ... oryzae pv. oryzae KACC10331] gb|AAW75798.1| ...
International Nuclear Information System (INIS)
Axelrod, Herbert L.; Kozbial, Piotr; McMullan, Daniel; Krishna, S. Sri; Miller, Mitchell D.; Abdubek, Polat; Acosta, Claire; Astakhova, Tamara; Carlton, Dennis; Caruthers, Jonathan; Chiu, Hsiu-Ju; Clayton, Thomas; Deller, Marc C.; Duan, Lian; Elias, Ylva; Feuerhelm, Julie; Grzechnik, Slawomir K.; Grant, Joanna C.; Han, Gye Won; Jaroszewski, Lukasz; Jin, Kevin K.; Klock, Heath E.; Knuth, Mark W.; Kumar, Abhinav; Marciano, David; Morse, Andrew T.; Murphy, Kevin D.; Nigoghossian, Edward; Okach, Linda; Oommachen, Silvya; Paulsen, Jessica; Reyes, Ron; Rife, Christopher L.; Tien, Henry J.; Trout, Christina V.; Bedem, Henry van den; Weekes, Dana; White, Aprilfawn; Xu, Qingping; Zubieta, Chloe; Hodgson, Keith O.; Wooley, John; Elsliger, Marc-André; Deacon, Ashley M.; Godzik, Adam; Lesley, Scott A.; Wilson, Ian A.
2009-01-01
The crystal structure of an RmlC-type cupin with zinc acetate bound at the putative active site reveals significant differences from a previous structure without any bound ligand. The functional implications of the ligand-induced conformational changes are discussed. In the plant pathogen Xanthomonas campestris pv. campestris, the product of the tcmJ gene, XcTcmJ, encodes a protein belonging to the RmlC family of cupins. XcTcmJ was crystallized in a monoclinic space group (C2) in the presence of zinc acetate and the structure was determined to 1.6 Å resolution. Previously, the apo structure has been reported in the absence of any bound metal ion [Chin et al. (2006 ▶), Proteins, 65, 1046–1050]. The most significant difference between the apo structure and the structure of XcTcmJ described here is a reorganization of the binding site for zinc acetate, which was most likely acquired from the crystallization solution. This site is located in the conserved metal ion-binding domain at the putative active site of XcTcmJ. In addition, an acetate was also bound within coordination distance of the zinc. In order to accommodate this binding, rearrangement of a conserved histidine ligand is required as well as several nearby residues within and around the putative active site. These observations indicate that binding of zinc serves a functional role in this cupin protein
Directory of Open Access Journals (Sweden)
Liliana Andréa dos Santos
2008-12-01
Full Text Available Noventa isolados de Xanthomonas campestris pv. campestris (Xcc de brássicas oriundas de sistemas de produção orgânico das Zonas da Mata e Agreste de Pernambuco foram caracterizados com base na sensibilidade a antibióticos e sulfato de cobre e atividade de esterase. A maioria apresentou alta sensibilidade à tetraciclina (76,6%, eritromicina (63,3% e estreptomicina (63,3%, resistência à amoxicilina (70%, gentamicina (40,0% e norfloxacin (45,5% e média sensibilidade (44,4% ou resistência (44,4% à neomicina. Cinqüenta e cinco isolados de Xcc foram resistentes ao sulfato de cobre na concentração de 50 mg/mL e todos foram sensíveis ao produto na concentração de 200 mg/mL. Atividade de esterase foi apresentada por 92,22% dos isolados. A análise Euclidiana por ligação simples evidenciou variabilidade entre os isolados separando-os em sete grupos de similaridade. Foi estudada também a reação de 14 cultivares de brássicas à podridão-negra, utilizando o isolado "B21" de Xcc. As cultivares diferiram significativamente entre si em relação ao período de incubação, incidência e severidade final da doença. Os maiores valores de severidade final da doença foram verificados em brócolos "Ramoso", couve-flor "Bola de Neve" e "Piracicaba de Verão", e repolho "Chato de Quintal". Os híbridos de couve-chinesa "AF 70", "AF 72", "AF 69" e "AF 66" mostraram-se altamente resistentes à doença, enquanto que brócolos "Ramoso" e "Precoce Piracicaba", couve-flor "Piracicaba de Verão" e "Híbrido Cindy" e repolho "60 Dias" foram medianamente resistentes.Ninety strains of Xanthomonas campestris pv. campestris (Xcc from brassicas grown under organic farming systems in the "Mata" and "Agreste" regions of Pernambuco, Brazil, were characterized based upon sensitivity to antibiotics and copper sulfate, and esterase activity. Most of the strains showed high sensitivity to tetracycline (76.6%, erythromycin (63.3% and streptomycin (63
Desarrollo de un software de reconocimiento de imagen para ensayos EMC de inmunidad
Cerro Gálvez, Ibán
2012-01-01
Desenvolupar un software de reconeixement d'imatge per a detectar mal funcionaments durant els assaigs d'immunitat d'EMC. [ANGLÈS] Develop an image recognition software to detect errors during EMC immunity test. [CASTELLÀ] Desarrollar un software de reconocimiento de imagen para detectar el mal funcionamiento durante los ensayos de inmunidad del EMC. [CATALÀ] Desenvolupar un software de reconeixement d'imatge per a detectar mal funcionaments durant els assaigs d'immunitat d'EMC.
Directory of Open Access Journals (Sweden)
Líllian V. Brandão
2010-09-01
Full Text Available Goma xantana é um biopolímero comercial produzido por fermentação de glicose e Xanthomonas com larga aplicação industrial. O objetivo deste trabalho foi estudar a síntese e a viscosidade da goma obtida por cepas nativas de Xanthomonas campestris utilizando soro de mandioca como substrato fermentativo alternativo. Três tipos de Xanthomonas foram utilizados. A maior produção foi de 13,83 g.L-1 obtida do meio fermentativo com X. campestris mangiferaeindicae a 25 ºC, 250 rpm por 120 horas apresentando uma viscosidade aparente de 96,14 cP na concentração de 2,0% de solução de xantana a 25 s-1, 25 ºC. O uso do resíduo industrial de soro de mandioca para biossíntese da xantana é uma alternativa de baixo custo para o processo fermentativo e um destino para esse soro.Xanthan gum is a commercial biopolymer produced by fermentation of glucose and Xanthomonas with many industrial applications. The objective of this work was to study the synthesis and the viscosity of xanthan obtained from native strains of Xanthomonas campestris using cassava as an alternative fermentative substrate. Three kinds of Xanthomonas were used. The highest production was 13.83 g.L-1 obtained with X. campestris mangiferaeindicae fermented at 25 ºC, 250 rpm during 120 hours and presenting apparent viscosity 96.14 cP in the concentration of 2.0% of xanthan solution at 25 s-1, 25 ºC. The use of the industrial residue of cassava serum for biosynthesis of xanthan is a low cost alternative for the fermentation process and a noble use for this waste.
Directory of Open Access Journals (Sweden)
Ivana Kraiselburd
Full Text Available Pathogens interaction with a host plant starts a set of immune responses that result in complex changes in gene expression and plant physiology. Light is an important modulator of plant defense response and recent studies have evidenced the novel influence of this environmental stimulus in the virulence of several bacterial pathogens. Xanthomonas citri subsp. citri is the bacterium responsible for citrus canker disease, which affects most citrus cultivars. The ability of this bacterium to colonize host plants is influenced by bacterial blue-light sensing through a LOV-domain protein and disease symptoms are considerably altered upon deletion of this protein. In this work we aimed to unravel the role of this photoreceptor during the bacterial counteraction of plant immune responses leading to citrus canker development. We performed a transcriptomic analysis in Citrus sinensis leaves inoculated with the wild type X. citri subsp. citri and with a mutant strain lacking the LOV protein by a cDNA microarray and evaluated the differentially regulated genes corresponding to specific biological processes. A down-regulation of photosynthesis-related genes (together with a corresponding decrease in photosynthesis rates was observed upon bacterial infection, this effect being more pronounced in plants infected with the lov-mutant bacterial strain. Infection with this strain was also accompanied with the up-regulation of several secondary metabolism- and defense response-related genes. Moreover, we found that relevant plant physiological alterations triggered by pathogen attack such as cell wall fortification and tissue disruption were amplified during the lov-mutant strain infection. These results suggest the participation of the LOV-domain protein from X. citri subsp. citri in the bacterial counteraction of host plant defense response, contributing in this way to disease development.
Kraiselburd, Ivana; Daurelio, Lucas D.; Tondo, María Laura; Merelo, Paz; Cortadi, Adriana A.; Talón, Manuel; Tadeo, Francisco R.; Orellano, Elena G.
2013-01-01
Pathogens interaction with a host plant starts a set of immune responses that result in complex changes in gene expression and plant physiology. Light is an important modulator of plant defense response and recent studies have evidenced the novel influence of this environmental stimulus in the virulence of several bacterial pathogens. Xanthomonas citri subsp. citri is the bacterium responsible for citrus canker disease, which affects most citrus cultivars. The ability of this bacterium to colonize host plants is influenced by bacterial blue-light sensing through a LOV-domain protein and disease symptoms are considerably altered upon deletion of this protein. In this work we aimed to unravel the role of this photoreceptor during the bacterial counteraction of plant immune responses leading to citrus canker development. We performed a transcriptomic analysis in Citrus sinensis leaves inoculated with the wild type X. citri subsp. citri and with a mutant strain lacking the LOV protein by a cDNA microarray and evaluated the differentially regulated genes corresponding to specific biological processes. A down-regulation of photosynthesis-related genes (together with a corresponding decrease in photosynthesis rates) was observed upon bacterial infection, this effect being more pronounced in plants infected with the lov-mutant bacterial strain. Infection with this strain was also accompanied with the up-regulation of several secondary metabolism- and defense response-related genes. Moreover, we found that relevant plant physiological alterations triggered by pathogen attack such as cell wall fortification and tissue disruption were amplified during the lov-mutant strain infection. These results suggest the participation of the LOV-domain protein from X. citri subsp. citri in the bacterial counteraction of host plant defense response, contributing in this way to disease development. PMID:24260514
2018-03-13T08:12:57Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
Acidovorax avenae subsp. avenae ainsi que Xanthomonas oryzae pv. oryzae ont été chacune détectées dans 50 % des échantillons et Burkholderia Glumae dans 16,66 %. 52 % des bactéries identifiées se rapportent à Acidovorax avenae subsp. avenae, 35 % à Xanthomonas oryzae pv. oryzae et 13 % à Burkholderia ...
Yang, Li; Hu, Chunhua; Li, Na; Zhang, Jiayin; Yan, Jiawen; Deng, Ziniu
2011-01-01
The COOH terminal of pthA encoding three nuclear localizing signals (NLS) was amplified by polymerase chain reaction (PCR) from the plasmid of Xanthomonas axonopodis pv. citri, the pathogen of citrus canker disease. Then the sense and antisense strands of the nls were cloned into pBI121 vector. pthA-nls driven by the CaMV35 s promoter was transferred into sweet orange via Agrobacterium -mediated transformation. Successful integration was confirmed by PCR and Southern blotting, and 12 sense-nls (nls (+)) and 9 antisense-nls (nls (-)) transgenic clones were obtained. The expression of nls fragment was analyzed by RT-PCR, Real time q-PCR and Western blotting, in which the specific NLS protein was detected only in nls (+) transgenic clones. In an in vitro assay, when pin-puncture inoculation was performed with 2.5 × 10(7) cfu/ml of bacterial solution, the nls (+) transgenic clones showed no typical lesion development, while typical symptoms were observed in the wild types and the nls (-) transgenic clones. In vivo assay results indicated that the nls (+) transgenic clones showed less disease incidence, in comparison with the wild types and the nls (-) transgenic clones, when pin-puncture inoculation was performed with 10(4)-10(5) cfu/ml. The minimum disease incidence was 23.3% for 'Sucarri' sweet orange and 33.3% for 'Bingtang' sweet orange. When 10(4)-10(7) cfu/ml of pathogen was spray inoculated, the nls (+) transgenic clones did not show any symptom, and even the concentration raised to 10(9) cfu/ml, the disease incidence was 20-80%, while the wild types and the nls (-) transgenic clones had 100% disease development with whatever concentration of inoculum. Two transgenic clones were confirmed to be resistant to citrus canker disease in the repeated inoculation. The results suggested that the transformation of nls sense strands may offer an effective way to acquire resistance to citrus canker disease.
de Barros, Caio Henrique Nasi; Cruz, Guilherme Crispim Faria; Mayrink, Willian; Tasic, Ljubica
2018-01-01
Despite the numerous reports on biological syntheses of silver nanoparticles (AgNPs), little is known about the composition of their capping agents, protein corona of plant extract-mediated synthesis, and their influence on the properties of AgNPs. Here, orange ( Citrus sinensis ) waste was utilized as a source of an extract for AgNP synthesis (the protein corona composition of which was elucidated), and also as a starting material for hesperidin and nanocellulose extraction, which were used for bio-based AgNP synthesis. A comparison of the results using the two methods of synthesis is presented. AgNPs were synthesized using orange ( C. sinensis ) peel extract (Or-AgNPs) in a biological route, and using hesperidin (Hsd-AgNPs) and nanocellulose (extracted from oranges) in a green chemical route. Characterization of nanoparticles was carried out using zeta potential and hydrodynamic size measurements, transmission electron microscopy, and X-ray diffraction. Elucidation of proteins from protein corona was performed via ultra performance liquid chromatography-tandem mass spectrometer experiments. Antimicrobial activity was assessed via minimum inhibitory concentration assays against Xanthomonas axonopodis pv. citri ( Xac ), the bacterium that causes citric canker in oranges. Or-AgNPs were not completely uniform in morphology, having a size of 48.1±20.5 nm and a zeta potential of -19.0±0.4 mV. Stabilization was performed mainly by three proteins, which were identified by tandem mass spectrometry (MS/MS) experiments. Hsd-AgNPs were smaller (25.4±12.5 nm) and had uniform morphology. Nanocellulose provided a strong steric and electrostatic (-28.2±1.0 mV) stabilization to the nanoparticles. Both AgNPs presented roughly the same activity against Xac , with the minimum inhibitory concentration range between 22 and 24 μg mL -1 . Despite the fact that different capping biomolecules on AgNPs had an influence on morphology, size, and stability of AgNPs, the antibacterial
Jiang, Chunmiao; Shen, Qingxi J; Wang, Bo; He, Bin; Xiao, Suqin; Chen, Ling; Yu, Tengqiong; Ke, Xue; Zhong, Qiaofang; Fu, Jian; Chen, Yue; Wang, Lingxian; Yin, Fuyou; Zhang, Dunyu; Ghidan, Walid; Huang, Xingqi; Cheng, Zaiquan
2017-01-01
Oryza officinalis Wall ex Watt, a very important and special wild rice species, shows abundant genetic diversity and disease resistance features, especially high resistance to bacterial blight. The molecular mechanisms of bacterial blight resistance in O. officinalis have not yet been elucidated. The WRKY transcription factor family is one of the largest gene families involved in plant growth, development and stress response. However, little is known about the numbers, structure, molecular phylogenetics, and expression of the WRKY genes under Xanthomonas oryzae pv. oryzae (Xoo) stress in O. officinalis due to lacking of O. officinalis genome. Therefore, based on the RNA-sequencing data of O. officinalis, we performed a comprehensive study of WRKY genes in O. officinalis and identified 89 OoWRKY genes. Then 89 OoWRKY genes were classified into three groups based on the WRKY domains and zinc finger motifs. Phylogenetic analysis strongly supported that the evolution of OoWRKY genes were consistent with previous studies of WRKYs, and subgroup IIc OoWRKY genes were the original ancestors of some group II and group III OoWRKYs. Among the 89 OoWRKY genes, eight OoWRKYs displayed significantly different expression (>2-fold, pWRKY family of transcription factors in O.officinalis. Insight was gained into the classification, evolution, and function of the OoWRKY genes, revealing the putative roles of eight significantly different expression OoWRKYs in Xoo strains PXO99 and C5 stress responses in O.officinalis. This study provided a better understanding of the evolution and functions of O. officinalis WRKY genes, and suggested that manipulating eight significantly different expression OoWRKYs would enhance resistance to bacterial blight.
Yim, W J; Kim, K Y; Lee, Y W; Sundaram, S P; Lee, Y; Sa, T M
2014-07-15
Biotic stress like pathogenic infection increases ethylene biosynthesis in plants and ethylene inhibitors are known to alleviate the severity of plant disease incidence. This study aimed to reduce the bacterial spot disease incidence in tomato plants caused by Xanthomonas campestris pv. vesicatoria (XCV) by modulating stress ethylene with 1-aminocyclopropane-1-carboxylate (ACC) deaminase activity of Methylobacterium strains. Under greenhouse condition, Methylobacterium strains inoculated and pathogen challenged tomato plants had low ethylene emission compared to pathogen infected ones. ACC accumulation and ACC oxidase (ACO) activity with ACO related gene expression increased in XCV infected tomato plants over Methylobacterium strains inoculated plants. Among the Methylobacterium spp., CBMB12 resulted lowest ACO related gene expression (1.46 Normalized Fold Expression), whereas CBMB20 had high gene expression (3.42 Normalized Fold Expression) in pathogen challenged tomato. But a significant increase in ACO gene expression (7.09 Normalized Fold Expression) was observed in the bacterial pathogen infected plants. In contrast, Methylobacterium strains enhanced β-1,3-glucanase and phenylalanine ammonia-lyase (PAL) enzyme activities in pathogen challenged tomato plants. The respective increase in β-1,3-glucanase related gene expressions due to CBMB12, CBMB15, and CBMB20 strains were 66.3, 25.5 and 10.4% higher over pathogen infected plants. Similarly, PAL gene expression was high with 0.67 and 0.30 Normalized Fold Expression, in pathogen challenged tomato plants inoculated with CBMB12 and CBMB15 strains. The results suggest that ethylene is a crucial factor in bacterial spot disease incidence and that methylobacteria with ACC deaminase activity can reduce the disease severity with ultimate pathogenesis-related protein increase in tomato. Copyright © 2014 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Matildes S. Prado
2013-06-01
Full Text Available A large number of human diseases are related to poor access to water and sewer systems, inadequate solid waste management and deficient storm water drainage. The goal of this study was to formulate environmental sanitation indicators and classify sanitation conditions in specific sewer basins and their respective neighborhoods. The database used contains information on the following sanitation components in these areas: water supply, sewer systems, urban drainage, road pavement, building typology and public cleaning. Data was analyzed using cluster analysis. The key variable of each component was identified, and eight sewer basins and twenty-three neighborhoods were classified into the following categories: good, regular, and poor. The use of environmental sanitation indicators allows decision makers to identify critical areas and define priorities for improving environmental sanitation conditions.Varias enfermedades que afectan a los seres humanos están vinculadas a la deficiencia en el acceso a servicios de agua y alcantarillado, la gestión inadecuada de los residuos sólidos y el deficiente sistema de drenaje de aguas pluviales. Este estudio trata de desarrollar indicadores de salud ambiental y clasificar las áreas dentro de las ciudades. Se utilizó una base de datos que contiene información sobre: limpieza urbana, abastecimiento de agua, alcantarillado, drenaje y calles, pavimentación de las calles y tipología de construcción en diferentes barrios. Se aplicó la técnica de clúster para el análisis de datos. Se identificó la variable que mejor representa cada componente y veintitrés áreas de la ciudad se clasificaron en tres categorías: buena, regular y mala. El uso de indicadores de salud ambiental permitió la identificación de áreas críticas y el establecimiento de prioridades en la inversión para la salud y mejora del medio ambiente.Várias patologias que acometem os seres humanos estão ligadas à deficiência de acesso a água e serviços de esgotamento sanitário, inadequado manejo de resíduos sólidos e deficiência do sistema de drenagem das águas pluviais. Este estudo buscou desenvolver indicadores sanitário ambientais e classificar áreas intraurbanas. Utilizou-se uma base de dados contendo informações sobre: abastecimento de água, sistema de esgoto, drenagem e limpeza urbana, pavimentação e tipologia construtiva referentes a bacias de esgotamento sanitário e áreas sentinela. Foi aplicada a técnica de analise de cluster. Identificou-se a variável que melhor representava cada componente, e oito bacias de esgotamento e vinte e três áreas sentinelas foram classificadas em três categorias: boa, regular e insatisfatória. O uso de indicador sanitário ambiental permitiu a identificação de áreas críticas e o estabelecimento de prioridades de investimentos para as melhorias sanitário ambientais.
Piazza, A.
2015-03-14
Xanthomonas citri subsp. citri (Xcc) is a bacterial pathogen that causes citrus canker in susceptible Citrus spp. The Xcc genome contains genes encoding enzymes from three separate pathways of trehalose biosynthesis. Expression of genes encoding trehalose-6-phosphate synthase (otsA) and trehalose phosphatase (otsB) was highly induced during canker development, suggesting that the two-step pathway of trehalose biosynthesis via trehalose-6-phosphate has a function in pathogenesis. This pathway was eliminated from the bacterium by deletion of the otsA gene. The resulting XccΔotsA mutant produced less trehalose than the wild-type strain, was less resistant to salt and oxidative stresses, and was less able to colonize plant tissues. Gene expression and proteomic analyses of infected leaves showed that infection with XccΔotsA triggered only weak defence responses in the plant compared with infection with Xcc, and had less impact on the host plant\\'s metabolism than the wild-type strain. These results suggested that trehalose of bacterial origin, synthesized via the otsA-otsB pathway, in Xcc, plays a role in modifying the host plant\\'s metabolism to its own advantage but is also perceived by the plant as a sign of pathogen attack. Thus, trehalose biosynthesis has both positive and negative consequences for Xcc. On the one hand, it enables this bacterial pathogen to survive in the inhospitable environment of the leaf surface before infection and exploit the host plant\\'s resources after infection, but on the other hand, it is a tell-tale sign of the pathogen\\'s presence that triggers the plant to defend itself against infection. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Directory of Open Access Journals (Sweden)
M. Mercado
2005-12-01
Full Text Available Este trabajo validó la técnica de PCR para la detección de L. monocytogenes a partir de ADN de cultivos puros y en muestras de leches crudas, quesos frescos, carne de res y carne de pollo. En DNA de cultivos puros la sensibilidad, la especificidad y la reproducibilidad encontrada fue de 100%, 101UFC/ml y K=1,respectivamente. Para la extracción del ADN de los alimentos se emplearon dos métodos, el primero, basado en la precipitación alcohólica en presencia de NaI, lo que redujo en gran medida las grasas; permitiendo la detección directa de 10 1 UFC/ml en leche cruda y 105 UFC/g en queso fresco. El segundo método, basado en la extracción con lisozima, proteinasa K y fenol-cloroformo, permitió establecer límites de detección de 102 y 104 UFC/g para las carnes de res y pollo respectivamente. La PCR se basó enla especificidad de los iniciadores LI1/U1 que amplificaron una banda de 938 pb (identificación de género característica del rDNA 16S y los iniciadores LF/LR que amplificaron una banda de 750 pbcaracterística del gen hlyA (identificación de especie. Los resultados de la validación reportaron con relación al método “Gold Standard” una reproducibilidad, sensibilidad y especificidad del 100% en leches crudas. Para las muestras de queso frescos se reportó una reproducibilidad de 97%, sensibilidad 96.3% y especificidad del 100%, para la carne de pollo la reproducibilidad fue 98.43%, sensibilidad96.9%, especificidad 100%, valor predictivo positivo 100% y valor predictivo negativo 100%, para la carne de res todos los parámetros fueron 100%. El método “Gold Standard” reportó 100% para todos losparámetros. El trabajo muestra que ambas técnicas pueden ser utilizadas para detectar L. monocytogenes en este tipo de alimentos y que la PCR reduce el tiempo de ensayo considerablemente.
Directory of Open Access Journals (Sweden)
Xiaoping Zhang
2013-12-01
Full Text Available Bacterial blight, caused by Xanthomonas oryzae pv. oryzae (Xoo, is one of the most destructive diseases of rice (Oryza sativa L. worldwide. The type III secretion system (T3SS of Xoo, encoded by the hrp (hypersensitive response and pathogenicity genes, plays critical roles in conferring pathogenicity in host rice and triggering a hypersensitive response (HR in non-host plants. To investigate the major genes conferring the pathogenicity and avirulence of Xoo, we previously constructed a random Tn5-insertion mutant library of Xoo strain PXO99A. We report here the isolation and characterization of a Tn5-insertion mutant PXM69. Tn5-insertion mutants were screened on indica rice JG30, which is highly susceptible to PXO99A, by leaf-cutting inoculation. Four mutants with reduced virulence were obtained after two rounds of screening. Among them, the mutant PXM69 had completely lost virulence to the rice host and ability to elicit HR in non-host tobacco. Southern blotting analysis showed a single copy of a Tn5-insertion in the genome of PXM69. PCR walking and sequencing analysis revealed that the Tn5 transposon was inserted at nucleotide position 70,192–70,201 in the genome of PXO99A, disrupting the type III hrc (hrp-conserved gene hrcQ, the first gene in the D operon of the hrp cluster in Xoo. To confirm the relationship between the Tn5-insertion and the avirulence phenotype of PXM69, we used the marker exchange mutagenesis to create a PXO99A mutant, ΔhrcQ::KAN, in which the hrcQ was disrupted by a kanamycin-encoding gene cassette at the same site as that of the Tn5-insertion. ΔhrcQ::KAN showed the same phenotype as mutant PXM69. Reintroduction of the wild-type hrcQ gene partially complemented the pathogenic function of PXM69. RT-PCR and cellulase secretion assays showed that the Tn5-disruption of hrcQ did not affect transcription of downstream genes in the D operon and function of the type II secretion system. Our results provide new insights into
Institute of Scientific and Technical Information of China (English)
Xiaoping; Zhang; Chunlian; Wang; Chongke; Zheng; Jinying; Che; Yanqiang; Li; Kaijun; Zhao
2013-01-01
Bacterial blight, caused by Xanthomonas oryzae pv. oryzae(Xoo), is one of the most destructive diseases of rice(Oryza sativa L.) worldwide. The type III secretion system(T3SS) of Xoo, encoded by the hrp(hypersensitive response and pathogenicity) genes, plays critical roles in conferring pathogenicity in host rice and triggering a hypersensitive response(HR) in non-host plants. To investigate the major genes conferring the pathogenicity and avirulence of Xoo, we previously constructed a random Tn5-insertion mutant library of Xoo strain PXO99A. We report here the isolation and characterization of a Tn5-insertion mutant PXM69. Tn5-insertion mutants were screened on indica rice JG30, which is highly susceptible to PXO99A, by leaf-cutting inoculation.Four mutants with reduced virulence were obtained after two rounds of screening. Among them, the mutant PXM69 had completely lost virulence to the rice host and ability to elicit HR in non-host tobacco. Southern blotting analysis showed a single copy of a Tn5-insertion in the genome of PXM69. PCR walking and sequencing analysis revealed that the Tn5 transposon was inserted at nucleotide position 70,192–70,201 in the genome of PXO99A, disrupting the type III hrc(hrp-conserved) gene hrcQ, the first gene in the D operon of the hrp cluster in Xoo. To confirm the relationship between the Tn5-insertion and the avirulence phenotype of PXM69, we used the marker exchange mutagenesis to create a PXO99Amutant, ΔhrcQ::KAN, in which the hrcQ was disrupted by a kanamycin-encoding gene cassette at the same site as that of the Tn5-insertion. ΔhrcQ::KAN showed the same phenotype as mutant PXM69. Reintroduction of the wild-type hrcQ gene partially complemented the pathogenic function of PXM69. RT-PCR and cellulase secretion assays showed that the Tn5-disruption of hrcQ did not affect transcription of downstream genes in the D operon and function of the type II secretion system. Our results provide new insights into the pathogenic
Almeida, Rodrigo P P; Killiny, Nabil; Newman, Karyn L; Chatterjee, Subhadeep; Ionescu, Michael; Lindow, Steven E
2012-04-01
In Xylella fastidiosa the fatty acid signal molecule diffusible signaling factor (DSF) is produced and sensed by components of the regulation of pathogenicity factors (rpf) cluster; lack of DSF production in RpfF mutants results in a non-vector-transmissible phenotype yet cells are hypervirulent to grape. rpfB has not been characterized in Xylella fastidiosa, although its homolog has been suggested to be required for DSF synthesis in Xanthomonas campestris pv. campestris. We show that RpfB is involved in DSF processing in both Xylella fastidiosa and Xanthomonas campestris, affecting the profile of DSF-like fatty acids observed in thin-layer chromatography. Although three fatty acids whose production is dependent on RpfF were detected in Xylella fastidiosa and Xanthomonas campestris wild-type strains, their respective rpfB mutants accumulated primarily one chemical species. Although no quantifiable effect of rpfB on plant colonization by Xylella fastidiosa was found, insect colonization and transmission was reduced. Thus, RpfB apparently is involved in DSF processing, and like Xanthomonas campestris, Xylella fastidiosa also produces multiple DSF molecules. It is possible that Xylella fastidiosa coordinates host vector and plant colonization by varying the proportions of different forms of DSF signals via RpfB.
Seismic Wave Propagation in South America,
1995-08-14
Informe del Grupo ad Hoc de Expertos Cientificos Encargado de Examinar las Medidas de Cooperaci6n Internacional para Detectar e Identificar... Cientificos Encargado de Examinar las Medidas de Cooperaci6n Internacional para Detectar e Identificar Fen6menos Sismicos. CD/1270, Ginebra. Dorbath, C
Defense mechanisms of Solanum tuberosum L. in response to attack by plant-pathogenic bacteria
Directory of Open Access Journals (Sweden)
VERA A D POIATTI
2009-01-01
Full Text Available The natural resistance of plants to disease is based not only on preformed mechanisms, but also on induced mechanisms. The defense mechanisms present in resistant plants may also be found in susceptible ones. This study attempted to analyze the metabolic alterations in plants of the potato Solanum tuberosum L. cv. Agata that were inoculated with the incompatible plant-pathogenic bacteria X. axonopodis and R. solanacearum, and the compatible bacterium E. carotovora. Levels of total phenolic compounds, including the flavonoid group, and the activities of polyphenol oxidase (PPO and peroxidase (POX were evaluated. Bacteria compatibility was evaluated by means of infiltration of tubers. The defense response was evaluated in the leaves of the potato plants. Leaves were inoculated depending on their number and location on the stem. Multiple-leaf inoculation was carried out on basal, intermediate, and apical leaves, and single inoculations on intermediate leaves. Leaves inoculated with X. axonopodis and with R. solanacearum showed hypersensitive responses within 24 hours post-inoculation, whereas leaves inoculated with E. carotovora showed disease symptoms. Therefore, the R. solanacearum isolate used in the experiments did not exhibit virulence to this potato cultivar. Regardless of the bacterial treatments, the basal leaves showed higher PPO and POX activities and lower levels of total phenolic compounds and flavonoids, compared to the apical leaves. However, basal and intermediate leaves inoculated with R. solanacearum and X. axonopodis showed increases in total phenolic compounds and flavonoid levels. In general, multiple-leaf inoculation showed the highest levels of total phenolics and flavonoids, whereas the single inoculations resulted in the highest increase in PPO activity. The POX activity showed no significant difference between single- and multiple-leaf inoculations. Plants inoculated with E. carotovora showed no significant increase in
International Nuclear Information System (INIS)
Padmanabhan, S.Y.; Kaur, S.; Rao, M.
1976-01-01
The high-yield variety Vijaya ( IR 8 x T 90), susceptible to bacterial leaf blight (Xanthomonas oryzae, Uyeda and Ishiyama Dawson), was treated with EMS to induce resistance. Dehusked seeds were pre-soaked in distilled water for 4 hrs, and subjected to 0.1% and 0.2% EMS for 6 hrs. Seed germination and survival was low in 0.2% EMS. Seedlings of M 1 were raised in pots, and panicles of individual plants harvested separately. The seeds of M 2 (8800 plants) generation were grown in nursery beds, and transplanted in field after 30 days. The plants were inoculated at the boot leaf stage with X.oryzae by the clipping method, and lesion length measured 15 days later. The frequency distribution of controls was bimodal, the EMS-treated population polymodal with new peaks. A wider range of variability was induced on the resistant and susceptible side. In M 2 0.36% resistant and 0.62% moderately resistant plants occurred. The seeds of (11) resistant and (20) moderately resistant plants of M 2 were sown for M 3 generation. These plants also segregated in the range of 0-31 and 0-32 cm lesion length. The frequency distribution curve was polymodal. M 2 from ''R'' showed 1.07% of resistant plants and 0.42% from ''MR'', against, 4.28% of moderately resistant plants from ''R'' and 3.22% from ''MR''. Susceptible plants of M 2 also segregated towards resistance (1.15%) and moderately resistant (6.96%) plants in M 3 generation. Resistant (25) and moderately resistant (147) plants of M 3 were carried forward to M 4 generation, and segregated in the range of 2.1-25 cm lesion length. The frequency curve was polymodal. No resistant plant (up to 2.0 cm lesion length) could be isolated in M 4 . The percentage of moderately resistant plants was 4.44% from ''R'' of M 3 and 4.82% from ''MR'' of M 3 and 4.77% from ''S'' of M 3 generation. The yield of resistant plants was low whereas the yield of moderately resistant plants equalled the parent; the yield of susceptible segregants equalled or
Directory of Open Access Journals (Sweden)
Juan J. Pierella Karlusich
2017-07-01
Full Text Available Non-host resistance is the most ample and durable form of plant resistance against pathogen infection. It includes induction of defense-associated genes, massive metabolic reprogramming, and in many instances, a form of localized cell death (LCD at the site of infection, purportedly designed to limit the spread of biotrophic and hemibiotrophic microorganisms. Reactive oxygen species (ROS have been proposed to act as signals for LCD orchestration. They are produced in various cellular compartments including chloroplasts, mitochondria and apoplast. We have previously reported that down-regulation of ROS build-up in chloroplasts by expression of a plastid-targeted flavodoxin (Fld suppressed LCD in tobacco leaves inoculated with the non-host bacterium Xanthomonas campestris pv. vesicatoria (Xcv, while other defensive responses were unaffected, suggesting that chloroplast ROS and/or redox status play a major role in the progress of LCD. To better understand these effects, we compare here the transcriptomic alterations caused by Xcv inoculation on leaves of Fld-expressing tobacco plants and their wild-type siblings. About 29% of leaf-expressed genes were affected by Xcv and/or Fld. Surprisingly, 5.8% of them (1,111 genes were regulated by Fld in the absence of infection, presumably representing pathways responsive to chloroplast ROS production and/or redox status during normal growth conditions. While the majority (∼75% of pathogen-responsive genes were not affected by Fld, many Xcv responses were exacerbated, attenuated, or regulated in opposite direction by expression of this protein. Particularly interesting was a group of 384 genes displaying Xcv responses that were already triggered by Fld in the absence of infection, suggesting that the transgenic plants had a larger and more diversified suite of constitutive defenses against the attacking microorganism compared to the wild type. Fld modulated many genes involved in pathogenesis, signal
Kocal, Nurcan; Sonnewald, Uwe; Sonnewald, Sophia
2008-11-01
Cell wall-bound invertase (cw-Inv) plays an important role in carbohydrate partitioning and regulation of sink-source interaction. There is increasing evidence that pathogens interfere with sink-source interaction, and induction of cw-Inv activity has frequently been shown in response to pathogen infection. To investigate the role of cw-Inv, transgenic tomato (Solanum lycopersicum) plants silenced for the major leaf cw-Inv isoforms were generated and analyzed during normal growth and during the compatible interaction with Xanthomonas campestris pv vesicatoria. Under normal growth conditions, activities of sucrolytic enzymes as well as photosynthesis and respiration were unaltered in the transgenic plants compared with wild-type plants. However, starch levels of source leaves were strongly reduced, which was most likely caused by an enhanced sucrose exudation rate. Following X. campestris pv vesicatoria infection, cw-Inv-silenced plants showed an increased sucrose to hexose ratio in the apoplast of leaves. Symptom development, inhibition of photosynthesis, and expression of photosynthetic genes were clearly delayed in transgenic plants compared with wild-type plants. In addition, induction of senescence-associated and pathogenesis-related genes observed in infected wild-type plants was abolished in cw-Inv-silenced tomato lines. These changes were not associated with decreased bacterial growth. In conclusion, cw-Inv restricts carbon export from source leaves and regulates the sucrose to hexose ratio in the apoplast. Furthermore, an increased apoplastic hexose to sucrose ratio can be linked to inhibition of photosynthesis and induction of pathogenesis-related gene expression but does not significantly influence bacterial growth. Indirectly, bacteria may benefit from low invertase activity, since the longevity of host cells is raised and basal defense might be dampened.
Directory of Open Access Journals (Sweden)
João Paulo de Maçaneiro
2016-12-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2016v29n4p43 As variações da vegetação em função da posição topográfica têm despertado o interesse dos pesquisadores. Entretanto, poucos estudos verificaram as associações florísticas formadas pela posição topográfica de uma encosta. Neste trabalho, analisamos se as variações na vegetação permitem detectar agrupamentos florísticos em uma Floresta Pluvial Subtropical. A vegetação foi amostrada em 25 parcelas de 400 m² distribuídas sistematicamente, onde foram medidos os indivíduos com DAP ≥ 5,0 cm. Amostramos 1.727 indivíduos e 144 espécies. A ordenação NMDS segregou três grupos em função da posição topográfica da encosta (Monte Carlo, P ≥ 0,05; ANOSIM, P < 0,001. Euterpe edulis e Sloanea guianensis se destacaram nos terços inferior e médio da encosta, enquanto Ocotea aciphylla e Alchornea triplinervia se destacaram no terço superior. Algumas espécies se mostraram indicadoras dos setores analisados, como é o caso de Actinostemon concolor e Alsophila setosa no terço inferior, Cyathea corcovadensis e Rudgea recurva no terço médio e Myrcia pulchra e Podocarpus sellowii no terço superior. Nossos resultados indicaram que as variações florísticas e estruturais observadas por Veloso e Klein (1959 e Klein (1980; 1984 para o Vale do Itajaí em Santa Catarina apresentam validade estatística nos dias atuais, pois verificamos a formação de diferentes grupos de acordo com a posição topográfica da encosta.
Production and certain properties of biopolymers used in drilling
Energy Technology Data Exchange (ETDEWEB)
Dedusenko, G Y; Gvozdyak, R I; Kolodkova, N M; Matyshevskaya, M S; Mayko, I I
1977-01-01
Biopolymers, belonging to modified polysaccharides, obtained by the action of Xanthomonas campestris bacteria on glucose and containing its substances, are used as the main component in clayless polymer muds. As a result of research performed at the laboratory of phytopathogenic bacteria in the IMV AN USSR, the producent strain of polysaccharide has been revealed and the nutritive medium chosen. Results are given of an analysis of the best Soviet samples of biopolymers created in the IMV AN USSR, produced using various strains of Xanthomonas bacteria. Rheological properties of aqueous dispersions of the biopolymer Keltsan are studied. The flow curves are recorded on the Fann rotation viscosimeter. The research performed enables determination that for fermentation can be used the bacteria Xanthomonas campestris, X. begonia, and X. molvacearum; and bacteria belonging to X. Campestris used to produce a sample batch of biopolymer, yielding the greatest amount of polysaccharide. The work results in development of a nutritive medium based on available Soviet materials, promoting formation of polysaccharide.
Triplett, Lindsay R; Cohen, Stephen P; Heffelfinger, Christopher; Schmidt, Clarice L; Huerta, Alejandra I; Tekete, Cheick; Verdier, Valerie; Bogdanove, Adam J; Leach, Jan E
2016-09-01
The rice pathogens Xanthomonas oryzae pathovar (pv.) oryzae and pv. oryzicola produce numerous transcription activator-like (TAL) effectors that increase bacterial virulence by activating expression of host susceptibility genes. Rice resistance mechanisms against TAL effectors include polymorphisms that prevent effector binding to susceptibility gene promoters, or that allow effector activation of resistance genes. This study identifies, in the heirloom variety Carolina Gold Select, a third mechanism of rice resistance involving TAL effectors. This resistance manifests through strong suppression of disease development in response to diverse TAL effectors from both X. oryzae pathovars. The resistance can be triggered by an effector with only 3.5 central repeats, is independent of the composition of the repeat variable di-residues that determine TAL effector binding specificity, and is independent of the transcriptional activation domain. We determined that the resistance is conferred by a single dominant locus, designated Xo1, that maps to a 1.09 Mbp fragment on chromosome 4. The Xo1 interval also confers complete resistance to the strains in the African clade of X. oryzae pv. oryzicola, representing the first dominant resistance locus against bacterial leaf streak in rice. The strong phenotypic similarity between the TAL effector-triggered resistance conferred by Xo1 and that conferred by the tomato resistance gene Bs4 suggests that monocots and dicots share an ancient or convergently evolved mechanism to recognize analogous TAL effector epitopes. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Yan, Qing; Hu, Xiufang; Wang, Nian
2012-10-01
Lipopolysaccharide (LPS) is an important virulence factor of Xanthomonas citri ssp. citri, the causative agent of citrus canker disease. In this research, a novel gene, designated as nlxA (novel LPS cluster gene of X. citri ssp. citri), in the LPS cluster of X. citri ssp. citri 306, was characterized. Our results indicate that nlxA is required for O-polysaccharide biosynthesis by encoding a putative rhamnosyltransferase. This is supported by several lines of evidence: (i) NlxA shares 40.14% identity with WsaF, which acts as a rhamnosyltransferase; (ii) sodium dodecylsulphate-polyacrylamide gel electrophoresis analysis showed that four bands of the O-antigen part of LPS were missing in the LPS production of the nlxA mutant; this is also consistent with a previous report that the O-antigen moiety of LPS of X. citri ssp. citri is composed of a rhamnose homo-oligosaccharide; (iii) mutation of nlxA resulted in a significant reduction in the resistance of X. citri ssp. citri to different stresses, including sodium dodecylsulphate, polymyxin B, H(2)O(2), phenol, CuSO(4) and ZnSO(4). In addition, our results indicate that nlxA plays an important role in extracellular polysaccharide production, biofilm formation, stress resistance, motility on semi-solid plates, virulence and in planta growth in the host plant grapefruit. © 2012 THE AUTHORS. MOLECULAR PLANT PATHOLOGY © 2012 BSPP AND BLACKWELL PUBLISHING LTD.
de Barros, Caio Henrique Nasi; Cruz, Guilherme Crispim Faria; Mayrink, Willian; Tasic, Ljubica
2018-01-01
Purpose Despite the numerous reports on biological syntheses of silver nanoparticles (AgNPs), little is known about the composition of their capping agents, protein corona of plant extract-mediated synthesis, and their influence on the properties of AgNPs. Here, orange (Citrus sinensis) waste was utilized as a source of an extract for AgNP synthesis (the protein corona composition of which was elucidated), and also as a starting material for hesperidin and nanocellulose extraction, which were used for bio-based AgNP synthesis. A comparison of the results using the two methods of synthesis is presented. Methods AgNPs were synthesized using orange (C. sinensis) peel extract (Or-AgNPs) in a biological route, and using hesperidin (Hsd-AgNPs) and nanocellulose (extracted from oranges) in a green chemical route. Characterization of nanoparticles was carried out using zeta potential and hydrodynamic size measurements, transmission electron microscopy, and X-ray diffraction. Elucidation of proteins from protein corona was performed via ultra performance liquid chromatography-tandem mass spectrometer experiments. Antimicrobial activity was assessed via minimum inhibitory concentration assays against Xanthomonas axonopodis pv. citri (Xac), the bacterium that causes citric canker in oranges. Results Or-AgNPs were not completely uniform in morphology, having a size of 48.1±20.5 nm and a zeta potential of −19.0±0.4 mV. Stabilization was performed mainly by three proteins, which were identified by tandem mass spectrometry (MS/MS) experiments. Hsd-AgNPs were smaller (25.4±12.5 nm) and had uniform morphology. Nanocellulose provided a strong steric and electrostatic (−28.2±1.0 mV) stabilization to the nanoparticles. Both AgNPs presented roughly the same activity against Xac, with the minimum inhibitory concentration range between 22 and 24 μg mL−1. Conclusion Despite the fact that different capping biomolecules on AgNPs had an influence on morphology, size, and stability
Pandey, Sheo Shankar; Patnana, Pradeep Kumar; Lomada, Santosh Kumar; Tomar, Archana; Chatterjee, Subhadeep
2016-01-01
Abilities of bacterial pathogens to adapt to the iron limitation present in hosts is critical to their virulence. Bacterial pathogens have evolved diverse strategies to coordinately regulate iron metabolism and virulence associated functions to maintain iron homeostasis in response to changing iron availability in the environment. In many bacteria the ferric uptake regulator (Fur) functions as transcription factor that utilize ferrous form of iron as cofactor to regulate transcription of iron metabolism and many cellular functions. However, mechanisms of fine-tuning and coordinated regulation of virulence associated function beyond iron and Fur-Fe2+ remain undefined. In this study, we show that a novel transcriptional regulator XibR (named X anthomonas iron binding regulator) of the NtrC family, is required for fine-tuning and co-coordinately regulating the expression of several iron regulated genes and virulence associated functions in phytopathogen Xanthomonas campestris pv. campestris (Xcc). Genome wide expression analysis of iron-starvation stimulon and XibR regulon, GUS assays, genetic and functional studies of xibR mutant revealed that XibR positively regulates functions involved in iron storage and uptake, chemotaxis, motility and negatively regulates siderophore production, in response to iron. Furthermore, chromatin immunoprecipitation followed by quantitative real-time PCR indicated that iron promoted binding of the XibR to the upstream regulatory sequence of operon’s involved in chemotaxis and motility. Circular dichroism spectroscopy showed that purified XibR bound ferric form of iron. Electrophoretic mobility shift assay revealed that iron positively affected the binding of XibR to the upstream regulatory sequences of the target virulence genes, an effect that was reversed by ferric iron chelator deferoxamine. Taken together, these data revealed that how XibR coordinately regulates virulence associated and iron metabolism functions in Xanthomonads in
Ionescu, Michael; Baccari, Clelia; Da Silva, Aline Maria; Garcia, Angelica; Yokota, Kenji; Lindow, Steven E.
2013-01-01
Xylella fastidiosa, like related Xanthomonas species, employs an Rpf cell-cell communication system consisting of a diffusible signal factor (DSF) synthase, RpfF, and a DSF sensor, RpfC, to coordinate expression of virulence genes. While phenotypes of a ΔrpfF strain in Xanthomonas campestris could be complemented by its own DSF, the DSF produced by X. fastidiosa (XfDSF) did not restore expression of the XfDSF-dependent genes hxfA and hxfB to a ΔrpfF strain of X. fastidiosa, suggesting that Rp...
International Nuclear Information System (INIS)
Ahmad, M.S.; Malik, M.A.; Shaukat, G.A.
1996-01-01
A bacterial strain bacillus subtilis AECL69 produces two anti bacterial antibiotics in a specified complex or synthetic medium. One of the antibiotics is characteristically active against Xanthomonas citri. Procedures have been described to isolate and purify a complex of xanthmonas antibiotics from the fermented complex broths, and from the fermented synthetic medium as well. Paper chromatography coupled with bioautography has shown that the complex of xanthomonas antibiotics has at least three components. The three components were indicated irrespective of the fact whether it was isolated from the fermented complex or synthetic broth. (author)
Directory of Open Access Journals (Sweden)
Cha Jae-Soon
2010-07-01
Full Text Available Abstract Background Xanthomonas oryzae pv. oryzae (Xoo is the causal agent of rice bacterial blight disease. Xoo produces a range of virulence factors, including EPS, extracellular enzyme, iron-chelating siderophores, and type III-secretion dependent effectors, which are collectively essential for virulence. Genetic and genomics evidence suggest that Xoo might use the diffusible signal factor (DSF type quorum sensing (QS system to regulate the virulence factor production. However, little is known about the chemical structure of the DSF-like signal(s produced by Xoo and the factors influencing the signal production. Results Xoo genome harbours an rpf cluster comprising rpfB, rpfF, rpfC and rpfG. The proteins encoded by these genes are highly homologous to their counterparts in X. campestris pv. campestris (Xcc, suggesting that Xcc and Xoo might use similar mechanisms for DSF biosynthesis and autoregulation. Consistent with in silico analysis, the rpfF mutant was DSF-deficient and the rpfC mutant produced about 25 times higher DSF-like activity than the wild type Xoo strain KACC10331. From the supernatants of rpfC mutant, we purified three compounds showing strong DSF-like activity. Mass spectrometry and NMR analysis revealed that two of them were the previously characterized DSF and BDSF; the third one was a novel unsaturated fatty acid with 2 double bonds and was designated as CDSF in this study. Further analysis showed that all the three DSF-family signals were synthesized via the enzyme RpfF encoded by Xoo2868. DSF and BDSF at a final concentration of 3 μM to the rpfF mutant could fully restore its extracellular xylanase activity and EPS production to the wild type level, but CDSF was less active than DSF and BDSF in induction of EPS and xylanase. DSF and CDSF shared a similar cell density-dependent production time course with the maximum production being detected at 42 h after inoculation, whereas the maximum production of BDSF was observed
Directory of Open Access Journals (Sweden)
Céline Pesce
2017-06-01
Full Text Available Xanthomonas translucens is the causal agent of bacterial leaf streak, the most common bacterial disease of wheat and barley. To cause disease, most xanthomonads depend on a highly conserved type III secretion system, which translocates type III effectors into host plant cells. Mutagenesis of the conserved type III secretion gene hrcT confirmed that the X. translucens type III secretion system is required to cause disease on the host plant barley and to trigger a non-host hypersensitive response (HR in pepper leaves. Type III effectors are delivered to the host cell by a surface appendage, the Hrp pilus, and a translocon protein complex that inserts into the plant cell plasma membrane. Homologs of the Xanthomonas HrpF protein, including PopF from Ralstonia solanacearum and NolX from rhizobia, are thought to act as a translocon protein. Comparative genomics revealed that X. translucens strains harbor a noncanonical hrp gene cluster, which rather shares features with type III secretion systems from Ralstonia solanacearum, Paraburkholderia andropogonis, Collimonas fungivorans, and Uliginosibacterium gangwonense than other Xanthomonas spp. Surprisingly, none of these bacteria, except R. solanacearum, encode a homolog of the HrpF translocon. Here, we aimed at identifying a candidate translocon from X. translucens. Notably, genomes from strains that lacked hrpF/popF/nolX instead encode another gene, called hpaT, adjacent to and co-regulated with the type III secretion system gene cluster. An insertional mutant in the X. translucens hpaT gene, which is the first gene of a two-gene operon, hpaT-hpaH, was non-pathogenic on barley and did not cause the HR or programmed cell death in non-host pepper similar to the hrcT mutant. The hpaT mutant phenotypes were partially complemented by either hpaT or the downstream gene, hpaH, which has been described as a facilitator of translocation in Xanthomonas oryzae. Interestingly, the hpaT mutant was also complemented
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... transferase [Xanthomonas oryzae pv. oryzae KACC10331] ... Length = 196 ... Query: 163 HLVVQAMDFASDQFSRDAFARC...AMACPPGIVRSVRKRQAEYFFGRLAARHALHQQGLVVH 222 ... HLVVQAMDFASDQFSRDAFARC...AMACPPGIVRSVRKRQAEYFFGRLAARHALHQQGLVVH Sbjct: 1 ... HLVVQAMDFASDQFSRDAFARCAMACPPGIVRSVRKRQAEYFFGRLAARHA
Ira y reactividad cardiaca : adaptación en una situación de estrés real
Breva Asensio, Alicia; Espinosa, Matilde; Palmero, Francisco
2000-01-01
El objetivo de nuestro trabajo se centra en establecer la posible relación existente entre el complejo irahostilidad y la activación y reactividad cardiacas. La literatura científica sobre el tema presenta resultados heterogéneos, gran parte de ellos debidos al tipo de tarea experimental diseñada para detectar diferencias entre grupos. En nuestro trabajo se ha utilizado una tarea de estrés real, un examen, que permite detectar mejor las diferencias entre grupos...
Búsquedas de epitopes conformacionales en la proteína HPV16-E7 del virus de papiloma humano
Directory of Open Access Journals (Sweden)
Julio C. Calvo
2010-11-01
Full Text Available El virus de papiloma humano tipo 16 (HPV-16 es la principal causa de cáncer entre las mujeres en Colombia. Es importante desarrollar pruebas de bajo costo y confiables para detectar la presencia de este virus en las primeras etapas de la enfermedad. Los péptidos pueden ser usados para detectar anticuerpos en sueros, pero a menudo no son activos. Sin embargo, péptidos restringidos que imiten epitopes conformacionales pueden ser más efectivos.
Bi, Hongkai; Yu, Yonghong; Dong, Huijuan; Wang, Haihong; Cronan, John E.
2014-01-01
SUMMARY In Xanthomonas campestris pv. campestris (Xcc), the proteins encoded by the rpf (regulator of pathogenicity factor) gene cluster produce and sense a fatty acid signal molecule called diffusible signaling factor (DSF, 2(Z)-11-methyldodecenoic acid). RpfB was reported to be involved in DSF processing and was predicted to encode an acyl-CoA ligase. We report that RpfB activates a wide range of fatty acids to their CoA esters in vitro. Moreover, RpfB can functionally replace the paradigm bacterial acyl-CoA ligase, Escherichia coli FadD, in the E. coli β-oxidation pathway and deletion of RpfB from the Xcc genome results in a strain unable to utilize fatty acids as carbon sources. An essential RpfB function in the pathogenicity factor pathway was demonstrated by the properties of a strain deleted for both the rpfB and rpfC genes. The ΔrpfB ΔrpfC strain grew poorly and lysed upon entering stationary phase. Deletion of rpfF, the gene encoding the DSF synthetic enzyme, restored normal growth to this strain. RpfF is a dual function enzyme that synthesizes DSF by dehydration of a 3-hydroxyacyl-acyl carrier protein (ACP) fatty acid synthetic intermediate and also cleaves the thioester bond linking DSF to ACP. However, the RpfF thioesterase activity is of broad specificity and upon elimination of its RpfC inhibitor RpfF attains maximal activity and its thioesterase activity proceeds to block membrane lipid synthesis by cleavage of acyl-ACP intermediates. This resulted in release of the nascent acyl chains to the medium as free fatty acids. This lack of acyl chains for phospholipid synthesis results in cell lysis unless RpfB is present to counteract the RpfF thioesterase activity by catalyzing uptake and activation of the free fatty acids to give acyl-CoAs that can be utilized to restore membrane lipid synthesis. Heterologous expression of a different fatty acid activating enzyme, the Vibrio harveyi acyl-ACP synthetase, replaced RpfB in counteracting the effects of
Estudi i anàlisi sobre la implantació dels drons com a una mesura antiincendis
Llordés Pavón, Ignasi
2016-01-01
Aquest projecte té com a objectiu general trobar una solució a la lentitud a l‟hora de detectar un incendi als boscos. Per fer-ho es dissenya un sistema emprant una tecnologia emergent: els drons. Es realitza un estudi de mercat per conscienciar-se de les infinites possibilitats que ofereix actualment una tecnologia en desenvolupament com són els drons. S‟analitzen el funcionament i les possibilitats de diverses tecnologies per a detectar incendis i es selecciona la més adie...
Directory of Open Access Journals (Sweden)
Maxuel O Andrade
2014-02-01
Full Text Available The RsmA/CsrA family of the post-transcriptional regulators of bacteria is involved in the regulation of many cellular processes, including pathogenesis. In this study, we demonstrated that rsmA not only is required for the full virulence of the phytopathogenic bacterium Xanthomonas citri subsp. citri (XCC but also contributes to triggering the hypersensitive response (HR in non-host plants. Deletion of rsmA resulted in significantly reduced virulence in the host plant sweet orange and a delayed and weakened HR in the non-host plant Nicotiana benthamiana. Microarray, quantitative reverse-transcription PCR, western-blotting, and GUS assays indicated that RsmA regulates the expression of the type 3 secretion system (T3SS at both transcriptional and post-transcriptional levels. The regulation of T3SS by RsmA is a universal phenomenon in T3SS-containing bacteria, but the specific mechanism seems to depend on the interaction between a particular bacterium and its hosts. For Xanthomonads, the mechanism by which RsmA activates T3SS remains unknown. Here, we show that RsmA activates the expression of T3SS-encoding hrp/hrc genes by directly binding to the 5' untranslated region (UTR of hrpG, the master regulator of the hrp/hrc genes in XCC. RsmA stabilizes hrpG mRNA, leading to increased accumulation of HrpG proteins and subsequently, the activation of hrp/hrc genes. The activation of the hrp/hrc genes by RsmA via HrpG was further supported by the observation that ectopic overexpression of hrpG in an rsmA mutant restored its ability to cause disease in host plants and trigger HR in non-host plants. RsmA also stabilizes the transcripts of another T3SS-associated hrpD operon by directly binding to the 5' UTR region. Taken together, these data revealed that RsmA primarily activates T3SS by acting as a positive regulator of hrpG and that this regulation is critical to the pathogenicity of XCC.
Directory of Open Access Journals (Sweden)
Dámaso Cáceres-Govea
2003-03-01
Full Text Available Se analiza el comportamiento de la falla Pinar a partir de datos reales de varios afloramientos descritos a lo largo de dicha estructura. El uso de la microtectónica y el análisis estructural permitió detectar e interpretar algunos indicadores cinématicos que denotan su funcionamiento transcurrente siniestro en su etapa inicial. Asimismo, estructuras superpuestas en diferentes planos de falla permitieron detectar desplazamientos subhorizontales que marcan una etapa intermedia de transición, para culminar su evolución como una clásica falla gravitacional.
Zaraín, Iliana Jiménez
2006-01-01
La presente investigación de tipo cualitativo, tuvo como objetivo detectar las necesidades psicológicas y físicas de los pacientescon alguna enfermedad terminal. Se llevó a cabo en un Hospital del I.S.S.S.T.E, endonde mediante la aplicación de un instrumento proporcionado por el hospital y la técnica de la entrevista profunda se recolectaron una serie de datos, cada entrevista duró entre 1 y 2 hrs. Se realizaron 6 entrevistas con cada uno de los 3 pacientes entrevistados para detectar sus nec...
Sélection des variétés de soja pour la résistance à la pustule bactérienne au Bénin
Directory of Open Access Journals (Sweden)
Zinsou, VA.
2016-01-01
Full Text Available Selection of Soybean Varieties for Resistance to Bacterial Pustule in Benin. Bacterial pustule caused by Xanthomonas axonopodis pv. glycines is a dreaded disease on soybeans inducing considerable yield losses worldwide. The aim of this study is to test 16 soybean varieties for resistance to bacterial pustule under natural infection and artificial inoculation. The study was conducted under greenhouse and field conditions at the experimental farm of the University of Parakou from July to October in 2013 and in 2014. The results show that the varieties JUPITER, ISRA25/72, TGX1985-77F, TGX1910-2F and TGX1985-11F are sensitive to moderately sensitive. The varieties TGX1448-2E, TGX1987-62F, TGX1990-15F, TGX1987-10F, TGX1835-10F, TGX1740-2F and TGX1440-1E are moderately resistant to resistant. The varieties TGX1988-5F, TGX1910-14F, TGX1989-21F and TGX1989-19F revealed moderately resistant in the greenhouse, but sensitive to moderately sensitive in the field. In 2013, yield losses from 2.7 to 28.1% were recorded with the varieties TGX1910-2F, ISRA25/72, JUPITER, TGX1910-2F, TGX1987-10F, TGX1835-10F and TGX1740-2F. Yield losses were calculated for each variety considering the yield difference between the natural infection and the artificial inoculation. The difference was than divided by the yield obtained in the natural infection. In 2014, varieties TGX1985-77F, TGX1740-2F, ISRA25/72, TGX1987-62F and TGX1910-14F showed losses ranging from 4.7 to 21.4%. The other varieties showed yield increases from 2.7 to 26% in 2013 and from 2.2 to 36.6% in 2014. With variety TGX1985-11F neither yield loss nor gain were observed over the two years. T For the 16 tested varieties, TGX1987-62F and TGX1990-15F are the most resistant; while TGX1989-19F, TGX1985-11F, TGX1440-1E, TGX1985-77F and TGX1910-14F are partial resistant. Those varieties have a high yield and could be recommended to the farmers. The two most resistant varieties could be integrated in a plant breeding
Directory of Open Access Journals (Sweden)
CAROLINA GONZALEZ ALMARIO
2008-05-01
Full Text Available La yuca es un cultivo de importancia en la seguridad alimentaria mundial ya que constituye la base de la alimentación de más de 600 millones de personas en el mundo. También es un alto productor de almidón con niveles que oscilan entre 73,7 y 84,9% de su peso seco total en raíces (FAO, 2007. El almidón de yuca puede utilizarse en una gama amplia de industrias (textil, cosmética, alimentaria, etc. Además, es empleado en la producción de biocombustibles. Una de las principales limitantes en la producción de yuca es la bacteriosis vascular producida por la bacteria Xanthomonas axonopodis pv. manihotis (Xam. Esta enfermedad puede comprometer no solo el suministro de almidón para las plantas industriales productoras de bioetanol sino que también puede amenazar la seguridad alimentaria. El mejoramiento genético convencional de yuca es complicado dado su largo ciclo reproductivo, su alta heterocigocidad y su naturaleza tetraploide. Por estas razones se deben buscar alternativas que involucren desarrollos en biotecnología que permitan un mejoramiento eficaz y rápido. En la actual era genómica y postgenómica muchos de los experimentos dependen de la posibilidad de contar con la secuencia de transcritos clonados. Dado que estos clones provienen de librerías de ADNc contar con este tipo de recursos de excelente calidad es un paso esencial. En este artículo reportamos la construcción de una librería de ADNc empleando el sistema Gateway® a partir de plantas de yuca que han sido inoculadas con la cepa CIO151 de Xam. La librería presentó un título de 1 x 107 unidades formadoras de colonias (ufc/ml y el tamaño de los insertos osciló entre 600-1.500 pb. Los análisis de secuencia de 14 clones al azar confirmaron que se trata de genes expresados y mostraron similitud con genes previamente reportados en especies estrechamente relacionadas a yuca. Esta librería se convierte en un excelente recurso para identificar novedosos genes y para
Directory of Open Access Journals (Sweden)
Tatiana Barreto Rocha Nery
2008-01-01
Full Text Available Xanthan is a polysaccharide synthesized by Xanthomonas bacteria and of extreme commercial importance as a microbial polysaccharide. The aim of this work was to produce xanthan using mozzarella cheese whey as substrate, by different isolates natives the Xanthomonas. The alternative medium for production was milk whey, urea and K2HPO4. The xanthan maximum productivity was 21.91 g L-1. Analysis of apparent viscosity was made in solutions of gum at 0.5-2.0%, 25-65 ºC with shear rate of 25-1000 s-1.The maximum viscosity found was 57.30 mPa.s. The isolates demonstrate capacity to degrade the lactose and to produce xanthan, being constituted an alternative for the industrial production.
African Journals Online (AJOL)
home
2014-05-25
May 25, 2014 ... (Phaeoisariopsis griseola) and common bacterial blight. (Xanthomonas ... most wide spread and economically important seed borne disease, mainly in the ..... International maize and wheat center,. Mexico. Conner, F.A. ...
Tomografía computada cone beam en articulación témporo mandibular (ATM)
DR. B. Andrés Briner
2014-01-01
En el estudio de la patología degenerativa de las ATM se pueden utilizar diversas modalidades imaginológicas, orientadas a detectar los cambios morfológicos y funcionales que ésta presenta, especialmente en los casos de artrosis. El propósito del presente artículo es exponer imágenes de alta resolución obtenidas mediante la técnica de Cone Beam, mostrando la elevada capacidad que esta técnica tiene para detectar cambios óseos morfológicos sutiles, que permiten el diagnóstico de las diversa...
Cancino Estrada, Yurixhi
2012-01-01
Antecedentes: el TDAH es la enfermedad psiquiátrica crónica más frecuente en la edad pediátrica. Su prevalencia es del 3 al 5%. No existe una encuesta única para sospechar TDAH, una de ellas es la escala de Conners, al detectar oportunamente a estos niños e iniciar tratamiento, se disminuye fracaso escolar y rechazo social. Objetivo: detectar TDAH mediante la escala de Conners en niños de 6 a 9 años de edad. Material y métodos: estudio descriptivo mediante aplicación de l...
Voorkom Xanthomonas in vaste planten
Leeuwen, van P.J.; Kerkvliet, J.J.P.; Meekes, E.
2015-01-01
Bij diagnostisch onderzoek blijkt regelmatig dat bladvlekken in vaste planten niet door een schimmel, maar door een bacterie worden veroorzaakt. Bestrijding is niet mogelijk, dus voorkomen is de enige oplossing.
OCCURRENCE AND CHARACTERISATION OF Xanthomonas ...
African Journals Online (AJOL)
ACSS
Current Microbiology 16:137-144. Frederick, R.D., Snyder, C.L., Peterson, G.L. and. Bonde, M.R. 2002. Polymerase chain reaction assays for the detection and discrimination of the soybean rust pathogens Phakopsora pachyrhizi and. P. meibomiae. Phytopathology 92: 217-227. Gnanamanickam, S.S., Shiaki, T., Medella, ...
Genetic sequences derived from suppression subtractive ...
African Journals Online (AJOL)
STORAGESEVER
2008-06-17
Jun 17, 2008 ... their possible roles in Xanthomonas albilineans ... Technology, P. O. Box 1334, Durban 4000, Republic of South Africa. Accepted 4 ... Clones selected were sequenced (using a Perkin Elmer ABI PRISM Dye terminator cycle.
Species-specific detection of Dickeya sp. (Pectobacterium ...
African Journals Online (AJOL)
use
2011-11-23
Nov 23, 2011 ... (Pectobacterium chrysanthemi) in infected banana tissues .... tetraacetic (EDTA) disodium salt pH 8.0, 100 mm NaCl and 1% .... lane 7, Erwinia carotovora subsp. carotovora; lane 8, Xanthomonas campestris pv.musacearum;.
African Journals Online (AJOL)
Items 451 - 500 of 11090 ... Vol 10, No 78 (2011), A study on reverse osmosis permeating treatment ... of resistance to streptomycin in Xanthomonas oryzae pv. oryzae, Abstract PDF ... suitable for Medicago truncatula leaf proteome, Abstract PDF.
African Journals Online (AJOL)
In vitro evaluation of the antibacterial activity of some medicinal plant extracts against. Xanthomonas .... biodegradable (Kagale et al., 2004; Guleria and. Tiku, 2009). ... remove dust and other debris, and air dried under shade at ... filter paper.
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest
DEFF Research Database (Denmark)
Madsen, Jonas Stenløkke
from seven different soil isolates. Especially strong biofilm synergy was found in co-cultures with members: Stenotrophomonas rhizophila, Xanthomonas retroflexus, Microbacterium oxydans, and Paenibacillus amylolyticus. Further analysis revealed that all members were essential for the strong biofilm...
DOI: 10.18697/ajfand.81.16700 13154 CANOPY MANAGEMENT ...
African Journals Online (AJOL)
Small-scale farmers in the banana-coffee agro-zone of Central Uganda plant ..... tree phenology [38]; tree species' architecture, tree age and local environmental .... Eden-Green S, Molina A and R Markham Xanthomonas wilt of bananas in.
Antimicrobial constituents of the leaves of Mikania micrantha H. B. K.
Directory of Open Access Journals (Sweden)
Yan Li
Full Text Available BACKGROUND: To isolate plant-derived compounds with antimicrobial activity from the leaves of Mikania micrantha, to determine the compounds configuration, and to evaluate their antimicrobial activity against eight plant pathogenic fungi (Exserohilum turcicum, Colletotrichum lagenarium, Pseudoperonispora cubensis, Botrytis cirerea, Rhizoctonia solani, Phytophthora parasitica, Fusarium solani, and Pythium aphanidermatum, and four plant pathogenic bacteria (gram negative bacteria: Ralstonia dolaanacearum, Xanthomonas oryzae pv. Oryzae, Xanthomonas Campestris pv. Vesicatoria, and Xanthomonas campestris pv. Citri, and four bacteria (gram positive bacteria: Staphyloccocus aureus, Bacillus subtilis, Micrococcus luteus, and Bacillus cereus. METHODS AND RESULTS: Antimicrobial constituents of the leaves of M. micrantha were isolated using bioactivity- guided fractionation. The antifungal activity of the isolated compounds was evaluated by the inhibit hypha growth method and inhibit spore germination method. Characterization of antibacterial activity was carried out using the minimum inhibitory concentrations (MICs and the minimum bactericidal concentrations (MBCs. MIC and MBC were determined by the broth microdilution method. Six compounds - deoxymikanolide, scandenolide, dihydroscandenolide, mikanolide, dihydromikanolide, and m - methoxy benzoic acid - have been isolated from leaves of Mikania micrantha H. B. K. Deoxymikanolide, scandenolide, and dihydroscandenolide were new compounds. The result of bioassay showed that all of isolated compounds were effective against tested strains and deoxymikanolide showed the strongest activity. CONCLUSIONS AND SIGNIFICANCE: The leaves of M. micrantha may be a promising source in the search for new antimicrobial drugs due to its efficacy and the broadest range. Meanwhile, adverse impact of M. micrantha will be eliminated.
New Sources of Tobamoviruses, CMV and Bacterial Spot Resistance in Pepper
Stoimenova, Elisaveta; Mitrev, Sasa; Bogatzevska, Nevena
2005-01-01
The pepper cultivars Zlaten medal, Alfi and Zalfi, the six Macedonian pepper accessions and the five Bulgarian lines have been screening for the resistance to cucumber mosaic virus (CMV), tobamoviruses and Xanthomonas vesicatoria pepper - tomato pathotype (XvPT).
Evaluation of physical and chemical characteristics of xanthan gums
Directory of Open Access Journals (Sweden)
Claire Tondo Vendruscolo
2007-03-01
Full Text Available This work aimed at evaluating the physical and chemical characteristics of the xanthan produced by Xanthomonas arboricola pv pruni strain 115, and at comparing it with two xanthans obtained from commercial sources – Kelzan e Roeper. The analyzed xanthans showed specified patterns mentioned in the literature, except for low pyruvic acid content in the xanthan produced by strain 115, low monovalent salt content in the Roeper sample and high divalent salt content in both commercial samples. The low pyruvic acid content in the xanthan produced by X. arboricola pv pruni 115 did not affect the aqueous solution viscosity. Thus, the xanthan produced by strain 115 show physical and chemical characteristics that allow its use by the petroleum industry, as well as, in food, pharmaceutical and cosmetics products. Xanthomonas arboricola pv pruni. Xanthan. Physical and chemical characteristics.
Directory of Open Access Journals (Sweden)
María Pía Majdalani
2005-02-01
Full Text Available OBJETIVOS: Validar un cuestionario diseñado para detectar casos de violencia, en consultorios de atención primaria, hacia mujeres de habla hispana. MÉTODOS: El estudio de validación se llevó a cabo entre octubre de 2002 y octubre de 2003 en el Programa de Medicina Interna General del Hospital de Clínicas, Universidad de Buenos Aires, Argentina. El cuestionario original en español se había formulado en clínicas de salud sexual y reproductiva de cinco países de América Latina y el Caribe. En él se abarcaban las formas más frecuentes de violencia basada en el género (VBG (emocional, física, sexual y abuso sexual durante la niñez; se exploraba cómo, cuándo y quién perpetró la agresión, y se indagaba acerca de la percepción de la paciente con respecto al peligro en que se encontraba. Durante la investigación en Buenos Aires se evaluaron el formato y el contenido teórico de la encuesta y se realizaron validaciones lingüística y psicométrica. Se evaluó la confiabilidad del instrumento en términos de reproducibilidad, estabilidad y coherencia interna. RESULTADOS: Se comprobó que las mujeres encuestadas comprendieron bien las preguntas, los ejemplos dados y las opciones de respuesta y que no percibieron la encuesta como un elemento de intimidación, ni una intromisión en su vida privada. En general consideraron su aplicación en el ámbito de la atención primaria como una oportunidad clave para expresar su sufrimiento y recibir ayuda. El nivel de concordancia entre las respuestas en las cinco áreas exploradas (violencia psicológica, violencia psíquica, violencia sexual, abuso sexual en la niñez y percepción del riesgo actual fue muy alta, tanto en lo que respecta a reproducibilidad (valores de kappa de 0,63 a 1,00 como a estabilidad (valores de kappa de 0,62 a 1,00. La coherencia interna, evaluada mediante el coeficiente de correlación alfa, fue de 0,755 entre la violencia psíquica y la física, de 0,498 entre la
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...
Lifescience Database Archive (English)
Full Text Available QT62244 Solanum lycopersicum Solanaceae RXopJ4 resistance locus resistance to bacterial spot... disease resistance to bacterial spot disease (Xanthomonas perforans (Xp)) 3 J350 ... Chr06 ... 10.1007/s00122-012-2004-6 23117718
Interplay of Bacterial Interactions and Spatial Organisation in Multispecies Biofilms
DEFF Research Database (Denmark)
Liu, Wenzheng
-tispecies biofilms, which provides theoretical and practical arguments for further ad-vancement of this field. Here, a reproducible four-species biofilm, composed of Stenotrophomonas rhizophila, Xan-thomonas retroflexus, Microbacterium oxydans and Paenibacillus amylolyticus, was established to study the effect...
DEFF Research Database (Denmark)
Raghupathi, Prem Krishnan; Liu, Wenzheng; Sabbe, Koen
2018-01-01
of a multispecies bacterial biofilm subject to grazing by a pelagic protozoan predator were investigated. To this end, a mono and multispecies biofilms of four bacterial soil isolates, namely Xanthomonas retroflexus, Stenotrophomonas rhizophila, Microbacterium oxydans and Paenibacillus amylolyticus, were...
REACTION OF Musa balbisiana TO BANANA BACTERIAL WILT ...
African Journals Online (AJOL)
Prof. Adipala Ekwamu
2Makerere University, Department of Agricultural Production, P. O. Box 7062, Kampala, Uganda. Corresponding author: kumalfred@gmail.com. (Received 7 February, 2012; accepted 3 September, 2013). ABSTRACT. Banana bacterial wilt (Xanthomonas campestris) is an emerging disease of bananas in Uganda.
Coexistence between neighbours
DEFF Research Database (Denmark)
Shenge, K.C.; Mabagala, R.B.; Mortensen, C A Nieves Paulino
2008-01-01
Experiments were conducted under laboratory and screenhouse conditions to study the coexistence between Pseudomonas syringae pv. tomato and Xanthomonas campestris pv. vesicatoria, incitants of bacterial speck and bacterial spot diseases of tomato. Results of in vitro studies showed that when mixe...
Denancé, N.; Ranocha, P.; Oria, N.; Barlet, X.; Rivière, M.P.; Yadeta, K.A.; Hoffmann, L.; Perreau, F.; Clément, G.; Maia-Grondard, A.; Berg, van den G.C.M.; Savelli, B.; Fournier, S.; Aubert, Y.; Pelletier, S.; Thomma, B.P.H.J.; Molina, A.; Jouanin, L.; Marco, Y.; Goffner, D.
2013-01-01
Inactivation of Arabidopsis WAT1 (Walls Are Thin1), a gene required for secondary cell-wall deposition, conferred broad-spectrum resistance to vascular pathogens, including the bacteria Ralstonia solanacearum and Xanthomonas campestris pv. campestris, and the fungi Verticillium dahliae and
Survival of pathogens of Brussels sprouts (Brassica oleracea Gemifera group) in crop residues
Köhl, J.; Vlaswinkel, M.E.T.; Groenenboom-de Haas, B.H.; Kastelein, P.; Hoof, van R.A.; Wolf, van der J.M.; Krijger, M.C.
2011-01-01
Mycosphaerella brassicicola (ringspot), Alternaria brassicicola and A. brassicae (dark leaf spot) and Xanthomonas campestris pv. campestris (black spot) can infect leaves of Brussels sprouts resulting in yield losses. Infections of outer leaves of sprouts cause severe losses in quality. Crop
African Journals Online (AJOL)
Small-scale farmers in the banana-coffee agro-zone of Central Uganda plant and ..... Eden-Green S, Molina A and R Markham Xanthomonas wilt of bananas in .... Isabirye EB Role of agro-ecosystems in conservation of tree species in the Lake.
Directory of Open Access Journals (Sweden)
Alejandra Corso
2011-12-01
Full Text Available OBJETIVO: Evaluar la capacidad de 17 laboratorios nacionales de referencia que participan en el Programa Latinoamericano de Control de Calidad en Bacteriología y Resistencia a los Antimicrobianos (LA-EQAS para detectar mecanismos de resistencia emergentes, a saber: resistencia de enterobacterias a carbapenemes por presencia de Klebsiella pneumoniae carbapenemasa (KPC; resistencia de enterobacterias a carbapenemes por presencia de metalobetalactamasas (MBL tipo IMP, y resistencia intermedia a vancomicina de aislamientos de Staphylococcus aureus (VISA. MÉTODOS: Se enviaron los siguientes tres aislamientos a los 17 laboratorios participantes del LA-EQAS: Klebsiella pneumoniae OPS-161 productor de KPC, Enterobacter cloacae OPS-166 productor de IMP y S. aureus OPS-165 con resistencia intermedia a vancomicina. Se evaluó la interpretación de las pruebas de sensibilidad y detección del mecanismo de resistencia y el tamaño de los halos de inhibición (método de difusión por discos o valor de la concentración inhibitoria mínima (CIM. RESULTADOS: La concordancia en la detección de los mecanismos de resistencia fue de 76,4%, 73,3% y 66,7% con respecto a la cepas K. pneumoniae OPS-161, E. cloacae OPS-166 y S. aureus OPS-165, respectivamente. La concordancia entre las zonas de inhibición obtenidas por los laboratorios participantes y los rangos establecidos por el laboratorio coordinador fue aceptable en los tres aislamientos, ya que alcanzó 90,8%, 92,8% y 88,9%, respectivamente, para cada cepa. CONCLUSIONES: La concordancia global en la detección de los mecanismos de resistencia KPC, MBL y VISA fue de 72,1%. Consideramos que los laboratorios nacionales de referencia de América Latina son capaces de reconocer estos mecanismos de resistencia emergentes y se espera que en el futuro la concordancia alcance su nivel máximo.OBJECTIVE: To evaluate the capability of 17 national reference laboratories participating in the Latin American Quality
VALIDEZ DE UNA ESCALA PARA DETECTAR AUTISMO EN LA EDUCACIÓN INICIAL
Huitzilihuitl Manuel Zulimak Esquer Sumuano; Dulce Haydé Belmont Sánchez
2015-01-01
El trastorno del espectro autista se caracteriza por la alteración de la interacción social y del len-guaje, movimientos estereotipados e intereses restrictivos. Puede diagnosticarse desde los dosaños de edad; sin embargo, México enfrenta el problema de carecer de instrumentos válidos parala detección y el diagnóstico del trastorno del espectro autista. El objetivo de este trabajo fue, enconsecuencia, adaptar la Escala para Detección de Autismo en Preescolares para ser aplicada aniños de dos ...
Directory of Open Access Journals (Sweden)
Liliana Cecilia Gómez Gómez
2012-07-01
Full Text Available Título en ingles: Halotolerant alkalophilic and indolacetic acid producing acid producing bacteria associated with Arthrospira platensis (Cyanophyceae Resumen: Este trabajo tuvo como propósito contribuir al conocimiento de la interacción entre la cianobacteria alcalófila Arthrospira platensis y las bacterias que crecen asociadas a su mucilago. Se desarrolló un medio de cultivo heterotrófico en el cual se aislaron cinco cepas bacterianas asociadas a un monocultivo de A. platensis. Se determinó la capacidad de estas cinco cepas para producir ácido 3- indol acético (AIA. La tipificación molecular de los aislamientos bacterianos permitió identificarlos como Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str. Kh10-101, Indibacter alkaliphilus, type str. LW1T; todas las cepas bacterianas obtenidas son halotolerantes, alcalófilas y productoras de AIA. Los resultados aportan evidencia para sugerir una interacción benéfica entre A. platensis y sus bacterias asociadas, quizá como estrategia evolutiva de cooperación para desarrollarse en un ambiente hipersalino. Palabras claves: Bacillus okhensis, Exiguobacterium aurantiacum, Halomonas sp., Indibacter alkaliphilus. Xanthomonas sp. Abstract: The aim of this study was contribute to knowledge over alkalophilic cianobacteryum Arthrospira platensis and their interaction with some associated bacteria growing in their mucilage. Heterotrophic culture medium was designed, in this medium were isolated five bacterial strains associated to single culture of A. platensis. It was measured the 3-indol acetic acid (IAA production by these bacterial strains. Molecular typing allowed identify these bacterial strains like Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str. Kh10-101, Indibacter alkaliphilus, type str. LW1T; all these bacteria are halotolerant
Huanglongbing (HLB or citrus greening disease) caused by Candidatus Liberibacter asiaticus (Las) is a great threat to the United States citrus industry. Citrus canker is also an economically important disease associated with a bacterial pathogen (Xanthomonas citri). In this study, we characterized e...
Antagonistic activity of Bacillus subtilis SB1 and its biocontrol effect on tomato bacterial wilt
A potential biocontrol agent of bacterial wilt, Bacillus subtilis SB1, isolated from tomato roots, showed a broad-spectrum of antimicrobial activity in in vitro experiments. It inhibited the growth of many plant pathogens, including Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, Fusarium ox...
Acibenzolar-S-methyl induces lettuce resistance against ...
African Journals Online (AJOL)
... contributing to the enhancement of plant resistance. The effect was comparable with copper treatment. As a marker of resistance, PR protein activity chitinase showed remarkable increase, depending on decreasing bacterial growth in planta. Key words: Acibenzolar-S-methyl, induced resistance, Xanthomonas campestris ...
Directory of Open Access Journals (Sweden)
Nagano Celso S
2008-06-01
Full Text Available Abstract Background An interaction between lectins from marine algae and PLA2 from rattlesnake was suggested some years ago. We, herein, studied the effects elicited by a small isolectin (BTL-2, isolated from Bryothamnion triquetrum, on the pharmacological and biological activities of a PLA2 isolated from rattlesnake venom (Crotalus durissus cascavella, to better understand the enzymatic and pharmacological mechanisms of the PLA2 and its complex. Results This PLA2 consisted of 122 amino acids (approximate molecular mass of 14 kDa, its pI was estimated to be 8.3, and its amino acid sequence shared a high degree of similarity with that of other neurotoxic and enzymatically-active PLA2s. BTL-2 had a molecular mass estimated in approximately 9 kDa and was characterized as a basic protein. In addition, BTL-2 did not exhibit any enzymatic activity. The PLA2 and BTL-2 formed a stable heterodimer with a molecular mass of approximately 24–26 kDa, estimated by molecular exclusion HPLC. In the presence of BTL-2, we observed a significant increase in PLA2 activity, 23% higher than that of PLA2 alone. BTL-2 demonstrated an inhibition of 98% in the growth of the Gram-positive bacterial strain, Clavibacter michiganensis michiganensis (Cmm, but only 9.8% inhibition of the Gram-negative bacterial strain, Xanthomonas axonopodis pv passiflorae (Xap. PLA2 decreased bacterial growth by 27.3% and 98.5% for Xap and Cmm, respectively, while incubating these two proteins with PLA2-BTL-2 inhibited their growths by 36.2% for Xap and 98.5% for Cmm. PLA2 significantly induced platelet aggregation in washed platelets, whereas BTL-2 did not induce significant platelet aggregation in any assay. However, BTL-2 significantly inhibited platelet aggregation induced by PLA2. In addition, PLA2 exhibited strong oedematogenic activity, which was decreased in the presence of BTL-2. BTL-2 alone did not induce oedema and did not decrease or abolish the oedema induced by the 48
Nguyen, Hoa Thi; Yu, Nan Hee; Park, Ae Ran; Park, Hae Woong; Kim, In Seon; Kim, Jin-Cheol
2017-10-28
This study aimed to isolate and characterize antibacterial metabolites from Pharbitis nil seeds and investigate their antibacterial activity against various plant pathogenic bacteria. The methanol extract of P. nil seeds showed the strongest activity against Xanthomonas arboricola pv. pruni (Xap) with a minimum inhibition concentration (MIC) value of 250 μg/ml. Among the three solvent layers obtained from the methanol extract of P. nil seeds, only the butanol layer displayed the activity with an MIC value of 125 μg/ml against Xap. An antibacterial fraction was obtained from P. nil seeds by repeated column chromatography and identified as pharbitin, a crude resin glycoside, by instrumental analysis. The antibacterial activity of pharbitin was tested in vitro against 14 phytopathogenic bacteria, and it was found to inhibit Ralstonia solanacearum and four Xanthomonas species. The minimum inhibitory concentration values against the five bacteria were 125-500 μg/ml for the n-butanol layer and 31.25-125 μg/ml for pharbitin. In a detached peach leaf assay, it effectively suppressed the development of bacterial leaf spot, with a control value of 87.5% at 500 μg/ml. In addition, pharbitin strongly reduced the development of bacterial wilt on tomato seedlings by 97.4% at 250 μg/ml, 7 days after inoculation. These findings suggest that the crude extract of P. nil seeds can be used as an alternative biopesticide for the control of plant diseases caused by R. solanacearum and Xanthomonas spp. This is the first report on the antibacterial activity of pharbitin against phytopathogenic bacteria.
2013-01-10
... polysaccharide produced by aerobic fermentation of Xanthomonas campestris. The chemical structure of the repeating pentasaccharide monomer unit consists of a backbone of two P-1,4-D- Glucose monosaccharide units...-D- Mannose monosaccharide units. The terminal mannose may be pyruvylated and the internal mannose...
Role of antioxidant scavenging enzymes and extracellular ...
African Journals Online (AJOL)
In the present work, we studied the role of antioxidant scavenging enzymes of plant pathogenic bacteria: catalase, ascorbate peroxidase and a virulence factor; extracelluar polysaccharide production in determining the virulence of Xanthomonas oryzae pv. oryzae (Xoo) isolates and its differential reaction to rice cultivars.
Asiatic citrus canker (ACC, caused by the bacterium Xanthomonas citri subsp. citri) is a destructive disease of citrus in Brazil and in several other citrus-producing countries. ACC management is problematic, and bactericides such as copper can be reasonably efficacious but do not completely control...
Resistance evaluation of Pera (Citrus sinensis) genotypes to citrus canker in greenhouse conditions
Citrus canker, caused by the bacterium Xanthomonas citri subsp. citri results in serious yield losses and phytoregulation penalties. The use of resistant genotypes is recognized as an important tool to facilitate control of the pathogen. Studies have show that artificial inoculation results in typic...
Evaluation of enset clones against enset bacterial wilt | Welde ...
African Journals Online (AJOL)
A large number of enset clones collected from the Sidama, Gurage, Kembata Tembaro and Hadyia zones were assessed for resistance/tolerance to enset bacterial wilt, Xanthomonas campestris pv. musacearum (Xcm) at the Awassa Agricultural Research Center, Awassa in Ethiopia, during the period 1994 to 2000.
gum production by Xanthomonas campestris pv
African Journals Online (AJOL)
DR TONUKARI NYEROVWO
2012-09-11
Sep 11, 2012 ... 8004) for xanthan gum production in this study. ... strain for xanthan gum production using cassava starch in industrial applications. ... the cassava price is cost-effective relative to other ... For amylase activity determination, a crude enzyme sample (1 ml) .... time point to stop fermentation from an economic.
Molecular and biochemical characterization of Xanthomonas ...
African Journals Online (AJOL)
Yomi
2010-12-29
Dec 29, 2010 ... tible to canker, but grapefruit, Mexican lime and lemon are highly ... the world, thereby generating substantial information on the biology and .... showed significantly increased activity by cup diffusion method, while a ...
Physiological characteristics and pathogenicity of Xanthomonas ...
African Journals Online (AJOL)
The strains were Gram-negative, KOH and catalase positive, suppressed on asparagine medium and negative for nitrate reduction; most isolates (84.2%) were insensitive to 2% NaCl while few strains (15.8%) were retarded by 1% NaCl concentration. All the strains were positive to hypersensitivity test with reaction varying ...
78 FR 8435 - Importation of Fresh Citrus Fruit From Uruguay, Including Citrus Hybrids and Fortunella
2013-02-06
...] australis, causal agent of sweet orange scab); and a pathogen (Xanthomonas citri subsp. citri, causal agent... oranges (Citrus sinensis (L.) Osbeck), lemons (C. limon (L.) Burm. f.), four species of mandarins (C... of the reading room). The PRA, titled ``Importation of Fresh Citrus Fruit, including Sweet Orange...
Bacterial leaf spot of lettuce, caused by Xanthomonas campestris pv. vitians, is a devastating disease of lettuce worldwide. Since there are no chemicals available for effective control of the disease, host-plant resistance is highly desirable to protect lettuce production. A total of 179 lettuce ge...
Been, T.H.; Kastelein, P.; Wolf, van der J.M.
2008-01-01
In november 2007 werden twee percelen met aardbeivoortkwekingsmateriaal, natuurlijk geïnfecteerd met X. fragariae, systematisch bemonsterd. Op een plot met een oppervlakte van ca. 100 m2 werden van ca. 120 planten rond een symptomatische plant, de (negen) samengestelde bladeren geanalyseerd op
Directory of Open Access Journals (Sweden)
Suresh Shastry
2005-03-01
Full Text Available An extracellular cell lytic enzyme from Pseudomonas sp. was active on heat killed cells of Xanthomonas campestris. The lytic activity caused enzymatic digestion of X.campestris xanthan gum. Digestion was effective for highly viscous native xanthan 2.0% (w/v and 2.5% (w/v commercial Sigma xanthan. Scanning electron microscopy and SDS-PAGE observations confirmed the cell lytic action on X.campestris cells.Uma enzima extracelular celulolítica produzida por Pseudomonas sp. foi ativa sobre células de Xanthomonas campestris mortas pelo calor. A atividade lítica causou a digestão enzimática de goma xantana de X. campestris. A digestão foi eficiente tanto para xantana nativa altamante viscosa (2,0% w/v como para xantana comercial Sigma (2,5% w/v. Observações por microscopia eletrônica de varredura demonstraram a ação celulolítica sobre células de X. campestris.
Directory of Open Access Journals (Sweden)
Fernanda Chiuso
2005-06-01
Full Text Available INTRODUÇÃO: O anticoagulante lúpico é uma imunoglobulina pertencente à família dos anticorpos antifosfolípides. A sua ação in vitro é interferir nos testes de coagulação dependentes de fosfolípides. O tempo de tromboplastina parcial ativada (TTPA é um teste utilizado como screening na pesquisa do anticoagulante lúpico. Os reagentes utilizados neste teste apresentam grandes variações quanto à sensibilidade. OBJETIVO: Avaliar o desempenho dos reagentes do TTPA e detectar a presença do anticoagulante lúpico através de diferentes testes da coagulação. MATERIAL E MÉTODO: A pesquisa do anticoagulante lúpico foi realizada em 50 amostras plasmáticas de pacientes do sexo feminino através dos testes do TTPA, do tempo de coagulação do caulim (TCC, do tempo de tromboplastina parcial ativada diluída (TTPAd e do tempo do veneno da víbora de Russel diluído (TVVRd. Três cefalinas comerciais foram avaliadas pelos testes do TTPA e do TTPAd. Na comparação entre os reagentes estudados foi aplicado o cálculo do intervalo de confiança (95%. RESULTADOS: Os três reagentes avaliados apresentaram boa concordância e os métodos utilizados responderam bem à pesquisa do anticoagulante lúpico. DISCUSSÃO E CONCLUSÃO: As três cefalinas comerciais avaliadas podem ser utilizadas na rotina laboratorial para a pesquisa do anticoagulante lúpico.INTRODUCTION: The lupus anticoagulant is an immunoglobin which belongs to the antiphospholid antibodies family. Its in vitro function is to interfere with coagulation tests that are dependent on phospholipids. The activated partial thromboplastin time (APTT is a test used as screening on lupus anticoagulant research. Reagents used in this test demonstrate wide sensitivity ranges. OBJECTIVE: To assess the performance of APTT reagents and detect the presence of lupus anticoagulant through various coagulation tests. MATERIAL AND METHOD: The lupus anticoagulant research was performed in plasma from 50
2013-07-19
..., and salts. Xanthan gum is a polysaccharide produced by aerobic fermentation of Xanthomonas campestris...,4-D- Glucose monosaccharide units, the second with a trisaccharide side chain consisting of P-D-Mannose-(1,4)- P-DGlucuronic acid-(1,2)-a-D- Mannose monosaccharide units. The terminal mannose may be...
Pyramiding of blast and bacterial leaf blight resistance genes into ...
African Journals Online (AJOL)
Blast caused by the fungus Magnaporthe oryzae (Hebert) Barr. and bacterial leaf blight (BLB) caused by Xanthomonas oryzae pv. oryzae (Xoo) are two major diseases of rice (Oryza sativa). The use of varietal resistance is the most appropriate strategy for controlling the diseases, and molecular assisted selection can ...
Reaction of Musa balbisiana to Banana bacterial wilt infection ...
African Journals Online (AJOL)
The expression of NPR1, a marker gene of the systemic acquired resistance plant defence system provides preliminary evidence that this may be the major form of resistance in Musa balbisiana to bacterial wilt infection. Keywords: NPR1, PR proteins, Uganda, Xanthomonas campestris. African Crop Science Journal, Vol.
Ambiente educacional y calidad de la docencia en la escuela de medicina
Directory of Open Access Journals (Sweden)
Arnoldo Riquelme Pérez
2007-08-01
La constante medición del ambiente educacional dentro de la Escuela de Medicina nos permitirá a futuro detectar las fortalezas, mejorar las áreas deficitarias y evaluar el impacto de las modificaciones curriculares.
Enfoque ontológico para detectar conceptos holónicos en las organizaciones
Directory of Open Access Journals (Sweden)
Gloria Lucía Giraldo G.
2013-01-01
Full Text Available Actualmente, las organizaciones presentan dificultades para entender el paradigma holónico y más aún, para identificar en sus procesos de producción, la existencia de posibles holones. Existen artefactos como las ontologías y los Esquemas Preconceptuales que permiten representar conocimiento para entender los elementos de un dominio. La literatura actual propone algunas ontologías para representar conceptos holónicos, pero estas ontologías carecen de una integración con los procesos de la organización. Estos procesos organizacionales se encuentran, la mayoría de las veces, escritos en lenguaje natural, el cual por su naturaleza es ambiguo y presenta irregularidades lingüísticas. Los Esquemas Preconceptuales, ayudan a eliminar esas características no deseables del lenguaje natural, representando esos procesos en forma no ambigua. Conocer si una empresa tiene en sus procesos, holones o maneja propiedades holónicas, requiere un análisis complejo por parte de analistas. Este artículo propone una ontología que ayuda a entender qué es un sistema holónico y a conocer si un proceso en una organización, modelado mediante Esquemas Preconceptuales, maneja características holónicas. Este trabajo realiza un acercamiento a la posible implantación de sistemas holónicos en una organización.
Cassava bacterial blight in Africa: the state of knowledge and ...
African Journals Online (AJOL)
Introduced to Africa in the 1970s, cassava bacterial blight caused by Xanthomonas campestris pv. manihotis (XCM) is present in almost all cropping areas. In the past fifteen years, advances have been made in knowledge of the biology and molecular genetics of XCM, host-parasite relationships and epidemiology of the ...
African Journals Online (AJOL)
Abstract. Ten rice cultivars from the International Rice Germplasm Centre originating from Bangladesh were analysedfor the~r genetics of resistance to bacterial blight. The test cultivars were selected on the basis of their high level ofresistance to races IV & VI ofXanthomonas oryzae pv. oryzae. The mode ofinheri- tance was ...
Genetic analysis of Resistance to Rice Bacterial blight in Uganda ...
African Journals Online (AJOL)
A full-diallel mating design involving three resistant and three susceptible rice cultivars was used to produce F1 and F2 progenies in a screen-house at the National Crop Resources Research Institute (NaCRRI), Namulonge in Uganda. The parents and F2 populations were challenged with the Xanthomonas oryzae ...
Identification of bacterial blight resistance genes Xa4 in Pakistani ...
African Journals Online (AJOL)
SERVER
2008-03-04
Mar 4, 2008 ... Bacterial blight (BB) caused by Xanthomonas oryzae pv oryzae (Xoo) is a major biotic constraint in the irrigated rice belts. Genetic resistance is the most effective and economical control for bacterial blight. Molecular survey was conducted to identify the rice germplasm/lines for the presence of Xa4, a.
... diagnosticar mediante análisis rápidos que permiten detectar la presencia o ausencia de anticuerpos contra el virus. En ... transgender people. Key populations often have legal and social issues related to their behaviours that increase vulnerability ...
ANÁLISE DE FALHAS NO PROCESSO LOGÍSTICO DEVIDO A FALTA DE UM CONTROLE DE QUALIDADE
Directory of Open Access Journals (Sweden)
Juliana Barreto
2005-06-01
conformidade dos produtos. A aplicação das Ferramentas da Qualidade Total como o Diagrama de Ishikawa e o Ciclo PDCA foram possíveis detectar os processos que possuem falhas, permitindo a correção. Com essas implantações, os resultados se darão em médio prazo, porém as empresas potencializarão seu diferencial competitivo ao entregarem produtos com baixo índice de avarias. Através de comparações entre duas empresas do ramo moveleiro, foi possível detectar falhas no sistema logístico, para o qual foi sugerida e implantada o Controle de Qualidade, auxiliado pelas ferramentas da Qualidade com o objetivo principal de minimizar os custos decorrentes de danificações de produtos das empresas em estudo.
Directory of Open Access Journals (Sweden)
EMILIA LUCIO GÓMEZ-MAQUEO
2009-01-01
Full Text Available Para detectar adolescentes en riesgo por abuso de sustancias psicoactivas y alcohol es necesario utilizar escalas de tamiza- je, para la canalización terapéutica eficaz. El DAST se ha utilizado para detectar abuso de sustancias psicoactivas; para el abuso de alcohol uno de los más usados es el AUDIT. Para evaluar la confiabilidad, validez y el poder de discriminación en población mexicana del DAST-10y el AUDIT, se realizó un muestreo aleatorio simple estratificado en un plantel de ba- chillerato de Ciudad de México. Ambas escalas se aplicaron a 915 alumnos. Los dos instrumentos resultaron válidos y confiables. Además, fueron sensibles en la identificación del riesgo en consumo de sustancias y alcohol al diferenciar niveles de riesgo entre hombres y mujeres.
Sendín, Lorena Noelia; Orce, Ingrid Georgina; Gómez, Rocío Liliana; Enrique, Ramón; Grellet Bournonville, Carlos Froilán; Noguera, Aldo Sergio; Vojnov, Adrián Alberto; Marano, María Rosa; Castagnaro, Atilio Pedro; Filippone, María Paula
2017-04-01
Transgenic expression of the pepper Bs2 gene confers resistance to Xanthomonas campestris pv. vesicatoria (Xcv) pathogenic strains which contain the avrBs2 avirulence gene in susceptible pepper and tomato varieties. The avrBs2 gene is highly conserved among members of the Xanthomonas genus, and the avrBs2 of Xcv shares 96% homology with the avrBs2 of Xanthomonas citri subsp. citri (Xcc), the causal agent of citrus canker disease. A previous study showed that the transient expression of pepper Bs2 in lemon leaves reduced canker formation and induced plant defence mechanisms. In this work, the effect of the stable expression of Bs2 gene on citrus canker resistance was evaluated in transgenic plants of Citrus sinensis cv. Pineapple. Interestingly, Agrobacterium-mediated transformation of epicotyls was unsuccessful when a constitutive promoter (2× CaMV 35S) was used in the plasmid construction, but seven transgenic lines were obtained with a genetic construction harbouring Bs2 under the control of a pathogen-inducible promoter, from glutathione S-transferase gene from potato. A reduction of disease symptoms of up to 70% was observed in transgenic lines expressing Bs2 with respect to non-transformed control plants. This reduction was directly dependent on the Xcc avrBs2 gene since no effect was observed when a mutant strain of Xcc with a disruption in avrBs2 gene was used for inoculations. Additionally, a canker symptom reduction was correlated with levels of the Bs2 expression in transgenic plants, as assessed by real-time qPCR, and accompanied by the production of reactive oxygen species. These results indicate that the pepper Bs2 resistance gene is also functional in a family other than the Solanaceae, and could be considered for canker control.
Testing Children for Color Blindness
... Stories Español Eye Health / News Testing Children for Color Blindness Leer en Español: Pruebas para Detectar Daltonismo en ... study shows that kids can be tested for color blindness as soon as age 4, finds Caucasian boys ...
African Journals Online (AJOL)
user
that the bacterium was Xanthomonas campestris pv citri A and the disease was a form of citrus canker. The disease incidence ... declined from 88.3% to 1.7% in six years (2009-2014) without the application of any control measure. It was conjectured that .... on yeast nutrient agar in plates using a heat- sterilized inoculation ...
EFFICACITE DE L'HYDROXYDE DE CUIVRE CONTRE LA ...
African Journals Online (AJOL)
Repository Agriculture : 70081962. Idrissou-Touré M. 2014. Test d'efficacité du fongi- cide « IDEFIX 40 WP hydroxyde de cuivre. 65,6 g/100 g » contre la nervation noire du chou causée par Xanthomonas campestris pv. campestris. Mémoire de. Master professionnel en Sciences et. Techniques de Production Végétale, Uni-.
Genetic homogeneity among Ugandan isolates of Xanthomonas ...
African Journals Online (AJOL)
Seven random primers were used because of their ability to amplify reproducible and reliable fingerprints generated between 6 - 12 amplicons each from the Xcm isolates obtained from central core of pseudostems, peduncles, fruit peelings, sap, nectar, insects' bodies and bacterial oozes. Regardless of the source and ...
Relative susceptibility of banana cultivars to Xanthomonas ...
African Journals Online (AJOL)
STORAGESEVER
2009-10-19
Oct 19, 2009 ... African Journal of Biotechnology Vol. 8 (20), pp. 5343-5350, 19 ... and Central Africa. The disease was first reported about. 40 years ago in Ethiopia on Ensete, which is closely related to banana (Yirgou et al., 1968). Outside Ethiopia,. BXW was ... Economic impact of the disease is manifested as result of ...
Identification and characterisation of Xanthomonas campestris pv
African Journals Online (AJOL)
Ednar Wulff
2013-02-06
Feb 6, 2013 ... Race type differentiation tests revealed the Xcc strains from Mozambique as members of race 1. ... However, differentiation of Xcc strains from closely related pathovars that are pathogenic on ..... village leadership, extension service officers and the cabbage growers in the survey area. REFERENCES.
Capítulo 9. Transición del cuidado hospitalario al cuidado ambulatorio
Directory of Open Access Journals (Sweden)
María J. Rodríguez
2016-03-01
Las intervenciones en la transición generalmente son lideradas por una enfermera que está encargada de detectar problemáticas adicionales en torno al paciente y conectarlo con el equipo de manejo multidisciplinario para que continúe su tratamiento al egreso.
ADOLESCENTES EN RIESGO PSICOSOCIAL Y RESILIENCIA
Directory of Open Access Journals (Sweden)
Griselda Cardozo
2009-01-01
Full Text Available El objetivo de la investigación fue detectar las variables individuales y sociales que contribuyen al fortalecimiento del proceso de resiliencia en 210 adolescentes escolarizados de ambos sexos de un nivel socioeconómico bajo, residentes en la ciudad de Córdoba (Argentina. La investigación permitió detectar dos grupos (resilientes- no resilientes, los cuales fueron comparados en relación a las características sociodemográficas y con las variables en estudio. Se observaron diferencias significativas en relación con auto-concepto, soporte social, inteligencia y sucesos estresantes de vida por problemas personales. El análisis realizado a través de la regresión múltiple logística indica que el autoconcepto es la variable mejor predictora de la resiliencia, seguida de soporte social y autorregulación de habilidades (cognitivas- emocionales.
Directory of Open Access Journals (Sweden)
José María López Morales
2016-01-01
Full Text Available En este trabajo se analiza la relación entre la evolución de la demanda del conjunto de la economía española frente a la de los principales componentes de gasto turístico, así como el grado de dependencia respecto al comportamiento económico de los principales países emisores de turistas hacia España. Para investigar la existencia de una relación entre estas variables se explican las principales técnicas de cointegración, que en caso de detectar dicha vinculación permiten estimar modelos de corrección del error. En concreto, en el trabajo se evalúa el comportamiento de estas variables a través de test de raíces unitarias para poder desarrollar modelos que permitan detectar con mayor precisión estas relaciones.
Google trends, una herramienta útil para detectar la presencia de polen atmosférico
DEFF Research Database (Denmark)
Oteros, José; Garcia-Mozo, Herminia; Ørby, Pia Viuf
2015-01-01
Pollinosis is one of the most extended allergies in the world, determining directly the quality of life of the population. Airborne pollen forecasting has become a key objective for allergists and aerobiologists trying to prevent the symptoms of hay fever. Google trends is a tool developed by Goo...
Nuevos métodos bacteriológicos para detectar y evitar la resistencia bacteriana
Directory of Open Access Journals (Sweden)
Margaret Ordoñez-Smith de Danies
2003-09-01
Full Text Available
DEFINICIÓN DE LA RESISTENCIA
De acuerdo al COC (Centro de Control de Enfermedades de Estados Unidos, la resistencia se da cuando un medicamento deja de inhibir el crecimiento o matar un microorganismo.
Hay dos tipos de resistencia la adquirida y la clínica. La adquirida se realiza en el laboratorio a través de las mutaciones o por transferencia de genes, sistemas de conjugación, transducción y transformación.
La resistencia clínica es la observada en la práctica médica, donde no todos los organismos son igualmente sensibles o resistentes a cierto antibiótico y que requiere la ayuda de técnicas de laboratorio para medir cuantitativamente o cualitativamente dicho proceso.
MECANISMOS DE LA RESISTENCIA BACTERIANA
En la detección de la Resistencia Bacteriana se han identificado diferentes mecanismos utilizados por las bacterias: destrucción o inactivación enzimática, cambios en la permeabilidad de la membrana interna, alteraciones de los precursores de la pared celular, de la membrana y de los ribosomas.
Para los años 90 se dispuso de una serie de antimicrobianos como betalactámicos, aminoglucósidos, macrólidos, sulfonamidas, trimetoprim, cloranfenicol, glicopéptidos, rifampicina, quinolonas, tetraciclinas....
Directory of Open Access Journals (Sweden)
César Augusto Morales García
2012-05-01
Full Text Available The aim of thisstudy is to design a psychoeducational procedure in orderto discover and prevent the emotional conflictsin relation to their educational, social and family context. This study was realized with children who were enrolled in first and second grade. The information was collected through projective human figure drawing test. For thisstudy, it was sellected a focus group conformed by 30 children between 6 and 8 years of old who studied in an institution of the Medellin city. The children conformed a nonrandom sample, with dissimilarschool performance, behavior and sociability. Result show emotional indicators in children with low and high school performance. The emphasis for the analysis was put on the classification of active and passive indicators.The procedurewas implemented, generating effective information in order to establish emotional warning indicators as much as for teachers as for educational psychologists.
Google trends, una herramienta útil para detectar la presencia de polen atmosférico
DEFF Research Database (Denmark)
Oteros, José; Garcia-Mozo, Herminia; Ørby, Pia Viuf
2015-01-01
Pollinosis is one of the most extended allergies in the world, determining directly the quality of life of the population. Airborne pollen forecasting has become a key objective for allergists and aerobiologists trying to prevent the symptoms of hay fever. Google trends is a tool developed...... by Google, which provides information about the dynamics of user searches through internet. The main aim of this work is to conduct a preliminary assessment of the usefulness of this tool to detect the presence of large concentrations of pollen in the atmosphere and to explore the impact of pollinosis among...... the population. To achieve these objectives, the analysis is based on data for olive pollen concentrations in the atmosphere of Cordoba (Spain) and search counts in Google of the words "Allergy", "Pollen" and "Olive". We observed a high correlation and a high geographic relationship between the number...
La estructura mediática de México y el caso del Estado de Chihuahua
Mancinas-Chávez, Rosalba
2009-01-01
Los objetivos que nos planteamos como puntos de partida y principios rectores de nuestro trabajo investigador. Pretendemos buscar esas relaciones que se esconden detrás de unas formas explícitas. Bucear en la información para detectar las alianzas que se
Directory of Open Access Journals (Sweden)
Cristina Vedia Urgell
2018-01-01
Conclusiones: El porcentaje de inadecuación es alto. El grado de registro en historia clínica es bajo. La metodología Delphi es útil para detectar discrepancias entre recomendaciones de guías de práctica clínica y resultados.
A grande fuga: como um campo sobreviveu a tempos difíceis
Directory of Open Access Journals (Sweden)
Leon Fink
2012-12-01
Full Text Available O artigo apresenta um balanço da historiografia norte-americana sobre trabalhadores. Após detectar momentos de crise dentro desse campo de pesquisa, aponta os caminhos de recuperação e vitalidade, com novas temáticas e abordagens.
Directory of Open Access Journals (Sweden)
Jeffrey H Lipton
1996-01-01
Full Text Available A 32-year-old female presented with aplastic anemia and subsequently underwent a one-antigen mismatched bone marrow transplant from her brother. She failed to engraft and a second graft was attempted. Protracted neutropenia of three months’ duration despite the use of broad spectrum antibiotics occurred. Stenotrophomonas (Xanthomonas maltophilia metastatic cellulitis developed that did not respond to appropriate antibiotics.
Improvement of xanthan gum production in batch culture using ...
African Journals Online (AJOL)
Yomi
2011-12-21
Dec 21, 2011 ... In this study, the effect of acetic acid on the improvement of xanthan biosynthesis by Xanthomonas campestris b82 was investigated. ... shown that citric acid that is used as a chelating agent in medium to prevent the ... pH value close to the acid pKa) in the medium in one pulse, 30 h after incubation (at the ...
etude de la résistance au flétrissement bactérien de lignées inter
African Journals Online (AJOL)
Administrator
4p. Mew, T. W., Vera Cruz, C. M. and Reyes, R. C.. 1992. Interaction of Xanthomonas campestris pv. oryzae and a resistance Rice Cultivar. Phytopathology 72: 786-789. Ouedraogo, S. L. Somda, I. Boro, F. et Seré, Y. 2004 Détection et caractérisation des bactéries phytopathogènes transmises par les semences du riz au ...
Reconocimiento de Gestos usando Cámaras de Profundidad
JHONSON GARCÍA, FIORELLA ANNETH
2017-01-01
El proyecto pretende detectar un repertorio de gestos a partir de nubes de puntos 3D obtenidas con cámaras de profundidad tipo Kinect. Jhonson García, FA. (2017). Reconocimiento de Gestos usando Cámaras de Profundidad. http://hdl.handle.net/10251/91700 TFGM
Síntomas gastrointestinales en pediatría ¿conducen siempre al verdadero diagnóstico?
Directory of Open Access Journals (Sweden)
Wilson Daza
2016-01-01
Conclusión. El estreñimiento se ubica entre los primeros motivos de consulta y es el primer diagnóstico gastrointestinal directo con una asociación significativa entre ambos. Los profesionales de la salud deben estar atentos para detectar y diagnosticar esta entidad.
Directory of Open Access Journals (Sweden)
MARISOL PÉREZ RAMOS
2009-08-01
Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 Para detectar adolescentes en riesgo por abuso de sustancias psicoactivas y alcohol es necesario utilizar escalas de tamizaje, para la canalización terapéutica eficaz. El DAST-10 se ha utilizado para detectar abuso de sustancias psicoactivas; para el abuso de alcohol uno de los más usados es el AUDIT. Para evaluar la confiabilidad, validez y el poder de discriminación en población mexicana del DAST-10 y el AUDIT, se realizó un muestreo aleatorio simple estratificado en un plantel de bachillerato de Ciudad de México. Ambas escalas se aplicaron a 915 alumnos. Los dos instrumentos resultaron válidos y confiables. Además, fueron sensibles en la identificación del riesgo en consumo de sustancias y alcohol al diferenciar niveles de riesgo entre hombres y mujeres.
Directory of Open Access Journals (Sweden)
Guy Blomme
2017-07-01
Full Text Available Bacterial diseases of bananas and enset have not received, until recently, an equal amount of attention compared to other major threats to banana production such as the fungal diseases black leaf streak (Mycosphaerella fijiensis and Fusarium wilt (Fusarium oxysporum f. sp. cubense. However, bacteria cause significant impacts on bananas globally and management practices are not always well known or adopted by farmers. Bacterial diseases in bananas and enset can be divided into three groups: (1 Ralstonia-associated diseases (Moko/Bugtok disease caused by Ralstonia solanacearum and banana blood disease caused by R. syzygii subsp. celebesensis; (2 Xanthomonas wilt of banana and enset, caused by Xanthomonas campestris pv. musacearum and (3 Erwinia-associated diseases (bacterial head rot or tip-over disease Erwinia carotovora ssp. carotovora and E. chrysanthemi, bacterial rhizome and pseudostem wet rot (Dickeya paradisiaca formerly E. chrysanthemi pv. paradisiaca. Other bacterial diseases of less widespread importance include: bacterial wilt of abaca, Javanese vascular wilt and bacterial fingertip rot (probably caused by Ralstonia spp., unconfirmed. This review describes global distribution, symptoms, pathogenic diversity, epidemiology and the state of the art for sustainable disease management of the major bacterial wilts currently affecting banana and enset.
Directory of Open Access Journals (Sweden)
Kátia Regina Freitas Schwan-Estrada
2006-06-01
sido afetada por doenças a exemplo da podridão negra causada por Xanthomonas campestris pv. campestris, fomentando novas pesquisas para seu controle. Com o objetivo de verificar o potencial de Mikania glomerata no controle dessa doença, a tintura etanólica 50 oGL dessa planta medicinal foi avaliada quanto: atividade ntimicrobiana in vitro através do crescimento bacteriano em tubos de ensaio contendo 100, 250, 500 e 1000 mg L-1 da tintura; indução de resistência local ou sistêmica em plantas de couve-flor aos 25 dias de idade, em casa de vegetação, através da pulverização de tintura oncomitantemente e três dias antes da inoculação com o patógeno, sendo água e calda bordaleza tratamentos controle; atividade de peroxidases em folhas tratadas e não tratadas de couve-flor, colhidas concomitantemente e as 24, 48 e 72 h da pulverização da tintura e, após pulverizaçãoinoculação. A tintura etanólica, in vitro, promoveu inibição no crescimento bacteriano, a partir da concentração de 250 mg L-1. Nas concentrações de 500 mg L-1 e 1000 mg L-1 foram observadas, respectivamente, 24% e 38% de inibição do crescimento bacteriano. Nas plantas de couve-flor foi observada redução da doença apenas em folhas tratadas com 100 e 500 mg L-1 de tintura, plicada concomitantemente à inoculação, comportamento este semelhante ao da calda bordaleza, ndicando que o controle através da tintura de guaco é através de atividade antimicrobiana direta. Ficou indicado que a indução de peroxidases ocorreu devido ao processo infeccioso e não em função dos tratamentos com tintura etanólica de guaco. Estes resultados indicam o potencial da tintura de guaco para o controle preventivo da podridão negra em couve-flor.
Vigilancia de la presencia de triatominos mediante gallineros en el sur de Jalisco, México
Directory of Open Access Journals (Sweden)
José Alejandro Martínez-Ibarra
2010-03-01
Conclusiones. Los gallineros se consideran una herramienta útil para detectar la presencia de ejemplares de M. longipennis, aunque no funcionaron para T. barberi. Se confirma la importancia de M. longipennis y se establece el posible rol primario de T. barberi como vector en el área de estudio.
JPRS Report, Science & Technology, USSR: Life Sciences.
1987-06-29
MEDITSINSKAYA BIOTEKHNOLOGIYA, No 11, Nov 85) 20 Xanthomonas Campestris Pv. Oryzae, Rice Seed Bacteriosis Pathogen in the Ukraine (I.B, Koroleva...ethylene, and are active in a series of bioassays on auxins, gibberellins and cytokinins. Nevertheless, according to the character of their biological...CAMPESTRIS PV. ORYZAE, RICE SEED BACTERIOSIS PATHOGEN IN THE UKRAINE Kiev MIKROBIOLOGICHESKIY ZHURNAL in Russian Vol 47, No 6, Nov-Dec 85 (manuscript
Foliar Application of the Fungicide Pyraclostrobin Reduced Bacterial Spot Disease of Pepper
Beom Ryong Kang; Jang Hoon Lee; Young Cheol Kim
2018-01-01
Pyraclostrobin is a broad-spectrum fungicide that inhibits mitochondrial respiration. However, it may also induce systemic resistance effective against bacterial and viral diseases. In this study, we evaluated whether pyraclostrobin enhanced resistance against the bacterial spot pathogen, Xanthomonas euvesicatora on pepper (Capsicum annuum). Although pyraclostrobin alone did not suppressed the in vitro growth of X. euvesicatoria, disease severity in pepper was significantly lower by 69% after...
Wang, Jun; Zeng, Xuan; Tian, Dongsheng; Yang, Xiaobei; Wang, Lanlan; Yin, Zhongchao
2018-03-30
Transcription activator-like effector (TALE)-dependent dominant disease resistance (R) genes in plants, also referred to as executor R genes, are induced on infection by phytopathogenic bacteria of the genus Xanthomonas harbouring the corresponding TALE genes. Unlike the traditional R proteins, the executor R proteins do not determine the resistance specificity and may function broadly in different plant species. The executor R gene Bs4C-R in the resistant genotype PI 235047 of the pepper species Capsicum pubescens (CpBs4C-R) confers disease resistance to Xanthomonas campestris pv. vesicatoria (Xcv) harbouring the TALE genes avrBsP/avrBs4. In this study, the synthetic genes of CpBs4C-R and two other Bs4C-like genes, the susceptible allele in the genotype PI585270 of C. pubescens (CpBs4C-S) and the CaBs4C-R homologue gene in the cultivar 'CM334' of Capsicum annum (CaBs4C), were characterized in tobacco (Nicotiana benthamiana) and rice (Oryza sativa). The Bs4C genes induced cell death in N. benthamiana. The functional Bs4C-eCFP fusion proteins were localized to the endoplasmic reticulum (ER) membrane in the leaf epidermal cells of N. benthamiana. The Xa10 promoter-Bs4C fusion genes in transgenic rice conferred strain-specific disease resistance to Xanthomonas oryzae pv. oryzae (Xoo), the causal agent of bacterial blight in rice, and were specifically induced by the Xa10-incompatible Xoo strain PXO99 A (pHM1avrXa10). The results indicate that the Bs4C proteins from pepper species function broadly in rice and the Bs4C protein-mediated cell death from the ER is conserved between dicotyledonous and monocotyledonous plants, which can be utilized to engineer novel and enhanced disease resistance in heterologous plants. © 2018 TEMASEK LIFE SCIENCES LABORATORY. MOLECULAR PLANT PATHOLOGY © 2018 JOHN WILEY & SONS LTD.
Directory of Open Access Journals (Sweden)
Stella Maris Batallés
2009-01-01
Full Text Available La técnica diagnóstica óptima para detectar tromboembolismo pulmonar agudo (TEP continúa en discusión. La gammagrafía pulmonar de ventilación/perfusión ha sido el examen preferido durante décadas, pero con el advenimiento de nuevas pruebas de imágenes las posibilidades diagnósticas se ampliaron, siendo necesario evaluarlas desde la perspectiva del coste y de la efectividad. El objetivo de este trabajo fue evaluar distintos métodos de diagnóstico por imagen para detectar TEP agudo para determinar el más coste-efectivo. Métodos. Análisis de coste-efectividad (CE empleando un árbol de decisiones para modelar distintas pruebas (centellograma V/Q, TC helicoidal, angiografía por tomografía computada multidetector (TCMD, resonancia magnética por imágenes (RMI y arteriografía convencional. Se obtuvieron valores de sensibilidad, especificidad, valor predictivo positivo (VPP y negativo (VPN de las pruebas diagnósticas. Resultado medido: "caso detectado de TEP". Los costes evaluados fueron los directos, expresados en euros (t, incluyendo los secundarios a las complicaciones de los métodos diagnósticos. Se realizó un análisis de sensibilidad de una vía para evaluar la robustez de las conclusiones. Resultados. No se eliminaron pruebas por dominancia extendida. La tasa cruda de CE para TCMD fue de 486 t por cada caso de TEP detectado. El coste marginal entre la TC helicoidal y el centellograma V/Q fue de 103 t para detectar 8 casos adicionales de TEP, mientras que el coste marginal entre la TCMD y la TC helicoidal fue de 229 t para detectar un caso adicional de TEP. Conclusiones. La prueba diagnóstica más coste-efectiva fue la TCMD, hallazgo que mostró robustez en el análisis de sensibilidad. Sin embargo, el análisis de C-E incremental nos mostró que la TCMD costó 229 t más respeto a la TC helicoidal para lograr una mínima mejora en la efectividad de la prueba (detección de TEP agudo. El alto valor predictivo negativo de
Directory of Open Access Journals (Sweden)
A. Jiménez Aceituna
2012-04-01
Conclusiones: El cierre de CIA a corazón latiendo es una técnica segura y efectiva. El control, mediante Invos®, de la oxigenación cerebral es una herramienta útil como indicador de perfusión cerebral y un método fiable para detectar embolias gaseosas.
Natural occurrence and pathogenicity of Xanthomonas bacteria on ...
African Journals Online (AJOL)
Tuoyo Aghomotsegin
2016-09-28
Sep 28, 2016 ... The analysis of variance for incubation period and disease incidence revealed significant ... has been implicated in threatening the crop enset. (Ensete ... the spear (youngest emerging leaf) or one or more of the young leaves ...
Two-dimensional profiling of Xanthomonas campestris pv. viticola ...
African Journals Online (AJOL)
However, the analysis of the 2D-PAGE gel images revealed a larger number of spots in the lysis method when compared to the others. Taking ... Keywords: Bacterial canker, Vitis vinifera, proteomics, sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), two-dimensional gel electrophoresis (2D-PAGE).
Host induced changes in plasmid profile of Xanthomonas ...
African Journals Online (AJOL)
Based on known facts about genome rearrangement, we speculate this as an adaptation strategy for Xam to increase copy number of genes involved in pathogen aggressiveness which are otherwise present as single copy in bacterial chromosome and this possibly occurred by induction from host elicitors present in leaf ...
Directory of Open Access Journals (Sweden)
Marcela López
2011-03-01
Conclusiones. La experiencia con el ensayo de nitrato reductasa demuestra que produce resultados resistentes confiables. El uso de cultivos envejecidos conduciría a una mayor proporción de resultados falsos sensibles, mientras que su capacidad para detectar multirresistencia disminuye a consecuencia de una mayor proporción de resultados no interpretables.
Directory of Open Access Journals (Sweden)
Jenniffer Rodiño
2011-03-01
Conclusiones. Ambas coloraciones son útiles para diagnosticar neumonía por P. jirovecii en muestras de lavado broncoalveolar. Sin embargo, el azul de toluidina no detecta, aproximadamente, el 12 % de los casos positivos por inmunofluorescencia. Las muestras de lavado orofaríngeo no son apropiadas para detectar microscópicamente P. jirovecii.
Mechanism of action and selective toxicity of ascamycin, a nucleoside antibiotic.
Osada, H; Isono, K
1985-01-01
An unidentified Streptomyces sp. produces two nucleoside antibiotics, ascamycin and its dealanyl derivative. In contrast to the broad antibacterial activity of dealanylascamycin against various gram-negative and gram-positive bacteria, ascamycin showed selective toxicity against Xanthomonas citri and X. oryzae. Both ascamycin and dealanylascamycin inhibited the protein synthesis of X. citri, but only dealanylascamycin inhibited that of Escherichia coli. In cell-free systems from E. coli and X...
Directory of Open Access Journals (Sweden)
Elkin Flórez
2009-01-01
Full Text Available Uno de los problemas comunes que se presentan en las ruedas de los trenes, es la presencia de planos. Éstos generan un impacto suficiente como para afectar el funcionamiento normal del tren. La detección temprana de planos en las ruedas permite realizar las correcciones necesarias (tornear la superficie de la rueda a fin de evitar daños a los componentes del tren que degraden la prestación del servicio a los usuarios. Aunque existen muchos sensores de vibración en el mercado para detectar vibraciones generadas por el paso de un tren, no hay aún una herramienta estándar que permitan detectar la presencia de planos en las ruedas del mismo. Este estudio presenta la selección apropiada de una ventana temporal para utilizar la Transformada de Fourier en Tiempos Cortos (STFT, por sus siglas en inglés en el análisis de señales de vibración, tomadas al pie del carril y generadas al paso de un tren, que permita determinar la presencia de dichos planos. Para ello, en primer lugar se generó, utilizando la herramienta Matlab, una señal que simule la presencia de un plano y que permita conocer como la STFT, implementando diferentes ventanas temporales (Rectangular, Gauss, Hanning y Chebyshev, permite descubrir la presencia del mismo, en el dominio conjunto tiempo-frecuencia. Seguidamente, se aplica la STFT a señales tomadas en campo. Los resultados obtenidos demuestran que la STFT es una herramienta efectiva para detectar planos en la rueda de los trenes, si la función ventana y sus parámetros se seleccionan correctamente al realizar un análisis tiempo-frecuencia.
Directory of Open Access Journals (Sweden)
Miguel E. Arechavaleta-Velasco
2011-01-01
Full Text Available Este estudio se realizó para detectar loci de rasgos binarios (BTL que influyen en la expresión del comportamiento higiénico de abejas obreras y para localizar marcadores genéticos asociados a estos BTL en un mapa de ligamiento. Se recolectaron abejas que realizaron el comportamiento higiénico y abejas que no realizaron el comportamiento higiénico de una colonia producto de una retrocruza. Se construyó un mapa genético utilizando marcadores AFLP generados a partir del ADN de las abejas que realizaron el comportamiento higiénico. Se realizó una prueba de bondad de ajuste a cada marcador del mapa para detectar desviaciones en el patrón de segregación esperado (1,1. Los marcadores que presentaron desviaciones significativas del patrón de segregación esperado en las abejas que realizaron el comportamiento higiénico, se generaron en el grupo de abejas que no realizó el comportamiento. Los marcadores que presentaron desviaciones en el patrón de segregación esperado en las abejas que realizaron el comportamiento higiénico pero no en el grupo que no realizó el comportamiento, se sometieron a una prueba de homogeneidad para detectar asociaciones entre el marcador y la expresión del comportamiento higiénico. Doce de los marcadores presentaron desviaciones en el patrón de segregación en las abejas que realizaron el comportamiento (P0.05, y nueve de los marcadores estuvieron asociados a la expresión del comportamiento higiénico (P<0.05. Los nueve marcadores genéticos representan siete BTL que influyen en la expresión del comportamiento higiénico de las abejas.
Directory of Open Access Journals (Sweden)
Paula Andrea Báez
2016-08-01
Conclusión. Este estudio permitió detectar la presencia del HAV en 6,6 % de las muestras de agua de abastecimiento y en 13,3 % de las muestras de agua residual de los municipios en estudio. Se reporta por primera vez la circulación del subgenotipo IA en muestras ambientales en Antioquia.
Oliván, M.C. (María); Guerrero, Luis
2012-01-01
Este trabajo trata del seguimiento para la formación de un panel de análisis sensorial aplicado a la carne de vacuno. Se basa en un conjunto de técnicas que permiten valorar las propiedades de los alimentos, es decir, los atributos de alos alimentos que se pueden detectar por los sentidos.
Directory of Open Access Journals (Sweden)
Carmona, M. A.
2015-09-01
Full Text Available Authenticating fats and detecting their adulteration with substantially cheaper fats can pose major problems for producers of high-value oils for nutritional and cosmetic use. In this work, we used Raman spectroscopy to discriminate macadamia and pecan oils from other, cheaper vegetable oils including corn and sunflower oils. This technique additionally allows one to detect and assess the adulteration of macadamia oil with another vegetable oil.La autentificación de grasas para detectar su adulteración con otras grasas más baratas es uno de los principales problemas a los que se enfrentan los productores de aceites de alto valor, ya sea para uso alimentario o para uso cosmético. En este trabajo se emplea la espectroscopia Raman, por un lado, para caracterizar los aceites de macadania y de nuez pecanera, de alto valor y diferenciarlos de otros más baratos, como los de maíz y de girasol, y por otro, para detectar mezclas del aceite de macadamia con estos aceites vegetales más baratos.
A microbially derived tyrosine-sulfated peptide mimics a plant peptide hormone.
Pruitt, Rory N; Joe, Anna; Zhang, Weiguo; Feng, Wei; Stewart, Valley; Schwessinger, Benjamin; Dinneny, José R; Ronald, Pamela C
2017-07-01
The biotrophic pathogen Xanthomonas oryzae pv. oryzae (Xoo) produces a sulfated peptide named RaxX, which shares similarity to peptides in the PSY (plant peptide containing sulfated tyrosine) family. We hypothesize that RaxX mimics the growth-stimulating activity of PSY peptides. Root length was measured in Arabidopsis and rice treated with synthetic RaxX peptides. We also used comparative genomic analyses and reactive oxygen species burst assays to evaluate the activity of RaxX and PSY peptides. Here we found that a synthetic sulfated RaxX derivative comprising 13 residues (RaxX13-sY), highly conserved between RaxX and PSY, induces root growth in Arabidopsis and rice in a manner similar to that triggered by PSY. We identified residues that are required for activation of immunity mediated by the rice XA21 receptor but that are not essential for root growth induced by PSY. Finally, we showed that a Xanthomonas strain lacking raxX is impaired in virulence. These findings suggest that RaxX serves as a molecular mimic of PSY peptides to facilitate Xoo infection and that XA21 has evolved the ability to recognize and respond specifically to the microbial form of the peptide. © 2017 UT-Battelle LLC. New Phytologist © 2017 New Phytologist Trust.
A maize resistance gene functions against bacterial streak disease in rice
Zhao, Bingyu; Lin, Xinghua; Poland, Jesse; Trick, Harold; Leach, Jan; Hulbert, Scot
2005-01-01
Although cereal crops all belong to the grass family (Poacea), most of their diseases are specific to a particular species. Thus, a given cereal species is typically resistant to diseases of other grasses, and this nonhost resistance is generally stable. To determine the feasibility of transferring nonhost resistance genes (R genes) between distantly related grasses to control specific diseases, we identified a maize R gene that recognizes a rice pathogen, Xanthomonas oryzae pv. oryzicola, wh...
Inhibition of Plant-Pathogenic Bacteria by Short Synthetic Cecropin A-Melittin Hybrid Peptides
Ferre, Rafael; Badosa, Esther; Feliu, Lidia; Planas, Marta; Montesinos, Emili; Bardají, Eduard
2006-01-01
Short peptides of 11 residues were synthesized and tested against the economically important plant pathogenic bacteria Erwinia amylovora, Pseudomonas syringae, and Xanthomonas vesicatoria and compared to the previously described peptide Pep3 (WKLFKKILKVL-NH2). The antimicrobial activity of Pep3 and 22 analogues was evaluated in terms of the MIC and the 50% effective dose (ED50) for growth. Peptide cytotoxicity against human red blood cells and peptide stability toward protease degradation wer...
TUMORES CEREBRALES ASOCIADOS A EPILEPSIA
Directory of Open Access Journals (Sweden)
Dr. Manuel G. Campos
2017-05-01
La Resonancia Magnética de cerebro es mandatoria en el estudio de todo paciente con epilepsia, para detectar lesiones estructurales, especialmente en epilepsia focal. Alrededor del 30% de los pacientes operados de epilepsia refractaria presentan tumores. En estos casos el control de crisis post-operatorio llega hasta un 70% en el seguimiento a largo plazo.
Directory of Open Access Journals (Sweden)
Diego Batalla
2016-11-01
Clindamicina y trimetoprim-sulfametoxazol son opciones terapéuticas para S.aureus. En los casos con resistencia a eritromicina es necesario detectar resistencia inducible a clindamicina. En los niños asistidos en el Centro Hospitalario Pereira Rossell la resitencia inducible a clindamicina no resulta un problema. Estos hallazgos necesitan ser complementados con estudios multicentricos.
... Estos tipos de exámenes se realizan para detectar estados tales huesos rotos, daños de los tejidos blandos y artritis. El médico le ... en interpretar las imágenes médicas de diagnóstico. Después de que el ... los resultados y conversará con usted sobre qué procedimientos adicionales ...
El título con tipografía Presidencia Firme 36 pts alineado a la derecha
International Development Research Centre (IDRC) Digital Library (Canada)
.
equidad de género al diseño, operación y evaluación de sus programas ... promover el desarrollo social y económico de México. ... pobreza extrema en el desarrollo de sus capacidades. • Educación. • Salud ... Generación y difusión de estudios e investigaciones. ... desarrollar proyectos para prevenir, detectar y atender la.
Detección precoz del cancer de mama, la mamografía y el autoexamen
Abella Calle, José; Fundación Valle de Lili
2001-01-01
Problemática mundial/ ¿Qué causa el cáncer de mama?/Factores de riesgo/ ¿Cómo podemos detectar precozmente el cáncer de mama?/ ¿Qué es la mamografía?/La ecografía en el estudio de las mamas/Los rayos X y el cáncer/El autoexamen de las mamas.
Tomografía computada cone beam en articulación témporo mandibular (ATM
Directory of Open Access Journals (Sweden)
DR. B. Andrés Briner
2014-09-01
El propósito del presente artículo es exponer imágenes de alta resolución obtenidas mediante la técnica de Cone Beam, mostrando la elevada capacidad que esta técnica tiene para detectar cambios óseos morfológicos sutiles, que permiten el diagnóstico de las diversas etapas del proceso óseo degenerativo.
Bandeira, Juliana de Magalhães; Marini, Patrícia; Borba, Isabel Cristina Gouvea de; Martins, Andrea Bicca Noguez; Amarante, Luciano do; Moraes, Dario Munt de
2014-01-01
We aimed to differentiate the vigor of soybean seeds through antioxidant enzyme activity (superoxide dismutase-SOD, ascorbate peroxidase-APX, and catalase- CAT) and relate them to the viability and vigor standard tests to verify if these enzymes detect tenuous differences in seed vigor. The following tests were performed: germination, fi rst germination count, germination speed index, initial growth of seedlings, electrical conductivity, and respiratory and enzymatic activity. It was only pos...
Directory of Open Access Journals (Sweden)
César Augusto Morales García
2012-07-01
Full Text Available El objetivo del presente estudio es diseñar un procedimiento psicoeducativo, que permita descubrir y prever los conflictos emocionales en relación con el contexto educativo, social y familiar de los niños de primero y segundo de primaria, a través de la prueba proyectiva del dibujo de figura humana. Para este estudio se seleccionó un grupo focal de 30 niños varones de 6 a 8 años de edad en una institución de la ciudad de Medellín. La muestra no probabilística contó con niños disímiles en su desempeño escolar, conducta y sociabilidad. Dentro de este estudio se encontraron indicadores emocionales tanto en niños con bajo y alto desempeño escolar; se hizo énfasis en clasificar los indicadores pasivos y activos. El procedimiento psicoeducativo se implementó y produjo una información eficaz de indicadores de alerta emocional, tanto para docentes como para psicólogos escolares. © Revista Colombiana de Ciencias Sociales.
Directory of Open Access Journals (Sweden)
María S Touzon
Full Text Available Durante el embarazo se producen frecuentemente infecciones del tracto genital inferior asociadas a complicaciones maternas y perinatológicas. El objetivo del trabajo fue evaluar la disfunción vaginal mediante el análisis de los estados vaginales básicos (EVB por la metodología del balance del contenido vaginal (BACOVA y compararlo con el estudio microbiológico convencional en el diagnóstico de candidiasis, tricomonosis y vaginosis bacteriana (VB. Entre 2010 y 2012 se estudiaron 1238 pacientes embarazadas; 1046 eran asintomáticas (A y 192 sintomáticas (S. La prevalencia del EVB I fue del 59,5 % y 26 %, respectivamente. El EVB II se observó en 19,7 % de las mujeres A y en 17,2 % de las S. El EVB III se detectó solamente en las A, en 0,4 %. El EVB IV se observó en 14,4 % de las A y en 38 % de las S. El EVB V se detectó en 6 % de las A y en 18,8 % de las S. En las mujeres A, las levaduras se asociaron a los EVB I y II en el 55,5 % y 23,2 % de los casos, respectivamente; entre las S, alcanzaron el 32,4 % y 31 % de los casos, en igual orden. Las tricomonas se asociaron al EVB I en el 50 % de las A, al EVB IV en el 44,4 % de las S y al EVB V en el 33,3 % de las S. La sensibilidad del BACOVA para detectar levaduras fue 80,4 % en las A y 85,5 % en las S; para detectar tricomonas, del 40 % y 75 %, y para detectar VB, del 100 % en los dos grupos. La especificidad del BACOVA fue 100 % para todos los patógenos en las A y en las S. El estudio de los EVB resultó útil para orientar el diagnóstico a la disfunción vaginal, independientemente de la sintomatología, por lo que se sugiere este estudio como parte del control prenatal. Durante el embarazo se producen frecuentemente infecciones del tracto genital inferior asociadas a complicaciones maternas y perinatológicas. El objetivo del trabajo fue evaluar la disfunción vaginal mediante el análisis de los estados vaginales básicos (EVB por la metodología del balance del contenido vaginal
Directory of Open Access Journals (Sweden)
Rosemary Corrêa Costa
2017-05-01
e as avaliações foram realizadas pela contagem do número de colônias do patógeno. Nos ensaios em casade-vegetação a aplicação dos tratamentos foi realizada 7 dias antes da inoculação de X. axonopodis pv. passiflorae para as formulações e extratos e 2 dias antes da inoculação para os produtos químicos. As avaliações de severidade da doença foram realizadas em intervalos de 48 horas. Os produtos oxitetraciclina, fluazinam, mancozeb, oxicloreto de cobre, Fitoforce Cobre e Fitoforce Plus inibiram totalmente o crescimento in vitro da bactéria. Em casa-de-vegetação, todos os tratamentos reduziram significativamente a severidade da mancha bacteriana com reduções entre 54 e 62%, com exceção do Fitoforce Plus que apresentou porcentagem de controle abaixo de 50%.
Fields, Francisco R; Carothers, Katelyn E; Balsara, Rashna D; Ploplis, Victoria A; Castellino, Francis J; Lee, Shaun W
2018-06-01
Bacteriocins hold unprecedented promise as a largely untapped source of antibiotic alternatives in the age of multidrug resistance. Here, we describe the first approach to systematically design variants of a novel AS-48 bacteriocin homologue, which we have termed safencin AS-48, from Bacillus safensis, to gain insights into engineering improved activity of bacteriocins. A library of synthetic peptides in which systematic amino acid substitutions to vary the periodicity and abundance of polar, acidic, aliphatic, and hydrophobic residues were generated for a total of 96 novel peptide variants of a single bacteriocin candidate. Using this method, we identified nine synthetic safencin (syn-safencin) variants with broad and potent antimicrobial activities with minimal inhibitory concentrations (MIC) as low as 250 nM against E. coli, P. aeruginosa, X. axonopodis, and S. pyogenes with minimal cytotoxicity to mammalian cells. It is anticipated that the strategies we have developed will serve as general guides for tuning the specificity of a given natural bacteriocin compound for therapeutic specificity.
Sha, A H; Lin, X H; Huang, J B; Zhang, D P
2005-07-01
DNA methylation is known to play an important role in the regulation of gene expression in eukaryotes. The rice cultivar Wase Aikoku 3 becomes resistant to the blight pathogen Xanthomonas oryzae pv. oryzae at the adult stage. Using methylation-sensitive amplified polymorphism (MSAP) analysis, we compared the patterns of cytosine methylation in seedlings and adult plants of the rice cultivar Wase Aikoku 3 that had been inoculated with the pathogen Xanthomonas oryzae pv. oryzae, subjected to mock inoculation or left untreated. In all, 2000 DNA fragments, each representing a recognition site cleaved by either or both of two isoschizomers, were amplified using 60 pairs of selective primers. A total of 380 sites were found to be methylated. Of these, 45 showed differential cytosine methylation among the seedlings and adult plants subjected to different treatments, and overall levels of methylation were higher in adult plants than in seedlings. All polymorphic fragments were sequenced, and six showed homology to genes that code for products of known function. Northern analysis of three fragments indicated that their expression varied with methylation pattern, with hypermethylation being correlated with repression of transcription, as expected. The results suggest that significant differences in cytosine methylation exist between seedlings and adult plants, and that hypermethylation or hypomethylation of specific genes may be involved in the development of adult plant resistance (APR) in rice plants.
Toxicity of twenty-two plant essential oils against pathogenic bacteria of vegetables and mushrooms.
Todorović, Biljana; Potočnik, Ivana; Rekanović, Emil; Stepanović, Miloš; Kostić, Miroslav; Ristić, Mihajlo; Milijašević-Marčić, Svetlana
2016-12-01
ASBTRACT Toxicity of twenty-two essential oils to three bacterial pathogens in different horticultural systems: Xanthomonas campestris pv. phaseoli (causing blight of bean), Clavibacter michiganensis subsp. michiganensis (bacterial wilt and canker of tomato), and Pseudomonas tolaasii (causal agent of bacterial brown blotch on cultivated mushrooms) was tested. Control of bacterial diseases is very difficult due to antibiotic resistance and ineffectiveness of chemical products, to that essential oils offer a promising alternative. Minimal inhibitory and bactericidal concentrations are determined by applying a single drop of oil onto the inner side of each plate cover in macrodilution assays. Among all tested substances, the strongest and broadest activity was shown by the oils of wintergreen (Gaultheria procumbens), oregano (Origanum vulgare), and lemongrass (Cymbopogon flexuosus. Carvacrol (64.0-75.8%) was the dominant component of oregano oils, while geranial (40.7%) and neral (26.7%) were the major constituents of lemongrass oil. Xanthomonas campestris pv. phaseoli was the most sensitive to plant essential oils, being susceptible to 19 oils, while 11 oils were bactericidal to the pathogen. Sixteen oils inhibited the growth of Clavibacter michiganensis subsp. michiganensis and seven oils showed bactericidal effects to the pathogen. The least sensitive species was Pseudomonas tolaasii as five oils inhibited bacterial growth and two oils were bactericidal. Wintergreen, oregano, and lemongrass oils should be formulated as potential biochemical bactericides against different horticultural pathogens.
El consumo mediático de los estudiantes del Grado de Periodismo. ¿Uso lúdico o profesional?
Directory of Open Access Journals (Sweden)
Marta REDONDO
2017-01-01
Full Text Available El consumo mediático de los jóvenes es un indicador interesante para anticipar tendencias de uso de los medios de comunicación. Los estudiantes universitarios del área de la comunicación son un público especialmente atractivo para explorar estas preferencias. A partir del diagnóstico sobre el consumo mediático de los estudiantes del Grado de Periodismo de la Universidad de Valladolid (España realizado mediante el método de la encuesta, se celebraron tres grupos focalizados con el fin de detectar patrones dominantes de comportamiento en su relación con los medios, así como indagar en sus motivaciones y valoraciones respecto a la profesión periodística. Los resultados ponen en evidencia la centralidad de Internet en su dieta mediática, un espacio en el que convergen los medios convencionales y las redes sociales digitales. La progresiva especialización adquirida durante la formación universitaria convierte a estos estudiantes en un público crítico con su propio consumo, capaz de detectar fortalezas y debilidades en el ecosistema mediático.
SISTEMA DE VISIÓN SINÉRGICO PARA DETECCIÓN DE MOVIMIENTO
Directory of Open Access Journals (Sweden)
MA. TERESA GARCÍA RAMÍREZ
2010-01-01
Full Text Available La detección de movimiento en sistemas de vigilancia y monitoreo se ve favorecida por la combinación sinérgica de diferentes tipos de cámaras y su óptima distribución sobre el área de interés. Se propone un modelo de optimización para un sistema de visión sinérgico basado en programación lineal entera. Los objetivos son encontrar la posición y orientación óptima de cada una de las cámaras direccionales y omnidireccionales con el fin de maximizar la cobertura del espacio de trabajo y detectar los objetos en movimiento presentes. Para detectar eficientemente el movimiento, incluso ante cambios de luminosidad globales, se utiliza un algoritmo de substracción de fondo que usa la información espacial de la textura. El método propuesto se evalúa en un conjunto representativo de escenarios reales utilizando una red de cámaras. Los resultados muestran que nuestro algoritmo es capaz de determinar el número mínimo de cámaras necesario para cubrir un área determinada.
Directory of Open Access Journals (Sweden)
María Mercedes Chacara Montes
2015-06-01
Full Text Available Esta investigación de la Enseñanza de la Geometría se desarrolla con un estudio exploratorio de profesores de Matemáticas de secundaria. Su objetivo es detectar creencias y concepciones del profesor, respecto al concepto de isometría en particular el de “reflexión”. Para detectar creencias y concepciones del profesor fue necesario adecuar un modelo teórico que nos permitiera diseñar un instrumento diagnóstico y nuestra intervención. El diseño del modelo se basó en la teoría de Van Hiele y la Taxonomía SÓLO (Estructura del resultado observado del aprendizaje, denominándolo “Niveles de Razonamiento-Calidad”. Se realizó un análisis cuantitativo y cualitativo de los resultados obtenidos encontrando variables relacionadas con la Formación Profesional y el manejo de los conceptos del profesor, por lo que recurrimos a la Técnica Multivariante por Discriminante. Las isometrías representan un reto en su enseñanza porque además de la dificultad teórica de los conceptos relacionados está implicado el movimiento.
Lectura literaria juvenil: los clubes de lectura como entornos de investigación
Directory of Open Access Journals (Sweden)
Taísa Dantas
2017-01-01
Full Text Available El presente artículo se centra en el uso de los clubes de lectura en investigaciones realizadas con lectores jóvenes (entre 13 y 18 años, a partir del modelo utilizado por la Fundación Germán Sánchez Ruipérez en el proyecto BeatlePad (Territorio Ebook. En él se comprueba la influencia que los clubes de lectura ejercen en lectura de los jóvenes, realizando además un seguimiento de las mismas en sus entornos naturales. La metodología utilizada es de carácter cualitativo, con entrevistas semiestructuradas y análisis de la documentación generada en el desarrollo del proyecto. Se parte de la hipótesis de que los clubes de lectura revisten una importancia capital desde el punto de vista de la dinamización de la misma, pero también como objeto de estudio para detectar todos los elementos nucleares que subyacen en el desarrollo de las prácticas lectoras. Al mismo tiempo, la investigación con estas entidades permite aflorar elementos transversales que habitualmente son difíciles de detectar.
Uso de zangões (Apis mellifera L. na detecção de cera de abelha adulterada
Directory of Open Access Journals (Sweden)
Maurizete da Cruz Silva
2000-12-01
Full Text Available Esta pesquisa avaliou a habilidade de zangões da abelha africanizada (Apis mellifera L. em detectar cera de abelha adulterada usando o reflexo da extensão da probóscide (PER. Duzentos e quarenta zangões foram divididos em 12 grupos contendo níveis diferentes de cera de abelha adulterada (100% cera de abelha, 90% cera de abelha, 10% cera de abelha, 0% cera de abelha. Um estímulo de ar foi incluído como testemunha devido à possível influência do fluxo de ar per se. Os animais foram mantidos em tubos de metal, acondicionados com fita adesiva Ducktape® entre a cabeça e o tórax. Os resultados da performance dos zangões no condicionamento olfativo do PER indicam que esses animais são capazes de detectar níveis diferentes de cera de abelha adulterada. Os zangões mostraram melhor resposta ao tratamento contendo 100% de cera de abelha. Esse bioensaio pode servir de ferramenta alternativa na seleção de lotes de cera de abelha na apicultura e indústria.
Banana Xanthomonas wilt: a review of the disease, management ...
African Journals Online (AJOL)
... a review of the disease, management strategies and future research directions. ... Plants are infected either by insects through the inflorescence or by ... wilt is not fully understood but its impact on food security in the region is very significant.
Species-specific PCR primers for detection of Xanthomonas vesicatoria
Czech Academy of Sciences Publication Activity Database
Beran, P.; Mráz, Ivan
2013-01-01
Roč. 43, Jan (2013), s. 213-215 ISSN 0261-2194 R&D Projects: GA MZe QH71229 Institutional support: RVO:60077344 Keywords : Bacterial spot * Tomato * Pepper Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.539, year: 2013
DEFF Research Database (Denmark)
Herschend, Jakob; Damholt, Zacharias Brimnes Visby; Marquard, Andrea Marion
2017-01-01
Microbial biofilms are omnipresent in nature and relevant to a broad spectrum of industries ranging from bioremediation and food production to biomedical applications. To date little is understood about how multi-species biofilm communities develop and function on a molecular level, due...... of fermentation and nitrogen pathways in Paenibacillus amylolyticus and Xanthomonas retroflexus may, however, indicate that competition for limited resources also affects community development. Overall our results demonstrate the multitude of pathways involved in biofilm formation in mixed communities....
Roberts, P. D.; Rouse, R. E.; Teems, S. S.; Sytsma, R. E.; Shobert, Z.
2014-01-01
Huanglongbing (HLB) was detected in Florida in 2005 and has reached 100% incidence in certain citrus plantings in southwest Florida. The putative causal agent of HLB in Florida is the bacterium Candidatus Liberibacter asiaticus (CLa). Citrus canker caused by the bacterium Xanthomonas citri subsp. citri is endemic in Florida. In 2011 and 2012, fruit drop on young ‘Hamlin’ trees with symptoms of HLB and/or citrus canker was particularly severe, with more than 90% fruit drop recorded. Nutritio...
Fungus diseases of poplar that pose a threat to Italy
Energy Technology Data Exchange (ETDEWEB)
Castellani, E.; Cellerino, G.P.; Garibaldi, A.
1981-01-01
European Economic Community Directive No. 7793 on the exchange of, and trade in, plant material between member countries specified Hypoxylon mammatum, Mycosphaerella populorum, Melampsora medusae and Xanthomonas populi as the causal agents of serious poplar diseases the introduction of which into Italy should be avoided. Information is given on the geographic distribution, morphology and biology of the four pathogens, together with notes on the symptoms of attack, host plants and damage caused. Control measures to avoid their introduction and spread are suggested.
International Nuclear Information System (INIS)
Malik, M.A.; Shaukat, G.A.; Ahmed, M.S.
1990-01-01
Three types of antibiotics S, X and F characteristically bioactive against staphylococcic, xanthomonas and fungi are elaborated by Bacillus Subtilis AECL 69 when grown in molasses peptone malt extract sucrose. No antibiotic production was observed when molasses was omitted from the growth medium. A mineral salt mixture was devised that could replace molasses and restore the production of antibiotics. Influence of various carbohydrates on the production of antibiotics was also studied. Mannose and mannitol had inhibitory effect on the antibiotic production. (author)
Energy Technology Data Exchange (ETDEWEB)
Mohs Alfaro, Monica
2011-07-01
The CD34 marker is used as immunohistochemistry technique to detect and differentiate between the hepatocellular adenoma of the hepatocellular carcinoma. The liver lesions are described. The hepatic angiogenesis is explained [Spanish] El marcador CD34 es usado como tecnica de inmunohistoquimica para detectar y diferenciar entre el adenoma hepatocelular del carcinoma hepatocelular. La lesiones en el higado son descritas. La angiogenesis hepatica es explicada.
Directory of Open Access Journals (Sweden)
Katerina Klímová
2016-03-01
Discusión. Los resultados del estudio confirmaron que el espectro microbiológico de las infecciones bacterianas en pacientes con cirrosis ha sufrido importantes cambios. Las infecciones por gérmenes multirresistentes causan infecciones con gran morbimortalidad y el fracaso del tratamiento antibiótico habitual. Para controlarlas de forma eficaz, es imprescindible detectar precozmente a aquellos pacientes con factores de riesgo.
Directory of Open Access Journals (Sweden)
Catalina Marceló
2014-12-01
Conclusión. Se estableció la línea base de la mortalidad frente a tres insecticidas en una cepa sensible del vector L. longipalpis. Estos indicadores permitirán establecer comparaciones con poblaciones del vector expuestas regular o esporádicamente a medidas de control químico y detectar, así, cambios en la sensibilidad de esta especie a los insecticidas.
Directory of Open Access Journals (Sweden)
Janice Izabel Druzian
2007-03-01
Full Text Available Goma xantana é um heteropolissacarídeo hidrosolúvel, produzida industrialmente por fermentação da sacarose por Xanthomonas campestris. Suas excelentes propriedades reológicas contribuem para o grande número de aplicações na indústria de alimentos e recuperação terciária de petróleo. Economicamnte a utilização petroquímica não é ainda viável em função do custo da sacarose, o que torna interessante estudar fontes de carbonos alternativas, como é o caso do resíduo do suco de maçã. As cepas de Xanthomonas campestris pv maniothis foram mantidas em agar YM a 4 °C, e o inóculo foi incubado em meio YM. A produção de goma foi realizada nos meios fermentativos I e II, com sacarose como fonte de carbono padrão, e como fonte alternativa o resíduo de maçã fuji. A fermentação em Incubadora/28 °C/150 rpm produziu goma precipitada em álcool. A condição otimizada de 45 g.L-1 de meio II (0,05% uréia, 0,5% de KH2PO4 e 70% de resíduo representou um rendimento 10 vezes maior do que o obtido com sacarose. Por CG-EM obteve-se 44,53% de manose, 34,76% de glicose e 20,71% de ácido glucurônico para a composição desta goma. O uso de resíduo de maçã para produção de goma xantana é viável porque pode ser usado com um substrato suplementar e apresentar rendimento de goma muito superior ao obtido com sacarose.Xanthan gum is heteropolysaccharide aquosoluble produced industrially for fermentation with sucrose by Xanthomonas campestris. Excellent gum rheological properties contribute to the use in a wide range of applications in the food industry and tertiary recovery of oil. Commercially, the use of petrochemical is no longer viable in the cost of sucrose, which makes it interesting to evaluate alternative carbon sources such as the residue from apple juice processing. The Xanthomonas campestris pv maniothis was maintained at 4 °C on YM agar slants and innocuous in a medium of YM. Gum production was carried out in
Directory of Open Access Journals (Sweden)
Adriana Pabón
2007-06-01
Conclusiones. La prueba Binax NOW® malaria ICT Pf/Pv como prueba diagnóstica mostró una sensibilidad muy baja para infecciones por P. falciparum y su capacidad para detectar parasitemias menores de 500 parásitos/ul es mínima. Como diagnóstico confirmatorio, la prueba ICT P.f/P.v. tiene buena sensibilidad para P. falciparum. Su uso para seguimiento de los pacientes no se recomienda.
Directory of Open Access Journals (Sweden)
Montserrat Gómez de Terreros Guardiola
2017-11-01
Discusión: Se ha obtenido un cuestionario breve, de fácil aplicación, fiable en cuanto a su consistencia interna y sensible para detectar diferencias en las dimensiones de satisfacción hospitalaria. Una vez terminada su validación, servirá para evaluar la satisfacción de los menores con su estancia hospitalaria, además de ser un potencial indicador de calidad asistencial.
Directory of Open Access Journals (Sweden)
María Consuelo Miranda
2006-09-01
Resultados. Los altos porcentajes de resistencia reportados en especial para A. baumannii, corroboraron la presencia de bacterias multirresistentes en las UCI en las instituciones participantes durante el periodo de estudio. Conclusiones. Es urgente crear una red nacional de vigilancia de la resistencia a antimicrobianos de los patógenos hospitalarios y de esta manera mejorar nuestra habilidad para detectar, supervisar y manejar la resistencia a antimicrobianos en Colombia.
Estudio de técnicas de inserción de marcas de agua sobre software
Jaimez Moruno, Marc
2008-01-01
Este trabajo es un estudio de las distintas técnicas de software watermarking existentes para la protección de la propiedad intelectual contenida en un programa. Partiendo de este estudio se propone una implementación para usar técnicas watermarking en la protección de agentes móviles. Concretamente se implementa una solución para detectar ejecuciones deshonestas por parte de host maliciosos
Microflora en semillas de frijol
Directory of Open Access Journals (Sweden)
Jos\\u00E9 B. Membre\\u00F1o
2001-01-01
Full Text Available Microflora en semillas de frijol (Phaseolus vulgaris L.. Se estudió la microflora bacteriana presente en semillas de frijol y su relación con Xanthomonas campestris pv. phaseoli (Xcp, en 118 genotipos procedentes de VIDAC-98, INTA- Nicaragua, TARS-USDA e Isabela-P.R. Se utilizaron cinco métodos de aislamiento: semilla desinfectada con hipoclorito de sodio, semilla en caldo nutritivo refrigerada por una hora, dispersión de 0,1 ml de suspensión de semillas en medio sólido, siembra líquida de 1 ml de suspensión y semilla en caldo nutritivo, agitado y refrigerado por 24 horas. Se aislaron 104 colonias amarillas de 41 genotipos. Treinta y seis colonias fueron KOH positivo (Gram negativo, 68 negativo (Gram positivo y 34 hidrolizaron almidón. Las colonias de pigmentación amarilla resultaron no patogénicas bajo condiciones de invernadero. Estas se identificaron con el sistema BIOLOG como: Pantoea agglomerans (25, Xanthomonas campestris (2, Enterobacter agglomerans (2, Sphingomonas paucimobilis (2, Pseudomonas fluorescens y Flavimonas oryzihabitans. En adición, los genotipos portaron colonias con pigmentación distinta a la amarilla. En las pruebas de antagonismo se identificaron colonias con actividad de deoxyribonucleasa y de antibiosis a Xcp. De éstas, 15 colonias inhibieron a Xcp significativamente. Se identificaron los hongos Rhizoctonia solani, Penicillium spp., Fusarium spp., Aspergillus flavus, Rhizopus nigricans y Macrophomina phaseolina en un 52,9 % del total de genotipos evaluados
Añez Reverol, Nestor Oswaldo; Romero, Maximiliano; Crisante R., Gladys E.; Bianchi Pérez, Guillermo Ricardo; Parada F., Henry
2011-01-01
Publicado en el Boletín de Malariología y Salud Ambiental Vol. L, Nº 1, Enero-Julio, 2010 Se presenta la valoración comparativa de 8 técnicas de uso común en el despistaje serológico de la enfermedad de Chagas utilizando muestras de pacientes de diversas procedencias del occidente de Venezuela. En el estudio fueron utilizados métodos serológicos convencionales (TAD, IFI, ELISA) y pruebas de diagnóstico comercialmente expendidas en el país (Pharmatest®, Chagatest ELISA®, Chagatest ELISA Rec...
La metacognición como estrategia para detectar procesos cognitivos en niños con retraso mental
Directory of Open Access Journals (Sweden)
Ana Patricia Vázquez-Chaves
2006-06-01
Full Text Available Abstract. It was planned to detect the cognitive processes that mentally retarded children used when solving math problems, through the use or metacognitive strategies. The work was done whit a sample of twenty mentally retarded children that attend integrated classrooms from de provinces of Heredia and Alajuela. An instrument called Batería de Resolución de Situaciones Matemáticas (BARSIMAR was used to detect the cognitive processes that children used when working with metacognitive strategies. The results show that the more cognitive engaged the children are, the more difficulty they will have when using cognitive processes to register the information in the short term memory. The advanced kids could use the processes in a better way, but with interferences and difficulty to recover the information form the long term memory and give correct answers to the cognitive task they are working on.
La metacognición como estrategia para detectar procesos cognitivos en niños con retraso mental
Vázquez-Chaves, Ana Patricia; León-Rodríguez, María Suzanne; Rodríguez-Ramírez, María Judith
2006-01-01
Abstract. It was planned to detect the cognitive processes that mentally retarded children used when solving math problems, through the use or metacognitive strategies. The work was done whit a sample of twenty mentally retarded children that attend integrated classrooms from de provinces of Heredia and Alajuela. An instrument called Batería de Resolución de Situaciones Matemáticas (BARSIMAR) was used to detect the cognitive processes that children used when working with metacognitive ...
Martín, María P.; García-Figueres, F.; Trapero, Antonio
2002-01-01
Colletotrichum acutatum y C. gloeosporioides son los agentes causantes de la antracnosis de los olivos en España. En este trabajo se presentan los iniciadores específicos diseñados que, junto con el iniciador general ITS4, permiten discriminar a ambas especies mediante la reacción en cadena de la polimerasa (PCR). Colletotrichum acutatum and C. gloeosporioides are the causal agents of the anthracnose on olive trees from Spain. In this work, the specific primers designed to discriminate bo...
Directory of Open Access Journals (Sweden)
Alberto Gómez Gutierrez
2003-09-01
prestigioso Instituto Gustave Roussy de Investigación del Cáncer y, coincidencialmente, del edificio Gustave Roussydel Hospital Cochin en el que yo mismo hice mi doctorado, el doctor Ordóñez hizo una brillante carrera de fisiólogo, en la tradición que iniciara en Francia Claude Bernard (1813-1878...
Directory of Open Access Journals (Sweden)
Adrían Cabedo Nebot
2010-06-01
Full Text Available Resumen: En el ámbito académico es posible que, en determinadas circunstancias y por diferente finalidad, se requiera la elaboración de un informe descriptivo sobre un caso de plagio o de atribución de autoría. Esta tarea debe realizarla un lingüista perfectamente formado y que, en el momento de redactar su análisis, posea una metodología compacta y sistemática. Este artículo, en tal sentido, esboza un protocolo de actuación, mediante el uso de algunas herramientas informáticas que facilitan la detección del plagio en el marco académico.Summary: In an academic environment it is possible that, under certain circumstances and for different purposes, some kind of descriptive report on a case of plagiarism or attribution will be required. This task must be performed by a fully trained linguist and, at the time of writing his analysis, this one should apply a compact and a systematic methodology. This article, in this sense, outlines an action protocol, using some tools that facilitate the detection of plagiarism in an academic framework.
Directory of Open Access Journals (Sweden)
Lorena Manzini Marchesi
2015-01-01
Full Text Available El paisaje rural del departamento de Maipú se caracteriza por una heterogeneidad integradora y un dinamismo activo, propio de la actividad productiva agrícola. e ste posee elementos que clarifican su carácter, pero otros que contribuyen a su banalización. En este marco, el presente artículo plantea la reflexión sobre cuál es el límite que existe entre los nuevos elementos en los paisajes rurales producto del proceso evolutivo de adaptación a los cambios económicos, técnicos y sociales de la época y la banalización del paisaje; y también, cómo poder detectar los elementos que están transformando el carácter del paisaje al punto de la banalización en un marco paisajístico dinámico y de heterogeneidad. Ante ello, se sostiene como hipótesis que la dimensión histórica del paisaje permite detectar y enfrentar a la banalización del mismo, ya que la relación conceptual dimensión histórica versus banalización del paisaje puede ser empleada como una herramienta para su análisis.
NITSCHKE,Marcia; RODRIGUES,Vanessa; SCHINATTO,Lisiane Fiorio
2001-01-01
A goma xantana é um polissacarídeo microbiano de grande significado comercial especialmente para a indústria de alimentos. O objetivo deste trabalho foi avaliar a produção de xantana em diferentes meios de cultura à base de soro de leite utilizando o isolado Xanthomonas campestris C7L. Dentre as formulações testadas o meio de soro de leite integral produziu maior viscosidade e concentração final de xantana. Um sistema combinando soro integral (0,35% de proteína) e soro filtrado (0,18%de prote...
Kang, In Jeong; Kang, Mi-Hyung; Noh, Tae-Hwan; Shim, Hyeong Kwon; Shin, Dong Bum; Heu, Suggi
2016-01-01
Burkholderia glumae (bacterial grain rot), Xanthomonas oryzae pv. oryzae (bacterial leaf blight), and Acidovorax avenae subsp. avenae (bacterial brown stripe) are major seedborne pathogens of rice. Based on the 16S and 23S rDNA sequences for A. avenae subsp. avenae and B. glumae, and transposase A gene sequence for X. oryzae pv. oryzae, three sets of primers had been designed to produce 402 bp for B. glumae, 490 bp for X. oryzae, and 290 bp for A. avenae subsp. avenae with the 63°C as an opti...
The genetic variance of resistance in M3 lines of rice against leaf blight disease
International Nuclear Information System (INIS)
Mugiono
1979-01-01
Seeds of Pelita I/1 rice variety were irradiated with 20, 30, 40 and 50 krad of gamma rays from a 60 Co source. Plants of M 3 lines were inoculated with bacterial leaf blight, Xanthomonas oryzae (Uzeda and Ishiyama) Downson, using clipping method. The coefficient of genetic variability of resistance against leaf blight disease increased with increasing dose. Highly significant difference in the genetic variance of resistance were found between the treated samples and the control. Dose of 20 krad gave good probability for selection of plants resistant against leaf blight disease. (author)
Directory of Open Access Journals (Sweden)
Lucía Echevarría Lucas
2016-09-01
Los linfocitos CD4+ T, leucocitos, macrófagos y granulocitos, con la producción de sus mediadores interferón gamma, IL-12 o TNF-α son fundamentales para controlar al Mycobacterium tuberculosis. Por ello, antes de introducir Interferón beta 1b, convendría realizar técnicas de screening, como la prueba de Mantoux o el interferon gamma release assay–(quantiferon-TB para detectar posibles tuberculosis latentes potencialmente activables.
Directory of Open Access Journals (Sweden)
Assumpta Ferrer
2014-11-01
La prevalencia de envejecimiento satisfactorio es elevada en personas de 86 años en la comunidad. La escasa actividad física multiplica por 7 la asociación a envejecimiento no satisfactorio, y la debilidad muscular por 6. Por ello, incorporar el cribado dirigido a detectar estos 2 factores podría mejorar intervenciones posteriores hacia un envejecimiento más óptimo, si estos resultados se confirman en futuros estudios.
Tuberculosis cutánea por mesoterapia, estudio de seis casos
Directory of Open Access Journals (Sweden)
Dora Orjuela
2010-09-01
Conclusiones. Se demostró una nueva forma de adquirir la tuberculosis cutánea. Esta es la segunda demostración de tuberculosis cutánea por mesoterapia en Colombia. El estudio de las lesiones de la piel en el sitio de la inyección cutánea debe incluir pruebas para detectar micobacterias, entre ellas M. tuberculosis. Las autoridades sanitarias deben prestar atención y prevenir esta modalidad de adquirir la tuberculosis.
Rendimiento escolar: un acercamiento cualitativo
Herrera García, Esperanza; Martínez García, Inés
1988-01-01
El objetivo de esta investigación fue detectar variables asociadas al rendimiento escolar, mediante una evaluación cualitativa de un grupo de alumnos de diferente rendimiento escolar. Este trabajo se puede encuadrar dentro de una línea de investigación cualitativa sobre el rendimiento escolar. En esta perspectiva, entre otros, destacar los trabajos de Mikusinski y Flores (1985): López, Marqués y Martínez (1985).
Rendimiento escolar: Un acercamiento cualitativo
Directory of Open Access Journals (Sweden)
Inés MARTÍNEZ GARCÍA
2009-11-01
Full Text Available El objetivo de esta investigación fue detectar variables asociadas al rendimiento escolar, mediante una evaluación cualitativa de un grupo de alumnos de diferente rendimiento escolar. Este trabajo se puede encuadrar dentro de una línea de investigación cualitativa sobre el rendimiento escolar. En esta perspectiva, entre otros, destacar los trabajos de Mikusinski y Flores (1985: López, Marqués y Martínez (1985.
Mendes,Lívia Rodrigues; Teixeira,Maria Luiza de Oliveira; Ferreira,Márcia de Assunção
2010-01-01
Investigación que trata sobre los significados del uso que hacen los adolescentes del alcohol. Objetivos: Identificar el significado los adolescentes le atribuyen al consumo de bebidas alcohólicas; Caracterizar la cantidad y los principales locales de consumo de estas bebidas; Detectar factores de riesgos y/o tendencia relacionadas con este consumo. Metodología: cualitativa, convergente asistencial, relacionada con cuidado-educación. Se aplicó un instrumento de entrevista, semi-estructurado, ...
Directory of Open Access Journals (Sweden)
L. Galli
2008-03-01
Full Text Available Escherichia coli productor de toxina Shiga es un patógeno emergente cuyo principal factor de virulencia son las toxinas Shiga (Stx, codificadas por los genes stx. Estas toxinas se clasifican en 6 tipos (1, 2, 2c, 2d, 2e y 2f que agrupan a 22 variantes. En Argentina se validaron dos técnicas de PCR para la detección de los genes stx, PCR-MK y PCR múltiple. Los objetivos del trabajo fueron analizar mediante el uso de herramientas bioinformáticas la capacidad de dichas técnicas para detectar las variantes del gen stx y demostrar experimentalmente la amplificación de 8 variantes stx. Se recopilaron 25 secuencias nucleotídicas de la base de datos GenBank correspondientes a 21 variantes de stx. Se utilizó el programa BLAST 2 sequences para analizar la complementariedad de las bases nucleotídicas entre las secuencias de las variantes y las secuencias de los cebadores utilizados en las PCR estudiadas. La técnica de PCR-MK permite detectar los tipos stx1, stx2, stx2c, stx2d y stx2f, aunque no permite detectar el tipo stx2e y tres variantes del tipo stx2c. La PCR múltiple permite detectar los tipos stx1, stx2, stx2c, stx2d, pero no los tipos stx2e y stx2f. Se demostró experimentalmente que ambas técnicas de PCR son apropiadas para la detección de las variantes que están asociadas a enfermedad grave en el hombre.Shiga toxin-producing Escherichia coli is an emergent pathogen, being the Shiga toxin (Stx the main virulence factor. These toxins are classified into 6 types (1, 2, 2c, 2d, 2e and 2f and 22 variants. In Argentina, two PCR for stx gene detection, PCR-MK and multiplex-PCR, were validated. The aim of this work was to analyze, by using bioinformatic tools, the stx variants that could be amplified by these PCRs, and to experimentally show the amplification of 8 stx variants. Twentyfive nucleotide sequences were collected from GenBank corresponding to 21 stx variants. The BLAST 2 sequences program was used to analyze the
Valoración Mediante Ultrasonidos de la Función Ventricular Izquierda en el Infarto de Miocardio.
Moreno Alba, Rafael
2017-01-01
Desde siempre nos ha preocupado el estudio de la función ventricular en cierto tipo de pacientes. Buscábamos afanosamente, métodos clínicos incruentos y fácilmente repetibles a la cabecera del enfermo, que nos pudieran detectar cuando comienza a declinar un miocardio, para en un paso siguiente poder instaurar la terapéutica oportuna, precoz y eficazmente. Al principio todas nuestras investigaciones fueron dirigidas hacia el campo de la Fonomecanoc...
Directory of Open Access Journals (Sweden)
Mirta Soijet
2017-06-01
En términos de resultados, este análisis socio-espacial posibilita detectar la evolución de una serie de procesos que ameritan ser profundizados, como la continuidad de un tránsito hacia un modelo de organización con indicios de la integración de nuevas áreas a la aglomeración y, a la vez, la consolidación de algunos subcentros metropolitanos, con capacidad de influencia en la estructura integral.
Detection of Salmonella sp in pork carcasses in slaughterhouses in Lima, Peru
Salvatierra R, Guillermo; Pinto J, Chris; Inga E, Edwin; Siuce M, Juan; Calle E, Sonia
2015-01-01
El objetivo del presente estudio fue detectar la frecuencia de Salmonella sp, median- te técnicas de aislamiento, en carcasas porcinas destinadas al consumo humano. Se muestrearon 300 carcasas beneficiadas en dos camales de Lima Metropolitana, Perú. Las muestras fueron tomadas mediante hisopados sobre la piel de la cabeza, vientre, lomo y pierna, representando en total 1200 submuestras. Estas fueron transportadas al laborato- rio en tubos Falcon con agua peptonada tamponada, donde fueron proc...