WorldWideScience

Sample records for deputy administrator lori

  1. 7 CFR 7.29 - Delegation of authority to Deputy Administrator.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Delegation of authority to Deputy Administrator. 7.29... STABILIZATION AND CONSERVATION STATE, COUNTY AND COMMUNITY COMMITTEES § 7.29 Delegation of authority to Deputy... any such office, county executive director, or other county employee, for any and all of the reasons...

  2. LORIS: A web-based data management system for multi-center studies.

    Directory of Open Access Journals (Sweden)

    Samir eDas

    2012-01-01

    Full Text Available LORIS (Longitudinal Online Research and Imaging System is a modular and extensible web-based data management system that integrates all aspects of a multi-center study: from heterogeneous data acquisition (imaging, clinical, behavior, genetics to storage, processing and ultimately dissemination. It provides a secure, user-friendly, and streamlined platform to automate the flow of clinical trials and complex multi-center studies. A subject-centric internal organization allows researchers to capture and subsequently extract all information, longitudinal or cross-sectional, from any subset of the study cohort. Extensive error-checking and quality control procedures, security, data management, data querying and administrative functions provide LORIS with a triple capability (i continuous project coordination and monitoring of data acquisition (ii data storage/cleaning/querying, (iii interface with arbitrary external data processing pipelines. LORIS is a complete solution that has been thoroughly tested through the full life cycle of a multi-center longitudinal project# and is now supporting numerous neurodevelopment and neurodegeneration research projects internationally.

  3. 28 CFR 49.4 - Deputy custodians.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Deputy custodians. 49.4 Section 49.4 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) ANTITRUST CIVIL PROCESS ACT § 49.4 Deputy custodians. Deputy custodians may perform such of the duties assigned to the custodian as may be authorized...

  4. Sexual Dimorphism in Lori Sheep Vomeronasal Organ dimensions ...

    African Journals Online (AJOL)

    This experiment was carried out to study the effect of gender on anatomy of vomeronasal organ (VNO) and their correlations with some external body measurements in Lori sheep. Six external body characteristics were measured on 21 Lori sheep (10 ewes and 11 rams). Heads of the animals were collected and several ...

  5. 28 CFR 0.15 - Deputy Attorney General.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Deputy Attorney General. 0.15 Section 0... the Deputy Attorney General § 0.15 Deputy Attorney General. (a) The Deputy Attorney General is authorized to exercise all the power and authority of the Attorney General, unless any such power or...

  6. 9 CFR 72.18 - Movement interstate; specification by the Deputy Administrator, Veterinary Services of treatment...

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Movement interstate; specification by the Deputy Administrator, Veterinary Services of treatment required when dipping facilities..., Veterinary Services of treatment required when dipping facilities unavailable. (a) Tick-infested cattle...

  7. 18th May 2011 - Chinese State Administration of Foreign Experts Affairs (SAFEA) Deputy Director-General M. LU (State Council of China) in the ATLAS visitors centre with Collaboration Deputy Spokesperson A. Lankford and Collaboration member Z. Ren.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    18th May 2011 - Chinese State Administration of Foreign Experts Affairs (SAFEA) Deputy Director-General M. LU (State Council of China) in the ATLAS visitors centre with Collaboration Deputy Spokesperson A. Lankford and Collaboration member Z. Ren.

  8. CEPF Western Ghats Special Series: Moolah, misfortune or spinsterhood? The plight of Slender Loris Loris lydekkerianus in southern India

    Directory of Open Access Journals (Sweden)

    A. Kanagavel

    2013-01-01

    Full Text Available In this communication, we document the local knowledge, attitudes and perceptions of slender lorises among the indigenous Kani community in the southern Western Ghats; document new records of Loris lydekkerianus lydekkerianus in the Agasthyamalai Hills; and discuss in detail a poorly known threat to these primates. Although not kept as pets due to their physical appearance, and belief that they would bring bad luck, the Kani community however captured slender lorises for wildlife photographers. Similar instances of loris abuse in various parts of south India were revealed upon analyzing photographs from a popular internet-based wildlife photography site. We recommend that strict guidelines be formulated for photographing lorises, and suggest that novel and ethical tourism initiatives be set up involving local communities to cater to wildlife photographers and tourists.

  9. 5 CFR 2638.204 - Deputy ethics official.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Deputy ethics official. 2638.204 Section 2638.204 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency Ethics Official § 2638.204...

  10. Mad, bad and dangerous to know: the biochemistry, ecology and evolution of slow loris venom.

    Science.gov (United States)

    Nekaris, K Anne-Isola; Moore, Richard S; Rode, E Johanna; Fry, Bryan G

    2013-09-27

    Only seven types of mammals are known to be venomous, including slow lorises (Nycticebus spp.). Despite the evolutionary significance of this unique adaptation amongst Nycticebus, the structure and function of slow loris venom is only just beginning to be understood. Here we review what is known about the chemical structure of slow loris venom. Research on a handful of captive samples from three of eight slow loris species reveals that the protein within slow loris venom resembles the disulphide-bridged heterodimeric structure of Fel-d1, more commonly known as cat allergen. In a comparison of N. pygmaeus and N. coucang, 212 and 68 compounds were found, respectively. Venom is activated by combining the oil from the brachial arm gland with saliva, and can cause death in small mammals and anaphylactic shock and death in humans. We examine four hypotheses for the function of slow loris venom. The least evidence is found for the hypothesis that loris venom evolved to kill prey. Although the venom's primary function in nature seems to be as a defense against parasites and conspecifics, it may also serve to thwart olfactory-orientated predators. Combined with numerous other serpentine features of slow lorises, including extra vertebra in the spine leading to snake-like movement, serpentine aggressive vocalisations, a long dark dorsal stripe and the venom itself, we propose that venom may have evolved to mimic cobras (Naja sp.). During the Miocene when both slow lorises and cobras migrated throughout Southeast Asia, the evolution of venom may have been an adaptive strategy against predators used by slow lorises as a form of Müllerian mimicry with spectacled cobras.

  11. 28 CFR 59.5 - Functions and authorities of the Deputy Assistant Attorneys General.

    Science.gov (United States)

    2010-07-01

    ... Assistant Attorneys General. 59.5 Section 59.5 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED... authorities of the Deputy Assistant Attorneys General. The functions and authorities of the Deputy Assistant Attorneys General set out in this part may at any time be exercised by an Assistant Attorney General, the...

  12. 28 CFR 16.71 - Exemption of the Office of the Deputy Attorney General System-limited access.

    Science.gov (United States)

    2010-07-01

    ... Attorney General System-limited access. 16.71 Section 16.71 Judicial Administration DEPARTMENT OF JUSTICE....71 Exemption of the Office of the Deputy Attorney General System—limited access. (a) The following... of the Office of the Deputy Attorney General (JUSTICE/DAG-013). (d) In addition, the Drug Enforcement...

  13. The Deputy Principal Instructional Leadership Role and Professional Learning: Perceptions of Secondary Principals, Deputies and Teachers

    Science.gov (United States)

    Leaf, Ann; Odhiambo, George

    2017-01-01

    Purpose: The purpose of this paper is to report on a study examining the perceptions of secondary principals, deputies and teachers, of deputy principal (DP) instructional leadership (IL), as well as deputies' professional learning (PL) needs. Framed within an interpretivist approach, the specific objectives of this study were: to explore the…

  14. 10 CFR 455.153 - Review by the Deputy Assistant Secretary.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Review by the Deputy Assistant Secretary. 455.153 Section 455.153 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION GRANT PROGRAMS FOR SCHOOLS AND HOSPITALS AND BUILDINGS OWNED BY UNITS OF LOCAL GOVERNMENT AND PUBLIC CARE INSTITUTIONS Administrative Review § 455.153...

  15. Assistant/Deputy Principals: What Are Their Perceptions of Their Role?

    Science.gov (United States)

    Shore, Kevin; Walshaw, Margaret

    2018-01-01

    The roles and aspirations of Assistant/Deputy Principals (AP/DPs) have received attention for a number of decades. In contrast to much of the reported research that either highlights the administrative and management tasks or foregrounds principal succession, we explore levels of satisfaction that play into DP/APs' interpretations of the realities…

  16. Improving diet and activity of insectivorous primates in captivity: Naturalizing the diet of Northern Ceylon gray slender loris, Loris lydekkerianus nordicus.

    Science.gov (United States)

    Williams, Emma; Cabana, Francis; Nekaris, K A I

    2015-01-01

    Data on in-situ diet and nutritional requirements should inform the provision of food to captive insectivorous primates. Despite the growing availability of such information an over-reliance on commercially available primate foods and fruit continues in many captive establishments. Wild slender lorises are almost exclusively insectivorous, yet captive conspecifics are fed a primarily frugivorous diet that is likely to contribute to behavioral and health problems. We investigated the effect of naturalizing diet in the Northern Ceylon grey slender loris (Loris lydekkerianus nordicus) by providing live insect prey to a captive group of five individuals. We calculated activity budgets in accordance with six established categories and recorded positional behaviors. We collected data over 30 hours for each of three conditions: pre-enrichment, enrichment, post-enrichment. We hypothesized that increased opportunity for the display of natural behaviors would be stimulated by the dietary enrichment of live insects and made the following predictions; 1) Percentage time spent foraging would increase and time spent inactive would decrease; 2) behavioral repertoires would increase; 3) foraging patterns would be more constant over time with reduced feeding-time peaks. We analyzed time budget and behavioral changes using Friedman tests. We found significant changes in activity budgets with inactivity reduced and foraging levels increased to levels seen in wild slender lorises. We found a significant increase in postures used in foraging and a wider behavioral repertoire. We discuss the benefits of providing free-ranging live food in relation to enhancing the temporal-spatial distribution of food acquisition, satisfying nutritional requirements, balancing energy intake, and expenditure, expanding sensory stimulation, and promoting behavioral competence. We discuss our findings in relation to other insectivorous primates. © 2015 Wiley Periodicals, Inc.

  17. 31 CFR 0.105 - Deputy Ethics Official.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Deputy Ethics Official. 0.105 Section... EMPLOYEE RULES OF CONDUCT General Provisions Responsibilities § 0.105 Deputy Ethics Official. The Chief Counsel or Legal Counsel for a bureau, or a designee, is the Deputy Ethics Official for that bureau. The...

  18. 39 CFR 4.4 - Deputy Postmaster General.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Deputy Postmaster General. 4.4 Section 4.4 Postal... described at 39 U.S.C. 202(d), 203. The Deputy Postmaster General shall act as Postmaster General during the.... The Governors set the compensation and benefits of the Deputy Postmaster General, subject to 39 U.S.C...

  19. Sobre a obscenidade inocente: o caderno Rosa de Lori Lamby, de Hilda Hilst

    Directory of Open Access Journals (Sweden)

    Luciana Borges

    2006-01-01

    Full Text Available From this text gender construction and pornography on female literature may be discussed. By reading O caderno rosa de Lori Lamby, not only the ancient prejudice over the erotic literature (what transforms written pornography into outraging political act but the way society assemble the idea that eroticism and sexual army may raise once it’s associated with the contrasts between male and female conceptions.

  20. School-Based Training for Deputy Heads and Its Relationship to the Task of Primary School Management.

    Science.gov (United States)

    Clerkin, Ciaran

    1985-01-01

    A survey of 40 newly appointed head teachers in Great Britain, supplemented by interviews with four head teachers, provided data establishing the extent to which head teachers were prepared for eight specific administrative roles by the experiences as deputy heads. Widely diverse, unsystematized approaches to administrator preparation were…

  1. 28 CFR 16.25 - Final action by the Deputy or Associate Attorney General.

    Science.gov (United States)

    2010-07-01

    ... Attorney General. 16.25 Section 16.25 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR... action by the Deputy or Associate Attorney General. (a) Unless otherwise indicated, all matters to be referred under § 16.24 by an Assistant Attorney General, the Director of the EOUST, or such person's...

  2. The occurance of Pterygodermatites nycticebi (Nematoda: Rictulariidae) in a captive slow loris, Nycticebus coucang

    Science.gov (United States)

    Tuggle, B.N.; Beehler, B.A.

    1984-01-01

    Adult and immature rictulariid nematodes were recovered at necropsy from the small intestine of an adult slow loris, Nycticebus coucang, from the Milwaukee County Zoo in Wisconsin. The lumen of the entire small intestine was packed with more than 100 nematodes, the intestinal wall appeared thickened and the mucosal surface contained numerous petechial hemorrhagic foci. The cause of death was diagnosed as a septicemia and possible lupus erythematosis.

  3. Loris Malaguzzi and the Schools of Reggio Emilia: Provocation and Hope for a Renewed Public Education

    Science.gov (United States)

    Moss, Peter

    2016-01-01

    Loris Malaguzzi (1920-1994) was one of the great educationalists of the last century, helping to create a system of public (or municipal) schools in his home city of Reggio Emilia in Northern Italy that is, arguably, the most successful example of radical or progressive education that has ever been. The article gives an introduction to Malaguzzi…

  4. 7 CFR 2.70 - Deputy Chief Economist.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Economist. 2.70 Section 2.70 Agriculture... GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist § 2.70 Deputy Chief Economist. Pursuant to § 2.29, the following delegation of authority is made by the Chief Economist to the...

  5. DEPUTY: analysing architectural structures and checking style

    International Nuclear Information System (INIS)

    Gorshkov, D.; Kochelev, S.; Kotegov, S.; Pavlov, I.; Pravilnikov, V.; Wellisch, J.P.

    2001-01-01

    The DepUty (dependencies utility) can be classified as a project and process management tool. The main goal of DepUty is to assist by means of source code analysis and graphical representation using UML, in understanding dependencies of sub-systems and packages in CMS Object Oriented software, to understand architectural structure, and to schedule code release in modularised integration. It also allows a new-comer to more easily understand the global structure of CMS software, and to void circular dependencies up-front or re-factor the code, in case it was already too close to the edge of non-maintainability. The authors will discuss the various views DepUty provides to analyse package dependencies, and illustrate both the metrics and style checking facilities it provides

  6. 7 CFR 2.75 - Deputy Chief Financial Officer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Financial Officer. 2.75 Section 2.75... AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Financial Officer § 2.75 Deputy Chief Financial Officer. Pursuant to § 2.28, the following delegation of authority is made by the...

  7. "Venom" of the slow loris: sequence similarity of prosimian skin gland protein and Fel d 1 cat allergen.

    Science.gov (United States)

    Krane, Sonja; Itagaki, Yasuhiro; Nakanishi, Koji; Weldon, Paul J

    2003-02-01

    Bites inflicted on humans by the slow loris (Nycticebus coucang), a prosimian from Indonesia, are painful and elicit anaphylaxis. Toxins from N. coucang are thought to originate in the brachial organ, a naked, gland-laden area of skin situated on the flexor surface of the arm that is licked during grooming. We isolated a major component of the brachial organ secretions from N. coucang, an approximately 18 kDa protein composed of two 70-90 amino-acid chains linked by one or more disulfide bonds. The N-termini of these peptide chains exhibit nearly 70% sequence similarity (37% identity, chain 1; 54% identity, chain 2) with the two chains of Fel d 1, the major allergen from the domestic cat (Felis catus). The extensive sequence similarity between the brachial organ component of N. coucang and the cat allergen suggests that they exhibit immunogenic cross-reactivity. This work clarifies the chemical nature of the brachial organ exudate and suggests a possible mode of action underlying the noxious effects of slow loris bites.

  8. NASA, NOAA administrators nominated

    Science.gov (United States)

    Richman, Barbara T.

    President Ronald Reagan recently said he intended to nominate James Montgomery Beggs as NASA Administrator and John V. Byrne as NOAA Administrator. These two positions are key scientific posts that have been vacant since the start of the Reagan administration on January 20. The President also said he intends to nominate Hans Mark as NASA Deputy Administrator. At press time, Reagan had not designated his nominee for the director of the Office of Science and Technology Policy.

  9. 15 CFR 4a.2 - Deputy Assistant Secretary for Security.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Deputy Assistant Secretary for Security. 4a.2 Section 4a.2 Commerce and Foreign Trade Office of the Secretary of Commerce CLASSIFICATION... Security. The Deputy Assistant Secretary for Security (DAS) is responsible for implementing E.O. 12958 and...

  10. Seeking Austen, from Abroad: Lori Smith’s Memoir 'A Walk with Jane Austen' (2007

    Directory of Open Access Journals (Sweden)

    Juliette Wells

    2009-05-01

    Full Text Available One outcome of Jane Austen’s popularity with present-day readers is their creation of books derived from and inspired by her own. This article examines a recent contribution to this increasingly crowded field: Lori Smith’s 2007 'A Walk with Jane Austen: A Journey into Adventure, Love & Faith', which depicts a thirtysomething American woman’s travel to England in the hopes of better understanding both Austen and herself. I consider this memoir in relation to other works created by Austen fans, including those who, like Smith, aim primarily at a Christian readership; I address as well this book’s significance as an account of literary pilgrimage and of personally transformative reading.

  11. 32 CFR 383a.8 - Administration.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Administration. 383a.8 Section 383a.8 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) ORGANIZATIONAL CHARTERS DEFENSE COMMISSARY AGENCY (DeCA) § 383a.8 Administration. (a) The Director and Deputy Director(s...

  12. Does toxic defence in Nycticebus spp. relate to ectoparasites? The lethal effects of slow loris venom on arthropods.

    Science.gov (United States)

    Grow, Nanda B; Wirdateti; Nekaris, K A I

    2015-03-01

    The venom produced by slow lorises (Nycticebus spp.) is toxic both intra- and inter-specifically. In this study we assessed the ecoparasite repellent properties of their venom. We tested venom from two Indonesian slow loris species: Nycticebus javanicus and Nycticebus coucang. Arthropods directly exposed to brachial gland secretions mixed with saliva from both species were immediately impaired or exhibited reduced activity (76%), and often died as a result (61%). We found no significant difference in the result of 60-min trials between N. coucang and N. javanicus [X(2)(1, n = 140) = 2.110, p = 0.3482]. We found evidence that the degree of lethality of the venom varies according to the arthropod taxa to which it is exposed. While most maggots (84%) were initially impaired from the venom after 10 min, maggots died after a 1 h trial 42% of the time. In contrast, at the end of 1 h trial, spiders died 78% of the time. For all arthropods, the average time to death from exposure was less than 25 min (M = 24.40, SD = 22.60). Ectoparasites including ticks, members of the arachnid order, are known to transmit pathogens to hosts and may be an intended target of the toxic secretions. Our results suggest that one function of slow loris venom is to repel parasites that affect their fitness, and that their topical anointing behaviour may be an adaptive response to ectoparasites. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. 7 CFR 2.55 - Deputy Under Secretary for Food, Nutrition, and Consumer Services.

    Science.gov (United States)

    2010-01-01

    ... the Under Secretary for Food, Nutrition, and Consumer Services § 2.55 Deputy Under Secretary for Food... made by the Under Secretary for Food, Nutrition, and Consumer Services to the Deputy Under Secretary for Food, Nutrition and Consumer Services, to be exercised only during the absence or unavailability...

  14. Ensuring a Strong U.S. Defense for the Future: The National Defense Panel Review of the 2014 Quadrennial Defense Review

    Science.gov (United States)

    2014-07-31

    territorial disputes with China. We note recent moves to station U.S. forces in Darwin , the plan to station a number of Littoral Combat Ships in Singapore...Under Secretary of Defense, Comptroller (C) Charles “Chuck” Hagel Secretary of Defense Mara Karlin Principal Director for Strategy, Policy (P...Support Staff to the Panel Charles Arnold George Sinks U.S. Government Liaison Officers Lori Abele Chief of Staff, Deputy Under Secretary of Defense

  15. Cloning and sequencing of growth hormone gene of Iranian Lori Bakhtiari sheep

    Directory of Open Access Journals (Sweden)

    M Dayani-Nia

    2010-05-01

    Full Text Available Growth hormone (GH is a peptide hormone that stimulates growth and cell reproduction in humans and animals. It is a 191-amino acid, single chain polypeptide hormone which is synthesized, stored, and secreted by the somatotroph cells within the lateral wings of the anterior pituitary gland. The goal of this research was to clone and sequence sheep growth hormone of Lori Bakhtiary breed in Iran. For this purpose, RNA was extracted from the pituitary gland of freshly slaughtered sheep and cDNA of growth hormone produced. The T/A cloning technique was used to clone the cDNA of growth hormone and then the synthesized construct was transferred into E. coli as the host. Once the correct recombinants were further confirmed by colony PCR or restriction enzyme digestion, sequencing was done. The sequencing results showed that, the length of sheep growth hormone cDNA was 690 bp fragments. Comparison of sequence of growth hormone inside the synthesized construct with those recorded in Genebank (NCBI, Blast indicated high degrees of similarity between Iranian native sheep and other sheep breeds of the world.

  16. 7 CFR 352.3 - Enforcement and administration.

    Science.gov (United States)

    2010-01-01

    ... section 414 of the Plant Protection Act (7 U.S.C. 7714). Any person who unloads, lands, or otherwise... applicable provisions of law. (b) Whenever the Deputy Administrator of the Plant Protection and Quarantine... Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION...

  17. 75 FR 50795 - Delegation by the Deputy Secretary of State Regarding Department Representation on the Committee...

    Science.gov (United States)

    2010-08-17

    ... Assistant Secretary for Economic, Energy and Business Affairs, to the extent authorized by law, the... Secretary or Assistant Secretary shall consult with the Under Secretary for Arms Control and International... authority, the Secretary, the Deputy Secretary, or the Deputy Secretary for Management and Resources may at...

  18. 75 FR 4982 - Redelegation of Functions; Delegation of Authority to Drug Enforcement Administration Official

    Science.gov (United States)

    2010-02-01

    ... other things, the CMEA amended the CSA to change the regulations for selling nonprescription products... redelegation will empower the Deputy Assistant Administrator, among other things, to exercise signing authority... Administration. The redelegation of signature authority for the regulations in part 1314 is consistent with the...

  19. 28 CFR 0.161 - Acceptance of certain offers by the Deputy Attorney General or Associate Attorney General, as...

    Science.gov (United States)

    2010-07-01

    ... Deputy Attorney General or Associate Attorney General, as appropriate. 0.161 Section 0.161 Judicial... certain offers by the Deputy Attorney General or Associate Attorney General, as appropriate. (a) In all... § 0.160, the Assistant Attorney General concerned shall, when he is of the opinion that the proposed...

  20. 14 CFR 385.15 - Authority of the Deputy General Counsel.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Authority of the Deputy General Counsel. 385.15 Section 385.15 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... affiliated with, any person subject to regulation under Titles IV or X of the Act, through issuance of an...

  1. Heads of administration from the University of Bergen, Norway, visiting CERN

    CERN Multimedia

    AUTHOR|(CDS)2094367

    2017-01-01

    The faculty directors and heads of administration from the University of Bergen, Norway, visited CERN on November 6 2017. The group was received by Martin Steinacher, Director for Finance and Human Resources, Prof. Egil Lillestøl, honorary staff member and Jens Vigen, head librarian. The delegation from Bergen included: Kjell Bernstrøm, University Director, Øystein Iversen, Director for Faculty of Law, Tore Tungodden, Assistant University Director, Kari Fuglseth, Deputy Director General University Director´s Office, Laurice Høie, Higher Executive Officer University Director´s Office, Ingar Myking, Deputy Director General University Director´s Office, Alette Mykkeltvedt, Director for Faculty of Social Sciences, Elisabeth Lysebo, Director for Faculty of Mathematics and Natural Sciences, Kim Ove Hommen, Director for Faculty of Humanities, Kristin Nodland, Head of Administration University Museum, Synnøve Myhre, Director for Faculty of Fine Art, Music and Design, Ørjan Hauge, Assistant Director for Facu...

  2. 77 FR 66864 - Delegation of Concurrent Authority to the Deputy Secretary

    Science.gov (United States)

    2012-11-07

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5671-D-01] Delegation of Concurrent Authority to the Deputy Secretary AGENCY: Office of the Secretary, HUD. ACTION: Notice of delegation of... officers and employees of the Department as the Secretary may designate, and may authorize successive...

  3. 76 FR 54217 - Membership of the National Oceanic and Atmospheric Administration Performance Review Board

    Science.gov (United States)

    2011-08-31

    ... Koch Director, Office of Education. Maureen E. Wylie Chief Financial Officer, Office of the Chief Financial Officer. Charles S. Baker Deputy Assistant Administrator, NESDIS National Environmental Satellite... Financial Officer National Ocean Service. David Robinson Associate Director for Management Resources...

  4. 76 FR 59662 - Membership of the National Oceanic and Atmospheric Administration Performance Review Board

    Science.gov (United States)

    2011-09-27

    ... Koch Director, Office of Education, Office of Education. Maureen E. Wylie Chief Financial Officer, Office of the Chief Financial Officer. Charles S. Baker Deputy Assistant Administrator, NESDIS, National.... Cartwright.... Chief Financial Officer, National Ocean Service. David Robinson Associate Director for...

  5. 7 CFR 371.1 - General statement.

    Science.gov (United States)

    2010-01-01

    ... headquartered in Washington, DC, and Riverdale, MD. The APHIS Management Team at these locations consists of the...) Deputy Administrator, Veterinary Services (VS) Deputy Administrator, Marketing and Regulatory Programs Business Services (MRPBS) Deputy Administrator, Wildlife Services (WS) Deputy Administrator, Animal Care...

  6. National Science Foundation Assistant Director for Mathematics and Physical Sciences Tony Chan (USA) visiting CMS experiment on 23rd May 2007 with Spokesperson T. Virdee, Deputy Spokesperson R. Cousins, Advisor to CERN Director-General J. Ellis, US CMS Research Program Deputy Manager D. Marlow and FNAL D. Green

    CERN Multimedia

    Maximilien Brice

    2007-01-01

    National Science Foundation Assistant Director for Mathematics and Physical Sciences Tony Chan (USA) visiting CMS experiment on 23rd May 2007 with Spokesperson T. Virdee, Deputy Spokesperson R. Cousins, Advisor to CERN Director-General J. Ellis, US CMS Research Program Deputy Manager D. Marlow and FNAL D. Green

  7. 7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics.

    Science.gov (United States)

    2010-01-01

    ... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to policy...

  8. 7 CFR 2.59 - Deputy Under Secretaries for Natural Resources and Environment.

    Science.gov (United States)

    2010-01-01

    ... Environment. 2.59 Section 2.59 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Natural Resources and Environment § 2.59 Deputy Under Secretaries for Natural Resources and Environment. Pursuant to § 2.20(a), subject to reservations in § 2.20(b), and subject to...

  9. The anti-liberal deputies in the Cortes of Cadiz (1810-1813

    Directory of Open Access Journals (Sweden)

    María del Mar Alarcón Alarcón

    2017-09-01

    Full Text Available This article attempts to analyze, mainly drawing on the Parliamentary Debates, the political positions adopted by some anti-liberal deputies in the Cortes of Cadiz. This representative chamber (which was the leading organ of political power in the Spanish lands not controlled by the Bonapartist regime was set up as a discussion and decision-making space,which entailed a rupture with conceptions of politics prevailing during the Ancien Régime, including Absolutism. The more conservative and reactionary groups used several mechanisms and ways (the propaganda machine, army, pulpit, municipal posts, diplomacy and Parliamentary elections, among others to put an end to that new place. Despite of its impact on the making and development of Society and State in Contemporary Spain, historians have paid little attention to the genesis and social bases of the Counter-Revolution. A small number of studies are focused on the origins of this historical movement, as well as on the various ideas and political attitudes of the deputies opposed to the constitutional regime of 1812. These gaps in knowledge have motivated the present pages. Our aim is to offer a first approach to the question.

  10. 75 FR 3924 - Delegation of Authority and Assignment of Responsibility to the Administrative Review Board

    Science.gov (United States)

    2010-01-25

    ...; (39) Toxic Substances Control Act, 15 U.S.C. 2622; 29 CFR Part 24; (40) Vietnam Era Veterans... of Labor shall have the responsibility for providing legal advice to the Secretary, the Deputy... the implementation and administration of this Order. The Solicitor of Labor may also provide legal...

  11. 18 December 2012 -Portuguese President of FCT M. Seabra visiting the Computing Centre with IT Department Head F. Hemmer, ATLAS experimental area with Collaboration Spokesperson F. Gianotti and A. Henriques Correia, in the LHC tunnel at Point 2 and CMS experimental area with Deputy Spokesperson J. Varela, signing an administrative agreement with Director-General R. Heuer; LIP President J. M. Gago and Delegate to CERN Council G. Barreia present.

    CERN Multimedia

    Samuel Morier-Genoud

    2012-01-01

    18 December 2012 -Portuguese President of FCT M. Seabra visiting the Computing Centre with IT Department Head F. Hemmer, ATLAS experimental area with Collaboration Spokesperson F. Gianotti and A. Henriques Correia, in the LHC tunnel at Point 2 and CMS experimental area with Deputy Spokesperson J. Varela, signing an administrative agreement with Director-General R. Heuer; LIP President J. M. Gago and Delegate to CERN Council G. Barreia present.

  12. Hubble 3D: A Science and Hollywood Collaboration Made (Nearly) in Heaven

    Science.gov (United States)

    Showstack, Randy

    2010-04-01

    Just 2 days after the 2010 Academy Awards® ceremony in early March bestowed Oscars® for motion picture achievements, NASA deputy administrator Lori Garver touted a new film about the Hubble Space Telescope, Hubble 3D, for best drama, special effects, screenplay, actors and actress, and director and producer. The 43-minute IMAX and Warner Brothers Pictures production, which opened in theaters on 19 March, is an example of the ability of Hollywood and the science community to partner in providing a dynamic educational and entertaining product, according to a number of people associated with the film. Sharing the red carpet at the Smithsonian National Air and Space Museum in Washington, D. C., with astronauts and others to mark the world premiere, Garver said the film shows the drama of the astronauts’ efforts to repair the telescope while traveling 17,000 miles per hour and performing grueling space walks (see Figure 1). “We have literally opened our eyes on the universe through this telescope,” she said. “This is a taxpayer-funded agency, and we are giving back to the public the very story that they paid for.”

  13. Open letter to Mr Christian Bataille, Deputy of Nord region, France. Open letter on nuclear energy

    International Nuclear Information System (INIS)

    Delacroix P

    2007-02-01

    The author, by means of a letter to the deputy Christian Bataille, presents arguments to the shutdown of old nuclear power plants. He points out the environmental and economical arguments in favor of a decrease of the nuclear power use in France. (A.L.B.)

  14. Fatal infection in three Grey Slender Lorises (Loris lydekkerianus nordicus) caused by clonally related Trueperella pyogenes.

    Science.gov (United States)

    Nagib, Samy; Glaeser, Stefanie P; Eisenberg, Tobias; Sammra, Osama; Lämmler, Christoph; Kämpfer, Peter; Schauerte, Nicole; Geiger, Christina; Kaim, Ute; Prenger-Berninghoff, Ellen; Becker, André; Abdulmawjood, Amir

    2017-08-29

    Trueperella pyogenes is a worldwide known bacterium causing mastitis, abortion and various other pyogenic infections in domestic animals like ruminants and pigs. In this study we represent the first case report of three unusual fatal infections of Grey Slender Lorises caused by Trueperella pyogenes. Meanwhile, this study represents the first in-depth description of the multilocus sequence analysis (MLSA) on T. pyogenes species. Three Trueperella pyogenes were isolated from three different Grey Slender Lorises, which died within a period of two years at Frankfurt Zoo (Frankfurt am Main - Germany). The three Grey Slender Loris cases were suffering from severe sepsis and died from its complication. During the bacteriological investigation of the three cases, the T. pyogenes were isolated from different organisms in each case. The epidemiological relationship between the three isolates could be shown by four genomic DNA fingerprint methods (ERIC-PCR, BOX-PCR, (GTG) 5 -PCR, and RAPD-PCR) and by multilocus sequence analysis (MLSA) investigating four different housekeeping genes (fusA-tuf-metG-gyrA). In this study, we clearly showed by means of using three different rep-PCRs, by RAPD-PCR and by MLSA that the genomic fingerprinting of the investigated three T. pyogenes have the same clonal origin and are genetically identical. These results suggest that the same isolate contaminated the animal's facility and subsequently caused cross infection between the three different Grey Slender Lorises. To the best of our knowledge, this is the first epidemiological approach concentrating on T. pyogenes using MLSA.

  15. Strengthening the University Executive: The Expanding Roles and Remit of Deputy and Pro-Vice-Chancellors

    Science.gov (United States)

    Shepherd, Sue

    2018-01-01

    Deputy and pro-vice-chancellors (DVCs and PVCs) are core members of the executive team and play a pivotal role in university management. Nevertheless, they have rarely been the subject of empirical investigation. This study addresses this research gap, utilising a census to examine the size and remit of the DVC and PVC cohort in English pre-1992…

  16. 28 CFR 0.165 - Recommendations to the Deputy Attorney General or Associate Attorney General, as appropriate...

    Science.gov (United States)

    2010-07-01

    ... General or Associate Attorney General, as appropriate, that certain claims be closed. 0.165 Section 0.165... Recommendations to the Deputy Attorney General or Associate Attorney General, as appropriate, that certain claims... the authority delegated by §§ 0.160(a) and 0.164, the Assistant Attorney General concerned shall, when...

  17. Explaining Perceptions of Administrative Support among Prison Treatment Staff: A Spotlight on Deputy Wardens in Charge of Treatment

    Science.gov (United States)

    Garland, Brett E.; McCarty, William P.

    2006-01-01

    This paper explores how perceptions of administrative support among 83 treatment staff working in a midwest prison system vary according to personal and work-related variables. It extends on previous literature by: (1) analyzing how perceptions of administrative support vary exclusively among prison treatment staff; (2) focusing on a single type…

  18. 77 FR 68830 - Delegation of Authority to the Principal Deputy Assistant Attorney General for the Civil Division

    Science.gov (United States)

    2012-11-16

    ... authority of the Assistant Attorney General for the Civil Division to the Principal Deputy Assistant Attorney General for the Civil Division, unless any such power or authority is required by law to be... for the Civil Division AGENCY: Department of Justice. ACTION: Notice. SUMMARY: On November 9, 2012...

  19. 77 FR 59004 - Membership of the Senior Executive Service Standing Performance Review Boards

    Science.gov (United States)

    2012-09-25

    ..., MELODEE PRINCIPAL DEPUTY ADMINISTRATOR, OFFICE OF JUVENILE JUSTICE AND DELINQUENCY PREVENTION. FEUCHT.... SABOL, WILLIAM DEPUTY DIRECTOR, BUREAU OF JUSTICE STATISTICS. RIDGEWAY, GREG DEPUTY DIRECTOR, NATIONAL...

  20. Effect of Organizational Culture Factors on Knowledge Management Processes Implementation in Technology & Deputy Tax Planning Agency

    Directory of Open Access Journals (Sweden)

    Hamid Rahimian

    2011-10-01

    Full Text Available This research was a case study to evaluate the effect of organizational culture on knowledge management processes implementation in Technology & Deputy Tax Planning Agency was done by Survey Method. Population of the study was experts in Technology & Deputy Tax planning of the organization. Research tools included two questionnaires: the organizational culture profile and the processes of knowledge management. The first questionnaire has surveyed the seven components of organizational culture (competitiveness, social responsibility, supportiveness, innovation, emphasis on rewards, performance orientation, and stability. The second has explored six processes such as creation, capture, organization, storage, dissemination and application of knowledge. The results of this research showed that according to the experts the components of organizational culture and knowledge management were in the intermediate level. Between each of the seven components of organizational culture was 70% positive and significant relationship with knowledge management processes. Also, among each of the seven components of organizational culture was positive and significant relationship with knowledge management processes. Regression analysis gave the same result that only two components of social responsibility and performance orientation in predicting the changing role of knowledge management processes have been effective.

  1. 28 CFR Appendix to Subpart B of... - Redelegation of Authority to the Deputy Assistant Attorney General for Litigation, Antitrust...

    Science.gov (United States)

    2010-07-01

    ... Assistant Attorney General for Litigation, Antitrust Division, To Authorize Production or Disclosure of... Assistant Attorney General for Litigation, Antitrust Division, To Authorize Production or Disclosure of... described in 28 CFR 16.21(a) is hereby redelegated to the Deputy Assistant Attorney General for Litigation...

  2. Corporate Dependence in Brazil's 2010 Elections for Federal Deputy

    Directory of Open Access Journals (Sweden)

    Wagner Pralon Mancuso

    2016-12-01

    Full Text Available What is the profile of candidates whose electoral campaigns are the most dependent on corporate donations? Our main objective is to identify factors that help explaining the level of corporate dependence among them. We answer this question in relation to the 2010 elections for federal deputy in Brazil. We test five hypotheses: 01. right-wing party candidates are more dependent than their counterparts on the left; 02. government coalition candidates are more dependent than candidates from the opposition; 03. incumbents are more dependent on corporate donations than challengers; 04. businesspeople running as candidates receive more corporate donations than other candidates; and 05. male candidates are more dependent than female candidates. Methodologically, the research design combines both descriptive and multivariate statistics. We use OLS regression, cluster analysis and the Tobit model. The results show support for hypotheses 01, 03 and 04. There is no empirical support for hypothesis 05. Finally, hypothesis 02 was not only rejected, but we find evidence that candidates from the opposition receive more contributions from the corporate sector.

  3. 2010 Special Operations Forces Industry Conference Held in Tampa, Florida on June 15-17, 2010

    Science.gov (United States)

    2010-06-17

    conference as it must be worn at all conference functions. “A la carte” tickets for the Tuesday Reception, Wednesday Gala Dinner, and Wednesday...USAF O6 Deputy Director of Procurement, YC-1102-3 Administration SOJA Supports Headquarters and Components Services KH Division KP Division...Organization Director of Procurement, USAF O6 Deputy Director of Procurement, YC-03 Administration SOJA Deputy Director of Procurement Mid-Atlantic

  4. 28 May 2010 - Japanese Ambassador H. Ueda visiting the LHC superconducting magnet test hall with CERN Technology Deputy Department Head L. Rossi.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    CERN-HI-1005088 02 Japanese Ambassador H. Ueda (right) visiting the LHC superconducting magnet test hall with Technology Deputy Department Head L. Rossi(left). H. Ueda is accompanied by KEK and ATLAS Collaboration T. Kondo (centre).

  5. The National Security Council Reform Project: Foundational Proposal for the Next Administration

    Science.gov (United States)

    2016-06-23

    connectedness of information in the digital age has resulted in a shift of power and influence from nation-states to nonstate actors. Growing...School of Citizenship and Public Affairs, Syracuse University Former Deputy Secretary of State, US Department of State Former Deputy National

  6. 77 FR 61571 - Membership of the Departmental Performance Review Board

    Science.gov (United States)

    2012-10-10

    ... Geovette E. Washington, Deputy General Counsel Office of the Chief Financial Officer and Assistant..., Chief Financial Officer and Director for Administration Economics and Development Administration Thomas Guevara, Deputy Assistant Secretary for Regional Affairs Sandra Walters, Chief Financial Officer and...

  7. The Canadian Human Rights Commission and Issues of Concern for Aboriginal Women. Notes for Remarks, by the Deputy Chief Commissioner.

    Science.gov (United States)

    Falardeau-Ramsay, Michelle

    This speech by the deputy chief commissioner of the Canadian Human Rights Commission discusses human rights, employment security, and pay-equity issues for Native Canadian women. The speech, offered in both English and French, calls the inequality of opportunity for Native Canadians a "national tragedy." It describes efforts to bring…

  8. 75 FR 37818 - Issues in the Design and Conduct of Clinical Trials for Antibacterial Drug Development; Public...

    Science.gov (United States)

    2010-06-30

    ... public workshop will help in developing topics for further discussion. Date and Time: The public workshop... Moser or Lori Benner, Center for Drug Evaluation and Research, Food and Drug Administration, Office of... of efficacy endpoints. Challenges in the conduct of clinical trials will be discussed, including good...

  9. 8 March 2012 - Extraordinary and plenipotentiary Ambassador R. van Schreven, Permanent Representative of the Kingdom of the Netherlands to the United Nations Office and other international organisations at Geneva, signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS experimental area with Deputy Spokesperson Y. Schutz; throughout accompanied by Former Deputy Department Head and Senior Physicist L. Linssen.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    8 March 2012 - Extraordinary and plenipotentiary Ambassador R. van Schreven, Permanent Representative of the Kingdom of the Netherlands to the United Nations Office and other international organisations at Geneva, signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS experimental area with Deputy Spokesperson Y. Schutz; throughout accompanied by Former Deputy Department Head and Senior Physicist L. Linssen.

  10. 10 October 2013 - D. Braun First Deputy Minister for Regional Development, Czech Republic, P. Styczeń Deputy Minister of Transport, Construction and Maritime Economy, Republic of Poland and F. Palko State Secretary, Ministry of Transport, Construction and Regional Development, Slovak Republic visiting the LHC tunnel at Point 1 with Technology Department, Vacuum, Surfaces and Coatings Group Leader J. M. Jimenez and signing the Guest book with CERN Director-General R. Heuer

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    10 October 2013 - D. Braun First Deputy Minister for Regional Development, Czech Republic, P. Styczeń Deputy Minister of Transport, Construction and Maritime Economy, Republic of Poland and F. Palko State Secretary, Ministry of Transport, Construction and Regional Development, Slovak Republic visiting the LHC tunnel at Point 1 with Technology Department, Vacuum, Surfaces and Coatings Group Leader J. M. Jimenez and signing the Guest book with CERN Director-General R. Heuer

  11. Institutions and Caudillos: Relations between the Deputies of the Twenty-eighth Legislature and President Venustiano Carranza

    Directory of Open Access Journals (Sweden)

    Ignacio Marván Laborde

    2001-10-01

    Full Text Available This article reviews the behavior of the Mexican Chamber of Deputies, from September, 1918 to December 1920 (XXVIII Legislature, and its relationship with the head of the executive branch, Venustiano Carranza. Challenging the traditional historiography of the period, Ignacio Marvan concludes that the dynamics of the executive-legislative relationship depended less on politician's leadership or absence of modern political parties than on institutional factors, such as the constitutional framework, the electoral system, the no reelection rule for the executive, and the presidential political cycle.

  12. 7 CFR 301.52-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Plant Protection and Quarantine Programs as applicable to the operations of such person. Deputy Administrator. The Deputy Administrator of the Plant Protection and Quarantine Programs, Animal and Plant Health... Plant Protection and Quarantine Programs, wherein the former agrees to comply with the requirements of...

  13. 1 December 2016 - First Deputy Chancellor of the Government of Lithuania R. Vaitkus signing the guest book with CERN Director-General R. Heuer.

    CERN Multimedia

    Gadmer, Jean-Claude Robert

    2015-01-01

    Dr Rimantas Vaitkus First Deputy Chancellor of the Government of Lithuania with Rectors of Kaunas Technological and Health Science Universities Republic of Lithuania on the occasion of the Signature of the Joint Statement of Intent by KTU and LUHS Rectors, Hospital of LUHS Kaunas Clinics and CERN.

  14. Bulgaria ,Boosting Energy Cooperation with China Interview with Deputy Minster Yaneva, Ministry of Economy and Energy, the Republic of Bulgaria

    Institute of Scientific and Technical Information of China (English)

    无

    2007-01-01

    @@ Deputy Minister Yaneva of Economy and Energy, the Republic of Bulgaria, a nice lady with outstanding talents, headed a delegation of Bulgaria to visit China in late June, for the participation at the 13th Bulgarian-Chinese Intergovernmental Commission for Economic, Trade, Scientific and Technical Cooperation. As an important instrument, the Joint Commission played a significant role in promoting the overall development of the bilateral economic relations.

  15. IAEA Delivers Report on Nuclear Power Development to Belarus Deputy Prime Minister

    International Nuclear Information System (INIS)

    2012-01-01

    Full text: The International Atomic Energy Agency today delivered the final report from an IAEA Integrated Nuclear Infrastructure Review (INIR) mission to Belarus. The report concludes that Belarus has made important progress in its development of nuclear infrastructure for a nuclear power programme and that Belarus is on its way to being well-prepared with its infrastructure to support the construction of a nuclear power plant. The report makes 16 recommendations and 22 specific recommendations to assist the national authorities in preparing the infrastructure necessary for the project. ''Belarus has already implemented some of the recommendations that we shared with them in June, and the Government plans to implement all the remaining ones,'' IAEA Deputy Director General Alexander Bychkov said after delivering the document to Belarusian Deputy Prime Minister Anatoly Tozik. ''This shows that the country is taking the report seriously.'' The main recommendations in the report include to revise Belarusian nuclear legislation to adequately address issues such as radioactive waste and spent fuel management, review the enforcement process, and norms relevant to civil liability for nuclear damage; to strengthen the regulatory body and the regulatory framework for licensing; and to develop comprehensive management systems for the nuclear project. Additionally, specific suggestions were made about its infrastructure development activities based on guidance contained in the publication Milestones in the Development of a National Infrastructure for Nuclear Power. ''The report acknowledges Belarus' strong expertise in radiation protection and environmental monitoring and recognizes that good coordination in the development of Belarus' nuclear power programme is beneficial,'' Bychkov said. Belarus began considering nuclear power in the 1980s and recently renewed its efforts. The Concept of Energy Security of the Republic of Belarus, promulgated in September 2007, called for

  16. 77 FR 44313 - 2011 Career Reserved Senior Executive Positions

    Science.gov (United States)

    2012-07-27

    ... Service. Officer. Administrator, Operations and Management. Director, Human Resources. Deputy... Resources Management. Director for Human Resources Management. Director for Director for Financial Financial.... Defense Human Chief Actuary. Resources Activity. Director, Civilian Personnel Management Service. Deputy...

  17. 15th December 2010 - World Intellectual Property Organization Director-General F. Gurry signing the guest book with CERN Director-General R. Heuer; visiting CMS control room, experimental cavern and LHC tunnel with Collaboration Deputy Spokesperson J. Incandela, accompanied by M. Bona.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    CERN-HI-1012325 36, from left to right: WIPO Arbitration and Mediation Center, Global Issues Sector Director E. Wilbers; CERN Adviser, Relations with International Organisations, M. Bona; CMS Collaboration Deputy Spokesperson, University of California Santa Barbara J. Incandela; WIPO Deputy Director General, Global Issues Sector J. C. Wichard; WIPO Director-General F. Gurry; WIPO Executive Director and Chief of Staff, Office of the Director General N. Prasad.

  18. 28 CFR 0.26 - Organization.

    Science.gov (United States)

    2010-07-01

    ... Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE 1-Office of International Programs... Deputy Attorney General with officials of foreign governments, foreign non-governmental organizations, and international organizations. (5) As required, advise the Deputy Attorney General on matters...

  19. 7 CFR 62.000 - Meaning of terms.

    Science.gov (United States)

    2010-01-01

    .... Conformance. A user's quality manual and supporting documentation. Deputy Administrator. The Deputy... maintain the identity of products for which service is provided under the regulations. Official memoranda... development, documentation, and implementation of QSVP. Quality Manual. A collection of documents that...

  20. 20 Years of Success: Science, Technology, and the Nuclear Weapons Stockpile

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2015-10-22

    On Oct. 22, 2015, NNSA celebrated the proven success of the Stockpile Stewardship Program at a half-day public event featuring remarks by Secretary of Energy Ernest Moniz, Secretary of State John Kerry, and Under Secretary for Nuclear Security and NNSA Administrator Lt. Gen. (retired) Frank G. Klotz. The event also featured remarks by Deputy Secretary of Energy Elizabeth Sherwood-Randall and NNSA Principal Deputy Administrator Madelyn Creedon.

  1. Political Public Relations Campaign for Election of Mayor and Deputy Mayor of Solok Period 2016-2020, Creative Design Coordinator Division

    OpenAIRE

    Sanjaya, Lovegi David; M.Si, Agus Naryoso; M.Si, Much Yulianto; Gono, Joyo M S; Ayun, Primada Qurrota

    2016-01-01

    Public relations, as one of the strategies are quite effective for building the image, as well as long-term relationship with the community or public. This strategy is often combined with a political strategy to win a pair of political party candidates, which is the background of the writing of this scientific work ; the intention to won Irzal Ilyas and Alfauzi Bote as pair of political candidates to become mayor and deputy mayor of Solok period 2016-2021. There need to be applied various eff...

  2. 19 September 2012 - Indonesian Members of Parliament visiting the CMS control room and experimental cavern at Point 5 with Former Deputy Spokesperson A. De Roeck and International Relations Adviser E. Tsesmelis.

    CERN Multimedia

    Jean-Claude Gadmer

    2012-01-01

    19 September 2012 - Indonesian Members of Parliament visiting the CMS control room and experimental cavern at Point 5 with Former Deputy Spokesperson A. De Roeck and International Relations Adviser E. Tsesmelis.

  3. First Lady Hillary Clinton is greeted by NASA Administrator Goldin

    Science.gov (United States)

    1999-01-01

    First Lady Hillary Rodham Clinton and her daughter, Chelsea, are greeted by NASA Administrator Daniel S. Goldin upon their arrival at the Skid Strip at Cape Canaveral Air Station. Next to Gold are (from left) Deputy Director for Business Operations Jim Jennings and Mrs. Goldin. Mrs. Clinton and Chelsea are here to view the launch of Space Shuttle mission STS-93, scheduled for 12:36 a.m. EDT July 20. Much attention has been generated over the launch due to Commander Eileen M. Collins, the first woman to serve as commander of a Shuttle mission. The primary payload of the five- day mission is the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected to unlock the secrets of supernovae, quasars and black holes.

  4. Emergency Operations Center ribbon cutting

    Science.gov (United States)

    2009-01-01

    Center Director Gene Goldman and special guests celebrate the opening of the site's new Emergency Operations Center on June 2. Participants included (l t r): Steven Cooper, deputy director of the National Weather Service Southern Region; Tom Luedtke, NASA associate administrator for institutions and management; Charles Scales, NASA associate deputy administrator; Mississippi Gov. Haley Barbour; Gene Goldman, director of Stennis Space Center; Jack Forsythe, NASA assistant administrator for the Office of Security and Program Protection; Dr. Richard Williams, NASA chief health and medical officer; and Weldon Starks, president of Starks Contracting Company Inc. of Biloxi.

  5. Presence of Political Parties and Deputies in Internet in Argentina, Paraguay and Uruguay

    Directory of Open Access Journals (Sweden)

    Yanina Welp

    2016-01-01

    Full Text Available According to Latinobarómetro, political parties are the institutions which less confidence receive from Latin Americans. This is not a particularity of Latin America, but a documented problem of Western consolidated democracies.In this context, in Europe and United States, among others, the use of digital media become a tool to overcome the crisis of representation, given their capacities to renovate politics, and because they allow the offering of more publicity of public matters as well as the opening up of new channels of participation and communication between citizens and representatives. But to what extent and with which features is this adoption happening in Latin America? Based on the study of the online presence of political parties and deputies of Argentina, Paraguay and Uruguay (webs, blogs, Facebook and Twitter, this article explores the levels of digital media adoption and the influence of variables such as the internet diffusion in the country, the crisis of representation and the characteristics of political parties (institutionalization, ideology, size, role of leaders explaining the extension and characteristics of this adoption. 

  6. 76 FR 37029 - Margin and Capital Requirements For Covered Swap Entities

    Science.gov (United States)

    2011-06-24

    ...., Washington, DC 20219. Board: Sean D. Campbell, Deputy Associate Director, Division of Research and Statistics, (202) 452-3761, Michael Gibson, Senior Associate Director, Division of Research and Statistics, (202... Administration Board. Dated: June 21, 2011. Stephen M. Cross, Deputy Director of the Division of Bank Regulation...

  7. An investigation whether the deputy president of the African National Congress can be the successor to the president during the National Elective Conference

    Directory of Open Access Journals (Sweden)

    Mavhungu E. Musitha

    2018-03-01

    Full Text Available This is a qualitative study which investigated whether the deputy president of the African National Congress (ANC can be the heir and elected president in the December 2017 elective conference. The study found that the deputy president is not the heir to the position of the president but that anybody can be elected to the position in terms of the existing constitution. The study also found that while the ANC has a constitution that prescribes how members are elected to positions, it is open to manipulation by those who wish to position their preferred comrades. The ANC does not have a clear policy or procedure to decide who succeeds to the presidency. This lack of policy has led to infighting among the comrades along factional lines as they seek to capture the soul of the ANC. The study found that most former liberation ruling parties such as ZANU–PF and the South West African People’s Organisation are faced with the same challenge. The Chinese Communist Party has faced and overcome this challenge by formulating a clear policy and procedure on who becomes the president or leader of the party. The study recommends that the ANC should formulate clear policies and regulations to define and determine who becomes its president.

  8. 4 July 2013- European Commission DG CONNECT Director-General R. Madelin, signing the guest book with CERN Director-General R. Heuer and visiting CMS experimental area with Collaboration Deputy Spokesperson J. Varela.

    CERN Multimedia

    Maximilien Brice

    2013-01-01

    4 July 2013- European Commission DG CONNECT Director-General R. Madelin, signing the guest book with CERN Director-General R. Heuer and visiting CMS experimental area with Collaboration Deputy Spokesperson J. Varela.

  9. Conference RSIS (The role of science in the information society) - Contributions to Economic Development - Building 40 S2 - B01 - Mr. John Dryden, Chairman, Deputy Director, Organisation for Economic Cooperation and Development.

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Conference RSIS (The role of science in the information society) - Contributions to Economic Development - Building 40 S2 - B01 - Mr. John Dryden, Chairman, Deputy Director, Organisation for Economic Cooperation and Development.

  10. 3 October 2013 - Ukrainian Vice Prime Minister Ukraine K. I. Gryschenko welcomed by CERN Director-General R. Heuer who introduces Head of International Relations R. Voss; Head of Technology Department F. Bordry; Deputy Head of International Relations E. Tsesmelis; Deputy Legal Counsel M. Wilbers; Adviser for Ukraine T. Kurtyka; Signing of the Agreement between Ukraine and CERN concerning the granting of the status of Associate Member at CERN; in the LHC tunnel at Point 5 and visiting CMS experimental area with CERN Team Leader A. Petrilli.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    3 October 2013 - Ukrainian Vice Prime Minister Ukraine K. I. Gryschenko welcomed by CERN Director-General R. Heuer who introduces Head of International Relations R. Voss; Head of Technology Department F. Bordry; Deputy Head of International Relations E. Tsesmelis; Deputy Legal Counsel M. Wilbers; Adviser for Ukraine T. Kurtyka; Signing of the Agreement between Ukraine and CERN concerning the granting of the status of Associate Member at CERN; in the LHC tunnel at Point 5 and visiting CMS experimental area with CERN Team Leader A. Petrilli.

  11. 75 FR 56503 - Membership of the Departmental Performance Review Board

    Science.gov (United States)

    2010-09-16

    .... Washington, Deputy General Counsel Chief Financial Officer and Assistant Secretary for Administration... Walters, Chief Financial Officer and Director of Administration International Trade Administration... National Oceanic and Atmospheric Administration: Robert J. Byrd, Chief Financial Officer/Chief...

  12. Information Technology Management: Social Security Administration Practices Can Be Improved

    National Research Council Canada - National Science Library

    Shaw, Clay

    2001-01-01

    To improve SSAs IT management practices, we recommend that the Acting Commissioner of Social Security direct the Chief Information Officer and the Deputy Commissioner for Systems to complete the following actions...

  13. 28 CFR 27.5 - Review.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Review. 27.5 Section 27.5 Judicial... Investigating Reprisal Allegations and Ordering Corrective Action § 27.5 Review. The Complainant or the FBI may..., review by the Deputy Attorney General of that determination or order. The Deputy Attorney General shall...

  14. Open letter to Mr Christian Bataille, Deputy of Nord region, France. Open letter on nuclear energy; Lettre ouverte a Monsieur Christian Bataille, depute du Nord. Lettre ouverte sur le nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Delacroix P

    2007-02-15

    The author, by means of a letter to the deputy Christian Bataille, presents arguments to the shutdown of old nuclear power plants. He points out the environmental and economical arguments in favor of a decrease of the nuclear power use in France. (A.L.B.)

  15. 78 FR 25565 - Controlled Import Permits

    Science.gov (United States)

    2013-05-02

    ... replacing the term ``Deputy Administrator'' with ``Administrator'' and making minor editorial changes. New..., linters, and other forms of cotton fiber (not including yarn, thread, and cloth); cottonseed hulls, cake...

  16. 7 CFR 1410.33 - Contract modifications.

    Science.gov (United States)

    2010-01-01

    ...) Decrease acreage in the CRP; (2) Permit the production of an agricultural commodity under extraordinary... Deputy Administrator; (3) Facilitate the practical administration of the CRP; or (4) Accomplish the goals...

  17. 27 September 2013 -Lithuanian Minister of Culture Š. Birutis in the LHC tunnel with International Relations Adviser T. Kurtyka and visiting CMS experimental area with Deputy Spokesperson T. Camporesi. Also present: V. Rapsevicius, CMS Collaboration.

    CERN Multimedia

    Laurent Egli

    2013-01-01

    27 September 2013 -Lithuanian Minister of Culture Š. Birutis in the LHC tunnel with International Relations Adviser T. Kurtyka and visiting CMS experimental area with Deputy Spokesperson T. Camporesi. Also present: V. Rapsevicius, CMS Collaboration.

  18. Visit of H.E. Mr. Attila Chikan, Minister of Economic Affairs, Prof. Adam Török, President, National Committee for Technological Development, Mr. Pal Koncz, Deputy Director General, National Committee for Technological Development, Hungary

    CERN Multimedia

    Laurent Guiraud

    1999-01-01

    Visit of H.E. Mr. Attila Chikan, Minister of Economic Affairs, Prof. Adam Török, President, National Committee for Technological Development, Mr. Pal Koncz, Deputy Director General, National Committee for Technological Development, Hungary

  19. 11 March 2010 - Ambassador of Canada to Switzerland and to Liechtenstein R. Santi in the ATLAS visitor centre with Collaboration Deputy Spokesperson A. Lankford and signing the guest book with CERN Director-General R. Heuer.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    11 March 2010 - Ambassador of Canada to Switzerland and to Liechtenstein R. Santi in the ATLAS visitor centre with Collaboration Deputy Spokesperson A. Lankford and signing the guest book with CERN Director-General R. Heuer.

  20. About the Principal Deputy Assistant Administrator of EPA’s Office of Administration and Resources Management

    Science.gov (United States)

    Donna Vizian manages essential support functions, including human resources management, diversity and inclusion, acquisition (contracts), grants management, and the protection of EPA’s facilities and other critical assets nationwide.

  1. 44 CFR 5.85 - Authentication and attestation of copies.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Authentication and attestation of copies. 5.85 Section 5.85 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT... Authentication and attestation of copies. The Administrator, Deputy Administrators, Regional Administrators...

  2. 77 FR 46519 - Proposed Aggregate Production Quotas for Schedule I and II Controlled Substances and Proposed...

    Science.gov (United States)

    2012-08-03

    ... Administrator, in turn, has redelegated this function to the Deputy Administrator, pursuant to 28 CFR 0.104. The... Benzylmorphine 2 Betacetylmethadol 2 Beta-hydroxy-3-methylfentanyl 2 Beta-hydroxyfentanyl 2 Betameprodine 2...

  3. Al-Shebab: An Al-Qaeda Affiliate Case Study (2Rev)

    Science.gov (United States)

    2017-10-01

    deputies responsible for finance , administration, and security. Coordination among regional groups is common.10 The deputy leader of al-Shebab, Mukhtar...Maaliya (Ministry of Finance ) controlled taxation. A complex court system also emerged. Multiple training camps were built that focused on hand-to-hand...Nathan Chandler, Counterterrorism and Counterinsurgency in Somalia: Assessing the Campaign Against Al Shabaab, Rand Corporation , 2016, accessed 6/5

  4. Army Cyber Mission Force - Ambitions and Realities

    Science.gov (United States)

    2015-05-21

    London: A & C Black, 2006), 219. 3 Ibid., 227. 4 Susan Pines, Veda Dickerson, and Lori Cates, eds., O*NET Dictionary of Occupational Titles, 2nd ed...Pines, Susan, Veda Dickerson, and Lori Cates. "Experience." In O*NET Dictionary of Occupational Titles

  5. 7 CFR 301.80-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Administrator. The Deputy Administrator of the Plant Protection and Quarantine Programs, Animal and Plant Health... Administrator, Plant Protection and Quarantine Programs, Animal and Plant Health Inspection Service, U.S... Plant Protection and Quarantine Programs, wherein the former agrees to comply with the requirements of...

  6. 75 FR 49994 - James Stephen Ferguson, D.M.D.; Revocation of Registration

    Science.gov (United States)

    2010-08-16

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration [Docket No. 09-64] James Stephen Ferguson, D.M.D.; Revocation of Registration On July 24, 2009, the Deputy Assistant Administrator, Office of Diversion Control, Drug Enforcement Administration (DEA), issued an Order to Show Cause to James Stephen...

  7. Exploring cultural drivers for wildlife trade via an ethnoprimatological approach: a case study of slender and slow lorises (Loris and Nycticebus) in South and Southeast Asia.

    Science.gov (United States)

    Nekaris, K A I; Shepherd, C R; Starr, C R; Nijman, V

    2010-09-01

    Illegal and unsustainable trade in wildlife is a major conservation challenge. For Asian primates, economic and cultural traditions, and increased forest access mean that trade may have become detrimental for certain species. Slow and slender lorises (Nycticebus and Loris) are primates particularly prevalent in trade, determined until now by focused counts of lorises in regional markets. Here, we use international trade statistics and a participant-observer approach to assess culturally specific drivers for trade in lorises in South and Southeast Asia, to provide a broader context to help mitigate this practice. Analysis of international records for the last 30 years revealed that live animal trade was more prevalent than trade in body parts (slow lorises, 86.4%; slender lorises, 91.4%), with Laos, Cambodia, and Thailand the largest exporters. We then examine drivers of international and domestic trade based on long-term data from 1994-2009 in Sri Lanka, Cambodia, and Indonesia. We show that slender lorises are important in Sri Lankan folklore, but their use as pets and for traditional medicine is rare. Trade in Bengal slow and pygmy lorises in Cambodia for use in traditional medicines, a practice with deeply historical roots, is widespread. Despite its own set of myths about the magical and curative properties of lorises, trade in Javan, Bornean, and greater slow lorises in Indonesia is largely for pets. Conservation practices in Asia are often generalized and linked with the region's major religions and economies. We show here that, in the case of wildlife trade, culturally specific patterns are evident among different ethnic groups, even within a country. Revealing such patterns is the foundation for developing conservation management plans for each species. We suggest some participatory methods for each country that may aid in this process. 2010 Wiley-Liss, Inc.

  8. 75 FR 68533 - Funding and Fiscal Affairs, Loan Policies and Operations, and Funding Operations; Capital...

    Science.gov (United States)

    2010-11-08

    ... FARM CREDIT ADMINISTRATION 12 CFR Part 615 RIN 3052-AC25 Funding and Fiscal Affairs, Loan Policies... K. Van Meter, Deputy Director, Office of Regulatory Policy, Farm Credit Administration, 1501 Farm... Director, Office of Regulatory Policy, Farm Credit Administration, McLean, VA 22102- 5090, (703) 883-4232...

  9. Completing the One EPA Web Transformation (Email Message)

    Science.gov (United States)

    Deputy administrator Stan Meiburg urged other administrators to review their web transformation progress, and make sure they have requested extensions and planned to temporarily transfer content to the www3 server, before the September 30, 2015 deadline.

  10. Heritability estimates and correlations between production and ...

    African Journals Online (AJOL)

    Heritablities and correlations were estimated between lamb body weight at different ages and reproductive traits in the Lori-Bakhtiari sheep breed. Data and pedigree information for Lori-Bakhtiari sheep used in this study were 5826 records of body weight of lambs from 240 sires and 1627 dams, and 5741 records of ...

  11. Integrating Postsecondary Education Interventions to Help Low-Income Students Succeed. Testimony of Alexander Mayer, Deputy Director, Postsecondary Education, MDRC, Before the California State Assembly Higher Education Committee and the Budget Subcommittee on Education Finance

    Science.gov (United States)

    Mayer, Alexander

    2018-01-01

    This document presents the testimony of MDRC's Alex Mayer, the Deputy Director for Postsecondary Education at MDRC. The three points that Alex Mayer emphasizes in this testimony before the California State Assembly Higher Education Committee and the Budget Subcommittee on Education Finance on integrating postsecondary education interventions to…

  12. Prioritizing the performance of civil development projects in governmental administration agencies, using gray relational analysis (GRA and TOPSIS approach

    Directory of Open Access Journals (Sweden)

    Ali Mohammadi

    2016-06-01

    Full Text Available A key indicator to evaluate the success of an organization is the degree of meeting specific civil project goals based on a predetermined schedule. Therefore, the main purpose of this paper is to evaluate the performance of governmental administration agencies based on realization of civil project goals. In this paper, the information published by the President Deputy of Strategic Planning and Control, that publishes an annual report of evaluation indicators for national civil development projects, are used to evaluate and prioritize the major and non-major governmental agencies. Also, the Gray Relational Analysis (GRA and the TOPSIS method are employed to analyze the data. The results indicate that using the GRA method, Supreme Council of Seminary and using the TOPSIS method, The Ministry of Labor and Social Affaires have gained the highest ranking.

  13. 75 FR 49956 - Dewey C. Mackay, M.D.; Revocation of Registration

    Science.gov (United States)

    2010-08-16

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration [Docket No. 09-28] Dewey C. Mackay, M.D.; Revocation of Registration On February 26, 2009, I, the Deputy Administrator of the Drug Enforcement Administration (DEA), issued an Order to Show Cause and Immediate Suspension of Registration to Dewey C. MacKay...

  14. 76 FR 70169 - SES Performance Review Board

    Science.gov (United States)

    2011-11-10

    ...: Emily T. Carroll, Chief, Human Resources Division, Office of Administration, National Transportation..., in accordance with regulations prescribed by the Office of Personnel Management, one or more SES... and Space Administration. Jerold Gidner, Deputy Director, Office of Strategic Employee and...

  15. 16 February 2012 - Chinese Taipei Ambassador to Switzerland F. Hsieh in the ATLAS visitor centre, ATLAS experimental area and LHC tunnel at Point 1 with Collaboration Deputy Sookesperson A. Lankford, throughout accompanied by International Relations Adviser R. Voss.

    CERN Multimedia

    Jean-Claude Gadmer

    2012-01-01

    16 February 2012 - Chinese Taipei Ambassador to Switzerland F. Hsieh in the ATLAS visitor centre, ATLAS experimental area and LHC tunnel at Point 1 with Collaboration Deputy Sookesperson A. Lankford, throughout accompanied by International Relations Adviser R. Voss.

  16. Mr Huidong LI Deputy Chairman and Secretary-General, Rev. Committee of Chinese Nationalist Party Vice President, Sun Yat-Sen Culture Interchange Association of China Member, Committee for Internal and Judicial Affairs of the National People's Congress of China

    CERN Multimedia

    Bennett, Sophia Elizabeth

    2017-01-01

    Mr Huidong LI Deputy Chairman and Secretary-General, Rev. Committee of Chinese Nationalist Party Vice President, Sun Yat-Sen Culture Interchange Association of China Member, Committee for Internal and Judicial Affairs of the National People's Congress of China

  17. 8 December 2011 - Kingdom of Lesotho Deputy Prime Minister and Minister of Home Affairs and Public Safety, and of Parliamentary Affairs A. Lesao Lehohla signing the guest book with Adviser R. Voss and in the ATLAS visitor centre.

    CERN Multimedia

    VMO Team

    2011-01-01

    8 December 2011 - Kingdom of Lesotho Deputy Prime Minister and Minister of Home Affairs and Public Safety, and of Parliamentary Affairs A. Lesao Lehohla signing the guest book with Adviser R. Voss and in the ATLAS visitor centre.

  18. 4th July 2011 - Russian Deputy Director-General Director of Directorate for Scientific and Technical Complex ROSATOM V. Pershukov in the ATLAS underground experimental area with Adviser T. Kurtyka, ATLAS Technical Coordinator M. Nessi and ATLAS Russian users.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    4th July 2011 - Russian Deputy Director-General Director of Directorate for Scientific and Technical Complex ROSATOM V. Pershukov in the ATLAS underground experimental area with Adviser T. Kurtyka, ATLAS Technical Coordinator M. Nessi and ATLAS Russian users.

  19. 78 FR 12102 - Manufacturer of Controlled Substances; Notice of Application; Mallinckrodt, LLC

    Science.gov (United States)

    2013-02-21

    ... plans to manufacture the listed controlled substances for internal use and for sale to other companies... Enforcement Administration, Office of Diversion Control, Federal Register Representative (ODL), 8701...: February 8, 2013. Joseph T. Rannazzisi, Deputy Assistant Administrator, Office of Diversion Control, Drug...

  20. 77 FR 66663 - Senior Executive Service; Combined Performance Review Board (PRB)

    Science.gov (United States)

    2012-11-06

    ... Director, BPD; Leonard R. Olijar, Chief Financial Officer/Associate Director, BEP; Beverly Ortega Babers, Chief Administrative Officer, United States Mint; Cheri Mitchell, Chief Financial Officer/Assistant... States Mint; Mary G. Ryan, Deputy Administrator, TTB. Alternate Members Marty Greiner, Chief Financial...

  1. 76 FR 2640 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2011 Atlantic Bluefish...

    Science.gov (United States)

    2011-01-14

    ... Assistant Administrator has determined that this proposed rule is consistent with the Atlantic Bluefish FMP... D. Rauch III, Deputy Assistant Administrator for Regulatory Programs, National Marine Fisheries... mortality; stock status; recent estimates of recruitment; virtual population analysis results; levels of...

  2. From Situation to opposition: the welfare reform of the Lula’s government from the perspective of the PSDB deputies

    Directory of Open Access Journals (Sweden)

    Felipe Corral de Freitas

    2015-06-01

    Full Text Available With the defeat in the 2002 elections, the PSDB was characterized as the "strong opposition" to the government of the PT. He reached the command of the Executive in 2003, implemented a reform in Social Security, thus constituting the first time the opposition PSDB. Thus, the objective of this work is to understand the discursive behavior of federal PSDB deputies, held during the sessions of the Great Expedient of the Federal Chamber, when dealing with this reform. For the analysis, the theoretical and methodological aspects of discourse theory of Ernesto Laclau and Chantal Mouffe were used. It was possible to identify that the new political context has changed the identities of PT and PSDB, but kept the antagonistic relationship. Moreover, because it is the first time opposition, the PSDB did not build hegemonic discourse against the reform, but critical of its formatting.

  3. 76 FR 17789 - Fisheries of the Northeastern United States; Atlantic Bluefish Fishery; 2011 Atlantic Bluefish...

    Science.gov (United States)

    2011-03-31

    ...-Stevens Act), the NMFS Assistant Administrator has determined that this final rule is consistent with the...: March 28, 2011. Samuel D. Rauch III, Deputy Assistant Administrator for Regulatory Programs, National...; current estimates of fishing mortality; stock status; recent estimates of recruitment; virtual population...

  4. 76 FR 80318 - Fisheries of the Northeastern United States; Northeast Multispecies Fishery Management Plan...

    Science.gov (United States)

    2011-12-23

    .... Classification Pursuant to section 304(c)(1)(A) of the Magnuson-Stevens Act, the NMFS Assistant Administrator has..., Deputy Assistant Administrator for Regulatory Programs, National Marine Fisheries Service. For the...-effort (CPUE); discards; stock status; recent estimates of recruitment; virtual population analysis...

  5. 78 FR 47021 - Excepted Service

    Science.gov (United States)

    2013-08-02

    ... the Assistant......... BO130016 5/9/2013 Director. Small Business Administration.. Office of Field... Immigration Director. Services. Office of the Cybersecurity DM120050 5/18/2013 Under Secretary Strategist. for... (International Defense (Europe/ Security Affairs). NATO). Small Business Administration.. Office of Deputy...

  6. 77 FR 65552 - SES Performance Review Board

    Science.gov (United States)

    2012-10-29

    ...: Anthony Costa, Chief People Officer, Office of the Chief People Officer, General Services Administration, 1275 First Street NE., Washington, DC 20002, (202) 501-0398. SUPPLEMENTARY INFORMATION: Section 4314(c..., Deputy Administrator--Chair. Anthony E. Costa, Chief People Officer. Jiyoung C. Park, Associate...

  7. Technology transfer from havana hospitals to primary care: yamila de armas, MD. Deputy director, provincial health department, havana city province.

    Science.gov (United States)

    Giraldo, Gloria

    2009-01-01

    Dr Yamila de Armas has occupied an array of posts since finishing her residency in family medicine in her home province of Cienfuegos in 1992. She has served as a family doctor; polyclinic, municipal and provincial health director; medical school dean; and twice vice minister of public health. But few would doubt her toughest job is the one she has now: deputy director of the Havana City Provincial Health Department, in charge of medical services for the 2.2 million people living in Cuba's complex, sprawling capital. It was here in 2002-2003 that the program was launched to repair, refurbish and expand the country's nearly 500 community polyclinics. Key to the effort was equipping these facilities with a broader range of new and upgraded medical technology. Dr de Armas offers MEDICC Review her reflections on the results five years later.

  8. COMPOSITION OF THE JOINT ADVISORY APPEALS BOARD & DISCIPLINARY BOARD 1999-2000 EXERCISE

    CERN Multimedia

    Division des ressources humaines

    2000-01-01

     Appointed by the Director-GeneralAppointed by the Staff AssociationMembersBertrand Frammery / PSDaniel Boimond/ PS1st deputiesSue Foffano / ASJean-Claude Carlier / TIS2nd deputiesWolfgangvon Rüden / ITPoul Frandsen / LHCMessrs. Frammery and Boimond have drawn up the following list of staff members from among whom the Chairman of the Board may be chosen when required:Jean-Luc Baldy / STGuy Maurin / EPJean-Paul Fabre / EPMichel Rabany / LHCSverre Jarp / ITJean-Pierre Riunaud / PSLennart Jirden / SPLRoberto Saban / ACRobin Lauckner / SLMarilena Streit-Bianchi /TISMediators [see Administrative Circular N¡ 6 (Rev. 1) entitled 'Review procedure'] will also be selected from this list of ten staff members.COMPOSITION OF THE JOINT ADVISORY DISCIPLINARY BOARD1999-2000 Exercise Appointed by the Director-GeneralAppointed by the Staff AssociationMembersAchille Petrilli / ASMichel Bonnet / EP1st deputiesWisla Carena / EPIrene Seis / IT2nd deputiesRoland Garoby / PSJuan Diaz-Montoya / AC...

  9. 7 CFR 301.85-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Administrator. The Deputy Administrator of the Plant Protection and Quarantine Programs, Animal and Plant Health.... Plant Protection and Quarantine Programs. The organizational unit within the Animal and Plant Health... Plant Protection and Quarantine Programs, wherein the former agrees to comply with the requirements of...

  10. 7 CFR 91.3 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Authority. 91.3 Section 91.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections... AND GENERAL INFORMATION Administration § 91.3 Authority. The Deputy Administrator is charged with the...

  11. 19th July 2010 - Italian Senators and Deputies on the occasion of the Third World Conference of Speakers of Parliament, visiting CMS control room with CERN Director-General R. Heuer.

    CERN Document Server

    Jean-Claude Gadmer

    2010-01-01

    CERN-HI-1007208 01: In the CMS surafce building 3578, from left to right: ALICE Collaboration Spokesperson elect P. Giubellino, Guest Professor and Former Italian Senator G. Basini, Technology Deputy Department Head L. Rossi, Vice President House R. Buttiglione, Vice President of the Italian Senate V. Chiti,Engineering Department Head R. Saban, Permanent Representative of Italy to the UN Ambassador L. Mirachian, CMS Collaboration Spokesperson G. Tonelli, Director for Research and Computing S. Bertolucci.

  12. 18 January 2011 - Ing. Vittorio Malacalza, ASG Superconductors S.p.A, Italy in the LHC superconducting magnet test hall with Deputy Department Head L. Rossi, in the LHC tunnel at Point 5 and CMS experimental area with Spokesperson G. Tonelli.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    18 January 2011 - Ing. Vittorio Malacalza, ASG Superconductors S.p.A, Italy in the LHC superconducting magnet test hall with Deputy Department Head L. Rossi, in the LHC tunnel at Point 5 and CMS experimental area with Spokesperson G. Tonelli.

  13. 10 January 2011 - Former Minister of Science and Technology Honorary Member of the National Academy of Engineering of Korea J.-U.SEO in the CMS underground experimental area with Deputy Spokesperson J. Incandela, Former Adviser D. Blechschmidt and Adviser R. Voss.

    CERN Multimedia

    Maximilien brice

    2011-01-01

    10 January 2011 - Former Minister of Science and Technology Honorary Member of the National Academy of Engineering of Korea J.-U.SEO in the CMS underground experimental area with Deputy Spokesperson J. Incandela, Former Adviser D. Blechschmidt and Adviser R. Voss.

  14. 7 May 2013 - Ambassador of the Federal Republic of Germany to Switzerland and Liechtenstein P. Gottwald and Mrs Gottwald in the ATLAS experimental cavern and LHC tunnel with Collaboration Deputy Spokesperson T. Wengler and German Scientists A. Schopper and V. Mertens.

    CERN Multimedia

    Maximilien Brice

    2013-01-01

    7 May 2013 - Ambassador of the Federal Republic of Germany to Switzerland and Liechtenstein P. Gottwald and Mrs Gottwald in the ATLAS experimental cavern and LHC tunnel with Collaboration Deputy Spokesperson T. Wengler and German Scientists A. Schopper and V. Mertens.

  15. 12 December 2012 - US NSF Physics Division Acting Director D. Caldwell signing the guest book with Adviser for the US R. Voss and Head of International Relations F. Pauss; CMS Collaboration Spokesperson J. Incandela and ATLAS Deputy Spokesperson A. Lankford present.

    CERN Multimedia

    Samuel Morier-Genoud

    2012-01-01

    12 December 2012 - US NSF Physics Division Acting Director D. Caldwell signing the guest book with Adviser for the US R. Voss and Head of International Relations F. Pauss; CMS Collaboration Spokesperson J. Incandela and ATLAS Deputy Spokesperson A. Lankford present.

  16. 77 FR 19138 - Fisheries of the Northeastern United States; Northeast Multispecies Fishery Management Plan...

    Science.gov (United States)

    2012-03-30

    ..., Acting Deputy Assistant Administrator for Regulatory Programs, National Marine Fisheries Service. For the... recruitment; virtual population analysis results and other estimates of stock size; sea sampling, port...

  17. 7 CFR 360.100 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Administrator. The Deputy Administrator of the Plant Protection and Quarantine Programs of the Animal and Plant Health Inspection Service of the Department, or any other officer or employee of the Plant Protection and... his stead. Plant Protection and Quarantine Programs. The Plant Protection and Quarantine Programs...

  18. 77 FR 59980 - Established Aggregate Production Quotas for Schedule I and II Controlled Substances and...

    Science.gov (United States)

    2012-10-01

    ... CFR 0.100. The Administrator, in turn, has redelegated this function to the Deputy Administrator... Alpha-methyltryptamine (AMT) 12 g Aminorex 12 g Benzylmorphine 2 g Betacetylmethadol 2 g Beta-hydroxy-3-methylfentanyl 2 g Beta-hydroxyfentanyl 2 g Betameprodine 2 g Betamethadol 2 g [[Page 59982

  19. 7 CFR 718.301 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... MARKETING QUOTAS, ACREAGE ALLOTMENTS, AND PRODUCTION ADJUSTMENT PROVISIONS APPLICABLE TO MULTIPLE PROGRAMS... administered by the Farm Service Agency under chapters VII and XIV of this title, except for an agricultural....). Administration of this subpart shall be under the supervision of the Deputy Administrator, except that such...

  20. 76 FR 51415 - Ideal Pharmacy Care, Inc., D/B/A Esplanade Pharmacy; Revocation of Registration

    Science.gov (United States)

    2011-08-18

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration Ideal Pharmacy Care, Inc., D/B/A Esplanade Pharmacy; Revocation of Registration On November 12, 2010, I, the then Deputy Administrator of the Drug... Pharmacy Care, Inc., d/b/a Esplanade Pharmacy (Registrant), of New Orleans, Louisiana. The Show Cause Order...

  1. 41 CFR 102-34.65 - How may we request an exemption from the fuel economy standards?

    Science.gov (United States)

    2010-07-01

    ... exemption from the fuel economy standards? 102-34.65 Section 102-34.65 Public Contracts and Property... an exemption from the fuel economy standards? You must submit a written request for an exemption from the fuel economy standards to: Administrator, General Services Administration, ATTN: Deputy Associate...

  2. 7 CFR 718.3 - State committee responsibilities.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE FARM MARKETING QUOTAS, ACREAGE ALLOTMENTS, AND PRODUCTION ADJUSTMENT PROVISIONS APPLICABLE TO... digital images. (b) The State committee shall submit to the Deputy Administrator requests to deviate from...

  3. 75 FR 51523 - Notice of Meeting of the Transit Rail Advisory Committee for Safety (TRACS)

    Science.gov (United States)

    2010-08-20

    ... Regional Transit Authority Alvin H. Pearson, Memphis Area Transit Authority Ed Watt, Transport Workers..., Deputy Associate Administrator, Office of Program Management, FTA. The tentative agenda for the first...

  4. 75 FR 59209 - Certain Coated Paper Suitable for High-Quality Print Graphics Using Sheet-Fed Presses from...

    Science.gov (United States)

    2010-09-27

    .... Lorentzen, Deputy Assistant Secretary for Import Administration, from Susan Kuhbach, Director, Office 1.... Provision of Standing Timber for Less Than Adequate Remuneration 2. Government Prohibition of Log Exports 3...

  5. 78 FR 79662 - Stainless Steel Plate in Coils From Belgium: Final Results of Antidumping Duty Administrative...

    Science.gov (United States)

    2013-12-31

    ... Secretary, for Antidumping and Countervailing Duty Operations, through Melissa Skinner, Director, Office III... Duty Operations, through Melissa Skinner, Director, Office III Antidumping and Countervailing Duty..., Deputy Assistant Secretary, for Antidumping and Countervailing Duty Operations, through Melissa Skinner...

  6. Task Force to Improve Timeliness of Senior Official Administrative Investigations

    Science.gov (United States)

    2014-11-04

    of Staff of the Army, or The Inspector General ( TIG ). When directed, DAIG-IN conducts investigations of systemic issues affecting the Army. The...develop the investigative plan. TIG and/or Deputy TIG notify the subject(s), rater, and senior rater of the investigation and provide the general nature...officers and SES equivalents. TIG approves all substantiated cases regardless of rank. DoD OIG Oversight After the Office of The Inspector General

  7. 76 FR 20034 - Calvin Ramsey, M.D.; Revocation of Registration

    Science.gov (United States)

    2011-04-11

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration [Docket No. 10-25] Calvin Ramsey, M.D.; Revocation of Registration On December 18, 2009, the Deputy Assistant Administrator, Office of Diversion... constitutional right to appointed counsel in a proceeding under 21 U.S.C. 824(a). See Goldberg v. Kelly, 397 U.S...

  8. 7 CFR 1700.27 - Chief of Staff.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Chief of Staff. 1700.27 Section 1700.27 Agriculture... GENERAL INFORMATION Agency Organization and Functions § 1700.27 Chief of Staff. The Chief of Staff aids and assists the Administrator and the Deputy Administrator. The Chief of Staff advises the...

  9. 7 CFR 996.40 - Handling standards.

    Science.gov (United States)

    2010-01-01

    ... other means that is acceptable to the Inspection Service. The crop year or quota year shown on the... Epstein, Deputy Administrator, Science and Technology Programs, AMS, USDA, 1400 Independence Avenue, SW...

  10. 76 FR 50272 - Senior Executive Service (SES) Performance Review Board; Members

    Science.gov (United States)

    2011-08-12

    ... Administration are: Debra Steidel Wall, Deputy Archivist of the United States, Thomas E. Mills, Chief Operating Officer, Analisa J. Archer, Chief Human Capital Officer, and Micah M. Cheatham, Chief Financial Officer...

  11. 7 CFR 54.1032 - Denial or withdrawal of service.

    Science.gov (United States)

    2010-01-01

    ... agent in the scope of the person's employment or agency: (i) Has wilfully made any misrepresentation or... violative features under supervision of the Deputy Administrator or Chief: And provided further, That...

  12. Perdagangan burung-burung paruh bengkok di Bali

    Directory of Open Access Journals (Sweden)

    W Widodo

    2012-02-01

    Full Text Available The survey was carried out to know some aspects of the bird trade in Bali on May 2002, especially to observe the diversity and abundance of species of Psittacidae Family along with their problems. The survey was done by direct observations and interview to the traders in the Sanglah and Satria Bird Markets, Denpasar-Bali. The total of 80 spescies of birds were traded in Bali and most of them i.e.: 75 species or 1577 individuals were found in the Satria bird market, but only 37 species or 393 individuals traded in the Sanglah bird market. Psittacidae family was found more abundantly, i.e.: 428 individiuals in 13 species of parrots. Those spesies of parrots were: Violet-necked Lory (Eos squamata, Blue-streaked Lory (E. reticulata, Red Lory (E. bornea, Rainbow Lorikeet (Trichoglossus haematodus, Chattering Lory (Lorius garrulus, Cockatail Australia (Nymphicus hollandicus, Moustached Parrakeet (Psittacula alexandri, Peach-faced Lovebird (Agapornis roseicollis, Fischer’s Lovebird (A. fischeri, Masked Lovebird (A. personata, Bali Hanging Parrot (Loriculus pusillus and Budgerigar (Melopsittacus undulatus. The Rainbow Lorikeet was found more abundant than another species of parrots, but Bali or Javan Hanging Parrot was very rare. The most catching area of Psittacidae was about 45% from Moluccas Islands.

  13. 14 November 2013 - Bangladesh Ministry of Education Secretary K.AN. Chowdhury signing an Expression of Interest and CERN guest book with CERN Director-General R. Heuer. Ambassador to the UNOG A. Hannan and CERN Deputy Head of International Relations E. Tsesmelis also present.

    CERN Multimedia

    Maximilien Brice

    2013-01-01

    14 November 2013 - Bangladesh Ministry of Education Secretary K.AN. Chowdhury signing an Expression of Interest and CERN guest book with CERN Director-General R. Heuer. Ambassador to the UNOG A. Hannan and CERN Deputy Head of International Relations E. Tsesmelis also present.

  14. 23rd May 2008 - CERN Director-General R. Aymar with German Federal Minister of Education and Research A. Schavan, CERN Director-General Designate R. Heuer, Swiss Federal Councillor M. Calmy-Rey and CERN Deputy Director-General and Chief Scientific Officer J. Engelen.

    CERN Multimedia

    Maximilien Brice

    2008-01-01

    23rd May 2008 - CERN Director-General R. Aymar with German Federal Minister of Education and Research A. Schavan, CERN Director-General Designate R. Heuer, Swiss Federal Councillor M. Calmy-Rey and CERN Deputy Director-General and Chief Scientific Officer J. Engelen.

  15. Signature of MoU between CERN and Australian Collaboration for Accelerator Science (ACAS); Roger Rassool, ACAS Director; Mark Boland, ACAS Deputy Director; Jean-Pierre Delahaye, CLIC Project Leader; in the presence of Rolf Heuer, Director-General and Emmanuel Tsesmelis, Adviser for Australia

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    Signature of MoU between CERN and Australian Collaboration for Accelerator Science (ACAS); Roger Rassool, ACAS Director; Mark Boland, ACAS Deputy Director; Jean-Pierre Delahaye, CLIC Project Leader; in the presence of Rolf Heuer, Director-General and Emmanuel Tsesmelis, Adviser for Australia

  16. Creating Environments Through the Art of Occupational Therapy

    Directory of Open Access Journals (Sweden)

    Lydia Royeen

    2016-07-01

    Full Text Available Dr. Lori Reynolds has an interest in therapeutic gardens and the creation of living spaces that promote wellbeing for older adults. Dr. Reynolds educates various stakeholders on the benefits of occupational therapy, including landscape architects and senior living administrators. Her advocacy to expand occupational therapy beyond its mainstream roles is infectious. She speaks passionately about her work in helping to create therapeutic gardens and how her role as an occupational therapist offers great perspective in this process. She appreciates the environmental impact on an individual’s health and well-being and practices from a personenvironment-occupation theory

  17. 17 CFR 140.72 - Delegation of authority to disclose confidential information to a contract market, registered...

    Science.gov (United States)

    2010-04-01

    ... Regional Administrators, each of the Directors of the Market Surveillance Branches, the Chief Economist of the Office of the Chief Economist, the Deputy Chief Economist of the Office of the Chief Economist...

  18. 75 FR 47620 - Notice of Availability of the Final Environmental Impact Statement and Proposed Amendment to the...

    Science.gov (United States)

    2010-08-06

    ... Southern California Edison (SCE) Pisgah Substation; an administration building; a main services complex.... Authority: 40 CFR 1506.6 and 1506.10; and 43 CFR 1610.2. Thomas Pogacnik, Deputy State Director, Natural...

  19. Management of Foreign Military Sales Design and Construction Services

    National Research Council Canada - National Science Library

    Young, Shelton

    1995-01-01

    ...) design and construction services. In addition, we examined the role of the Air Force in the administration of FMS construction projects at the request of the then Assistant Deputy Under Secretary of Defense...

  20. Risk factors associated with musculoskeletal disorders of the neck and shoulder in the personnel of Kerman University of Medical Sciences.

    Science.gov (United States)

    Madadizadeh, Farzan; Vali, Leila; Rafiei, Sima; Akbarnejad, Zahra

    2017-05-01

    Musculoskeletal disorders (MSDs) of the neck and shoulder are the most common and most influential factors causing disorder in the performance and absenteeism of work in administrative personnel. To identify risk factors which affect musculoskeletal disorders of neck and shoulder areas in headquarters staff of Kerman University of Medical Sciences. The present cross-sectional study was conducted in 2015 on 282 headquarters personnel of Kerman University of Medical Sciences (Kerman, Iran). The desired headquarters staff were selected from seven Deputy Vice-Chancellors of Kerman University of Medical Sciences, including Deputy of Health; Deputy of Treatment; Deputy of Education; Deputy of Students and Cultural Affairs; Deputy of Food and Drugs; Deputy of Management Development and Resource Planning; Deputy of Research and Technology, and data were gathered by using a standard Nordic musculoskeletal questionnaire NMQ (Nordic) and were analyzed by using SPSS version 16. The impact of various factors on the most common complications (neck and shoulder pains) was analyzed separately through logistic regression analysis and detailed Odds Ratio (OR) was calculated for each individual. The occurrence of neck and shoulder pains in headquarters staff were 42.14% and 40.71%, respectively. In the prevalence of neck pain variables such as marital status (single than married p=0.01, OR=0.24), work experience (p=0.03, OR=1.07 ), education (bachelor's degree and lower than master's degree and higher p=0.003, OR=2.69), right / left-handedness (left than right p=0.03, OR=0.33), weight (p=0.04, OR=1.04), place of work (prisk factors and some of which were identified and an amount of their influence in this study was found. Therefore, it is suggested by considering the risk factors and planning control programs, a major step is taken in reducing the musculoskeletal disorders of office staff.

  1. 78 FR 40186 - Proposed Aggregate Production Quotas for Schedule I and II Controlled Substances and Proposed...

    Science.gov (United States)

    2013-07-03

    ... Administrator, in turn, has redelegated this function to the Deputy Administrator, pursuant to 28 CFR 0.104. The...-methylthiofentanyl 2 g Alpha-methyltryptamine (AMT) 25 g Aminorex 25 g Benzylmorphine 2 g Betacetylmethadol 2 g Beta-hydroxy-3-methylfentanyl 2 g Beta-hydroxyfentanyl 2 g Betameprodine 2 g Betaprodine 2 g Bufotenine 3 g...

  2. 78 FR 48193 - Final Adjusted Aggregate Production Quotas for Schedule I and II Controlled Substances and...

    Science.gov (United States)

    2013-08-07

    ... Administrator, in turn, has redelegated this function to the Deputy Administrator, pursuant to 28 CFR 0.104. DEA... Alpha-methyltryptamine (AMT) 12 g Aminorex 12 g Benzylmorphine 2 g Betacetylmethadol 2 g Beta-hydroxy-3-methylfentanyl 2 g Beta-hydroxyfentanyl 2 g Betameprodine 2 g Betamethadol 2 g Betaprodine 2 g Bufotenine 3 g...

  3. 77 FR 42688 - Snapper-Grouper Fishery Off the Southern Atlantic States; Snapper-Grouper Management Measures

    Science.gov (United States)

    2012-07-20

    ... values as a catch limit is a risk-averse approach that sacrifices some yield over the short-term to gain... Islands. Dated: July 17, 2012. Samuel D. Rauch III, Deputy Assistant Administrator for Regulatory Programs...

  4. 23 July - Italian Director-General for Prevention G. Ruocco and Director-General for European and International Relations Ministry of Health D. Roderigo visiting the ATLAS experimental cavern with ATLAS Deputy Spokesperson B. Heinemann. Life Sciences Section M. Cirilli and Life Sciences Adviser M. Dosanjh present.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    23 July - Italian Director-General for Prevention G. Ruocco and Director-General for European and International Relations Ministry of Health D. Roderigo visiting the ATLAS experimental cavern with ATLAS Deputy Spokesperson B. Heinemann. Life Sciences Section M. Cirilli and Life Sciences Adviser M. Dosanjh present.

  5. 27 November 2013 - Greek Deputy Minister of Health Z. Makri with Governor of Thessaly K. Agorastos visiting the LHC superconducting magnet test hall with Senior Scientists D. Delikaris, E. Hatziangeli and E. Tsesmelis. E. Gazis, ATLAS Collaboration, National Technical University of Athens also present.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    27 November 2013 - Greek Deputy Minister of Health Z. Makri with Governor of Thessaly K. Agorastos visiting the LHC superconducting magnet test hall with Senior Scientists D. Delikaris, E. Hatziangeli and E. Tsesmelis. E. Gazis, ATLAS Collaboration, National Technical University of Athens also present.

  6. NASA Officials in MCC to decide whether to land Apollo 16 or cancel landing

    Science.gov (United States)

    1972-01-01

    NASA Officials gather around a console in the Mission Operations Control Room (MOCR) in the Mission Control Center (MCC) prior to the making of a decision whether to land Apollo 16 on the moon or to abort the landing. Seated, left to right, are Dr. Christopher C. Kraft Jr., Director of the Manned Spacecraft Center (MSC), and Brig. Gen. James A. McDivitt (USAF), Manager, Apollo Spacecraft Program Office, MSC; and standing, left to right, are Dr. Rocco A. Petrone, Apollo Program Director, Office Manned Space Flight (OMSF), NASA HQ.; Capt. John K. Holcolmb (U.S. Navy, Ret.), Director of Apollo Operations, OMSF; Sigurd A. Sjoberg, Deputy Director, MSC; Capt. Chester M. Lee (U.S. Navy, Ret.), Apollo Mission Director, OMSF; Dale D. Myers, NASA Associate Administrator for Manned Space Flight; and Dr. George M. Low, NASA Deputy Administrator.

  7. 77 FR 69377 - Delegation of Authority and Assignment of Responsibility to the Administrative Review Board

    Science.gov (United States)

    2012-11-16

    ...) Unemployment Compensation for Ex-Servicemembers Program, 5 U.S.C. Sec. 8521-8525; 20 CFR Part 614; (59) Vietnam... legal advice to the Secretary, the Deputy Secretary, and other officials of the Department with respect.... The Solicitor of Labor may also provide legal advice and assistance to the Chair and/or Vice- Chair of...

  8. 16 December 2013 - Hooke Professor of Experimental Physics and Pro Vice Chancellor University of Oxford Prof. I. Walmsley visiting the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler, Physics Department, ATLAS Collaboration P. Wells and Chair, CMS Collaboration Board, Oxford University and Purdue University I. Shipsey

    CERN Document Server

    Anna Pantelia

    2013-01-01

    16 December 2013 - Hooke Professor of Experimental Physics and Pro Vice Chancellor University of Oxford Prof. I. Walmsley visiting the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler, Physics Department, ATLAS Collaboration P. Wells and Chair, CMS Collaboration Board, Oxford University and Purdue University I. Shipsey

  9. Chairman of the DELL Board of Directors and Chief Executive Officer Michael S. Dell with CERN Director-General R. Heuer and in front of the ATLAS detector (centre) with ATLAS Deputy Spokesperson A. Lankford (left) and Information Technology Department Head F. Hemmer on 26th January 2010.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    Chairman of the DELL Board of Directors and Chief Executive Officer Michael S. Dell with CERN Director-General R. Heuer and in front of the ATLAS detector (centre) with ATLAS Deputy Spokesperson A. Lankford (left) and Information Technology Department Head F. Hemmer on 26th January 2010.

  10. 78 FR 30861 - Membership of the Office of the Secretary Performance Review Board

    Science.gov (United States)

    2013-05-23

    ... of Budget Lisa Casias, Director for Financial Management and Deputy Chief Financial Officer Office of... and Information Administration Leonard M. Bechtel, Chief Financial Officer and Director for... Theodore Constantine Johnston, Director, Office of White House Liaison Office of the Chief Financial...

  11. Commission on the Future of the United States Aerospace Industry

    Science.gov (United States)

    2002-11-01

    ballistics of a baseball, computing gas mileage in Corvettes, the chemistry of cosmetics , etc.) provokes student interest in core scientific areas... Fenton Carey, Deputy Director for Production Department of Transportation/Federal Aviation Administration Permanent Staff Mr. William J. Bihner, Jr

  12. 5 CFR 6401.103 - Prior approval for outside employment.

    Science.gov (United States)

    2010-01-01

    .... 6401.103 Section 6401.103 Administrative Personnel ENVIRONMENTAL PROTECTION AGENCY SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE ENVIRONMENTAL PROTECTION AGENCY § 6401.103 Prior approval... her Deputy Ethics Official before engaging in outside employment, with or without compensation, that...

  13. 76 FR 67761 - Hearing of the Attorney General's National Task Force on Children Exposed to Violence

    Science.gov (United States)

    2011-11-02

    ... and Delinquency Prevention (OJJDP). ACTION: Notice of hearing. SUMMARY: This is an announcement of the... public hearings, on comprehensive research, and on extensive input from experts, advocates, and impacted... Deputy Associate Administrator, Child Protection Division, Office of Juvenile Justice & Delinquency...

  14. 76 FR 20042 - Four Seasons Distributors, Inc.; Order Accepting Settlement Agreement and Terminating Proceeding

    Science.gov (United States)

    2011-04-11

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration [Docket No. 08-16] Four Seasons Distributors, Inc.; Order Accepting Settlement Agreement and Terminating Proceeding On October 31, 2007, the Deputy... Show Cause to Four Seasons Distributors, Inc. (Respondent), of Belleville, Illinois. The Show Cause...

  15. Developing the Conflicts Management Model for School Administrators of Secondary School under the Office of Secondary Educational Service Area 20

    Directory of Open Access Journals (Sweden)

    Pornpan Ruangrit

    2017-09-01

    Full Text Available This study aimed to 1 investigate the cause of conflict which in the secondary schools under the Secondary School under the Office of Secondary Educational Service Area 20, 2 study the conflict management method which administrators applied in Secondary School under the Office of Secondary Educational Service Area 20, and 3 develop conflict management model for Secondary School under the Office of Secondary Educational Service Area 20. The participants were 115 school administrators (44 school directors and 71 deputy directors which were selected by random sampling technique. The research instruments included a questionnaire, which reliability value was 0.97, and an interview schedule that were administered to the respondents. The data were analyzed by frequency, percentage, mean, and standard deviation. The result of the study showed that: 1. the causes of conflict in Secondary School under the Office of Secondary Educational Service Area 20 in overall was at the high level with the mean of 4.21, the internal conflict was at the high level with the mean of 4.22, and the external conflict was at the high level with the mean of 4.19. 2. Overall, conflict management method used by administrators in Secondary School under the Office of Secondary Educational Service Area 20was at a high level. Considering each aspect, the compromising method was the highest level at 4.48. 3. Developing conflict management model in Secondary School under the Office of Secondary Educational Service Area 20 were the collaboration and making understand method. These should be used for conflict management to achieve the success and to reach the standard which including responsibility, accountability, equality, teamwork, and communication competence.

  16. Schedules of controlled substances: temporary placement of three synthetic cannabinoids into Schedule I. Final order.

    Science.gov (United States)

    2013-05-16

    The Deputy Administrator of the Drug Enforcement Administration (DEA) is issuing this final order to temporarily schedule three synthetic cannabinoids under the Controlled Substances Act (CSA) pursuant to the temporary scheduling provisions of 21 U.S.C. 811(h). The substances are (1-pentyl-1H-indol-3-yl)(2,2,3,3-tetramethylcyclopropyl)methanone (UR-144), [1-(5-fluoro-pentyl)-1H-indol-3-yl](2,2,3,3-tetramethylcyclopropyl)methanone (5-fluoro-UR-144, XLR11) and N-(1-adamantyl)-1-pentyl-1H-indazole-3-carboxamide (APINACA, AKB48). This action is based on a finding by the Deputy Administrator that the placement of these synthetic cannabinoids and their salts, isomers and salts of isomers into Schedule I of the CSA is necessary to avoid an imminent hazard to the public safety. As a result of this order, the full effect of the CSA and the Controlled Substances Import and Export Act (CSIEA) and their implementing regulations including criminal, civil and administrative penalties, sanctions and regulatory controls of Schedule I substances will be imposed on the manufacture, distribution, possession, importation, and exportation of these synthetic cannabinoids.

  17. Making Sense of an Unstable Legislature: Committee Assignments in the Argentine Chamber of Deputies, 1946–2001 La lógica de una legislatura inestable: la distribución de comisiones en la Cámara de Diputados Argentina, 1946-2001

    Directory of Open Access Journals (Sweden)

    Silvina Lilian Danesi

    2011-01-01

    Full Text Available Latin American legislatures have gone largely unstudied, with the functioning of the Argentine Chamber of Deputies prior to the 1980s being an entirely unexplored subject. This paper fills that gap by examining the organization of the Chamber, with particular focus on its standing committee system from 1946 to 2001. We assess the portability of two U.S.-based theoretical approaches to legislative organization by applying them to committee assignments. An original data set of Argentine deputies was constructed and a way of measuring political power in committees was devised for this study. Despite weak democratic governments, military interventions, and changes to the electoral system, we find that ruling parties have consistently influenced the committee system, shaping its structure and securing an over-proportion of their deputies in key committee positions. These results support the applicability of the U.S. originated Cartel Theory of legislative organization to understanding and studying legislatures outside that country.Las legislaturas latinoamericanas no han recibido debida atención. Un caso emblemático es la Cámara de Diputados Argentina, cuyo funcionamiento previo a los 1980’s ha sido inexplorado. Este artículo persigue llenar ese vacío examinando la organización de su sistema de comisiones permanentes desde 1946 hasta 2001. Para ello, evaluamos la aplicabilidad de dos teorías norteamericanas sobre organización legislativa para analizar la integración de comisiones, creamos una base de datos de diputados argentinos y diseñamos una forma de medir su poder político en las comisiones. A pesar de la inestabilidad institucional y los cambios de sistema electoral, los resultados demuestran que los partidos que controlaron la Cámara influenciaron en forma sistemática el sistema de comisiones, cambiando su estructura y asegurando la sobrerrepresentación de sus diputados en cargos clave. El estudio confirma, asimismo, la

  18. 75 FR 35838 - Controlled Substances: Proposed Revised Aggregate Production Quotas for 2010

    Science.gov (United States)

    2010-06-23

    ... CFR 0.100. The Administrator in turn, has redelegated this function to the Deputy Administrator...-methyltryptamine (AMT) 2 g 2 g Aminorex 2 g 2 g Benzylmorphine 2 g 2 g Betacetylmethadol 2 g 2 g Beta-hydroxy-3-methylfentanyl 2 g 2 g Beta-hydroxyfentanyl 2 g 2 g Betameprodine 2 g 2 g Betamethadol 2 g 2 g Betaprodine 2 g 2...

  19. 28 CFR 0.164 - Civil claims that may be closed by Assistant Attorneys General.

    Science.gov (United States)

    2010-07-01

    ... Assistant Attorneys General. 0.164 Section 0.164 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION... General. Assistant Attorneys General are authorized, with respect to matters assigned to their respective... proposed closing should receive the personal attention of the Attorney General, the Deputy Attorney General...

  20. Examining the Role of Transformational Leadership in Technology Adoption: Evidence from Bruneian Technical & Vocational Establishments (TVE)

    Science.gov (United States)

    Seyal, Afzaal H.

    2015-01-01

    This pioneering study discusses the thirty-five Bruneian technical & vocational institutions of top management (principals, deputy principals, senior masters, ICT coordinators and technical administrators) leadership style with the adoption of Information and Communication Technologies (ICT). The study uses a survey approach further to…

  1. 75 FR 70619 - Standards of Conduct and Referral of Known or Suspected Criminal Violations; Disclosure to...

    Science.gov (United States)

    2010-11-18

    ... this ANPRM addresses this topic. E. Remuneration to Boards of Directors in Connection With Conclusion... Meter, Deputy Director, Office of Regulatory Policy, Farm Credit Administration, 1501 Farm Credit Drive... the disclosure of, certain payments to System institution directors; and Providing audit committees...

  2. 76 FR 9837 - Excepted Service

    Science.gov (United States)

    2011-02-22

    ... Associate GS110010......... 12/29/2010 Communications and Administrator for Marketing. Communications and.... Office of Deputy Director, DA110016......... 12/01/2010 Communications. Operations. Office of the General... DEFENSE Office of the Under Senior DD110019......... 12/03/2010 Secretary of Defense Communications...

  3. 29 CFR Appendix A to Part 70 - Disclosure Officers

    Science.gov (United States)

    2010-07-01

    ... Deputy Secretary for Adjudication (18) Women's Bureau (19) Employees' Compensation Appeals Board (20... Administrative Appeals Judge, Benefits Review Board (BRB) 22. Director, Women's Bureau (WB) 23. National Office..., 170 S. Independence Mall West, Philadelphia, PA 19106-2205. 3. Atlanta Federal Center, 61 Forsyth...

  4. Reorientation of Educational Deputy of Ministry of Health and Medical Education in accreditation and evaluation

    Directory of Open Access Journals (Sweden)

    Einollahi B

    2004-01-01

    Full Text Available Background. Recently the Government of Islamic Republic of Iran has considered radical changes and innovation in the structure of medical education at all levels. Therefore the “Accreditation and Evaluation Plan of Medical Universities in Iran” is approved and emphasized in the Third 5-Year Development Program. Method. The Educational Deputy (ED of Ministry of Health and Medical Education (MOHME considered three main plans: (1 Goal-based internal evaluation, and external evaluation of educational departments of medical universities based on internal evaluation. In 1995-6 ED began the internal evaluation, defining quality as fitness for purpose; and in 2000 started the external evaluation in some medical schools as a pilot study, based on previous internal evaluation. (2 Collaboration with World Federation for Medical Education (WFME, according to International Standards for Basic Medical Education Pilot Studies. Shiraz Medical University was co-opted by WFME to collaborate in the first stage; three medical universities (Tehran, Shahid Beheshti and Ahvaz are accepted for the second stage. (3 The project of “Standardization of Medical Education in Iran for Achieving International Accreditation”. This process is being performed in several steps: (a Study of three different sets of national (Australia, US and Mexico and international (WFME standards; (b Collection of the experts’ viewpoints specialized in medical education in this regard; (c Development of the first action plan; and (d Conduction of this project as pilot study in a number of medical universities. Results. Having primary results disseminated, motivated many other medical universities so that some announced their readiness to begin internal and external evaluation or standardization process. Conclusion. Regarding the importance of quality improvement in medical education, it is expected that even if this process would not lead to international accreditation acquisition, it

  5. The Impact of Job Satisfaction on the Turnover Intent of Executive Level Central Office Administrators in Texas Public School Districts: A Quantitative Study of Work Related Constructs

    Directory of Open Access Journals (Sweden)

    Johnny O’Connor

    2018-05-01

    Full Text Available The purpose of this study was to examine the relationship between job satisfaction and turnover intent of executive level central office administrators in Texas public school districts. For the intent of this study, executive level central office administrators were defined as staff members who serve in one of the following roles in a school district: assistant, associate, area, or deputy superintendent. The data were collected from a random sample of 234 participants in which survey instruments of job satisfaction and turnover intent were used. Each instrument was created on a five-point Likert scale. Based on the results of the study, it was concluded that a moderate inverse relationship exists between job satisfaction and turnover intent and job satisfaction explained 41.3% of an executive level central office administrator’s intent for turnover. Research related to this employee group is lacking. Therefore, not much is known regarding how it relates to their attitude towards work-related factors. Learning more about job satisfaction and turnover intention of these individuals could have long term implications since it relates to mitigating the shortage of superintendent candidates available to fill the growing number of vacancies as well as recruitment, retention, and increased work productivity of these staff.

  6. CARBON TRADING AND FOREST SEQUESTRATION: CAN FORESTS LIVE UP TO THE BILLING?

    Science.gov (United States)

    A growing number of public officials, scientists, and members of the public and private sector suggest that the effects of climate change could affect the environment and economy of Alaska. Accordingly, Region 10 has been given an "Eco-Region" assignment by EPA's Deputy Administr...

  7. 29 CFR 1921.3 - Complaints.

    Science.gov (United States)

    2010-07-01

    ... Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) RULES OF PRACTICE IN ENFORCEMENT PROCEEDINGS UNDER SECTION 41 OF THE LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT Prehearing Procedures § 1921.3 Complaints. (a) Issuance. The Deputy Solicitor of Labor shall...

  8. 78 FR 52955 - Changes in Flood Hazard Determinations

    Science.gov (United States)

    2013-08-27

    ... community that the Deputy Associate Administrator for Mitigation reconsider the changes. The flood hazard...; Internal Agency Docket No. FEMA-B-1349] Changes in Flood Hazard Determinations AGENCY: Federal Emergency... modification of Base Flood Elevations (BFEs), base flood depths, Special Flood Hazard Area (SFHA) boundaries or...

  9. 45 CFR 73.735-806 - Documentation and publication of opinions.

    Science.gov (United States)

    2010-10-01

    ...-806 Section 73.735-806 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION... Department Ethics Counselor, deputy ethics counselors, and any other individuals required to be involved in... Department Ethics Counselor shall publish summaries of advisory opinions issued by his or her office...

  10. 28 June 2012 - Ambassador I. Piperkov, Permanent Representative of Bulgaria to the United Nations Office and other international organisations in Geneva and Spouse visiting CMS experimental area with Collaboration Deputy Spokesperson T. Camporesi and CERN Control Centre with M. Benedikt.Senior physicist L. Litov accompanies the delegation throughout.

    CERN Multimedia

    Jean-Claude Gadmer

    2012-01-01

    28 June 2012 - Ambassador I. Piperkov, Permanent Representative of Bulgaria to the United Nations Office and other international organisations in Geneva and Spouse visiting CMS experimental area with Collaboration Deputy Spokesperson T. Camporesi and CERN Control Centre with M. Benedikt.Senior physicist L. Litov accompanies the delegation throughout.

  11. 27 February 2012- Thai Minister of Science and Technology P. Suraswadi with International Relations Adviser E. Tsesmelis and CMS Collaboration Former Deputy Spokesperson A. De Roeck signing the guest book in the 6th floor conference room, building 60 and visiting CMS underground experimental area at LHC Point 5.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    27 February 2012- Thai Minister of Science and Technology P. Suraswadi with International Relations Adviser E. Tsesmelis and CMS Collaboration Former Deputy Spokesperson A. De Roeck signing the guest book in the 6th floor conference room, building 60 and visiting CMS underground experimental area at LHC Point 5.

  12. BRAZILIAN ADMINISTRATION, ADMINISTRATIVE REFORM AND THE NEW STATE: THE ROLE OF ADMINISTRATIVE APPARATUS IN VARGAS ADMINISTRATION

    Directory of Open Access Journals (Sweden)

    Emerson Moura

    2016-07-01

    Full Text Available The role played by the administrative apparatus through the Department of Administrative Services in the Government policy Vargas is the object put in debate. Analyzes the theme from the the investigation of patrimonial, authoritarian and inefficient context which marks the formation and development of administrative bureaucracy, the tenders of professionalization and efficiency brought by the administrative reforms of the 1930s and 1940s with the contrast of the limitations of the import of the Weberian model in the Brazilian context and analysis of the establishment of the New State DASP and their assignments. Search the work demonstrate the control position he held directly and through the State Departments in the Brazilian Public Administration ensuring centralized and developmental policy of the government. For this is adopted as the research method of approach structuralism in order to identify the deconstruction of the phenomenon - of administrative reforms - in the superficial perception - the proposed impersonality and efficiency as the best way of achieving the public interest - its invariant structure - the search for the adequacy of the administrative apparatus and bureaucracy for pursuit of political ends pursued by the Government.

  13. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available lori (strain J99) ... Length = 261 ... Query: 120 QIMAILNLTPDSFYEKSRFDSKKALEE...IYQWLEKGITLIDIGAASSRPQSEIIDPKVEQD 179 ... QIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQD Sbjct: 1 ... QIMAIL

  14. The administrative contract asimilated to administrative acts in administrative litigation

    Directory of Open Access Journals (Sweden)

    Silvia GORIUC

    2018-03-01

    Full Text Available An administrative contract is the will between a public authority either a person empowe¬red by it, and one or more natural or legal persons, whether private or public, pursuing the realization of a public interest and to which a special scheme of administrative law applies. The typology of administrative contracts is very varied, depending on the evolution of the society’s needs. Thus, they are currently included in the category of administrative contracts: concession contracts and public procurement contracts, contracts for the use of public goods, public management contracts, public-private partnership contracts, public lending contracts and constitutive documents of the associative structures of public authorities.

  15. Administrative Appeals and ADR in Danish Administrative Law

    DEFF Research Database (Denmark)

    Conradsen, Inger Marie; Gøtze, Michael

    2014-01-01

    Administrative Appeals, review, administrative tribunals, ombudsman, alternative dispute resolution......Administrative Appeals, review, administrative tribunals, ombudsman, alternative dispute resolution...

  16. 7 CFR 352.10 - Inspection; safeguards; disposal.

    Science.gov (United States)

    2010-01-01

    ... inspectors. 3 The Deputy Administrator, Plant Protection and Quarantine Programs, Animal and Plant Health... Plant Protection and Quarantine Programs 3 for information as to applicable conditions. If diversion or change of Customs entry is desired at port, confirmation will be given by the Plant Protection and...

  17. 6 CFR Appendix A to Part 5 - FOIA/Privacy Act Offices of the Department of Homeland Security

    Science.gov (United States)

    2010-01-01

    ... of the Secretary Office of the Deputy Secretary Office of the Under Secretary for Management B Office... Hazard Information System of the National Oceanic and Atmospheric Administration), National Oceanic and... Preparedness d. Strategic National Stockpile 2. Centers for Disease Control and Agency for Toxic Substances and...

  18. 20 CFR 362.4 - Delegation of authority.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Delegation of authority. 362.4 Section 362.4 Employees' Benefits RAILROAD RETIREMENT BOARD INTERNAL ADMINISTRATION, POLICY AND PROCEDURES EMPLOYEES' PERSONAL PROPERTY CLAIMS § 362.4 Delegation of authority. The Deputy General Counsel of the Board is...

  19. 7 CFR 371.6 - Wildlife Services.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Wildlife Services. 371.6 Section 371.6 Agriculture..., DEPARTMENT OF AGRICULTURE ORGANIZATION, FUNCTIONS, AND DELEGATIONS OF AUTHORITY § 371.6 Wildlife Services. (a) General statement. Wildlife Services (WS) manages problems caused by wildlife. (b) Deputy Administrator of...

  20. 5 CFR 6901.103 - Outside employment.

    Science.gov (United States)

    2010-01-01

    ... ETHICAL CONDUCT FOR EMPLOYEES OF THE NATIONAL AERONAUTICS AND SPACE ADMINISTRATION § 6901.103 Outside..., astronaut candidate, procurement officer, or chief counsel. (2) Outside employment means any form of... submitted to and reviewed by the employee's supervisor and by a Deputy Ethics Official or designee. (3...

  1. U.S. Army-Baylor University Health Care Administration Program: evidenced-based outcomes in the military health system.

    Science.gov (United States)

    Mangelsdorff, A David; Rogers, Jody; Finstuen, Kenn; Pryor, Rene

    2004-01-01

    The purpose of this research is to assess the impact of an educational program on the Military Health System on some of the evidence-based educational outcomes for the Individual (student) and the Society (all Army Medical Treatment Facilities). The U.S. Army-Baylor University HCA program provides a unique opportunity to assess the impact of an educational program on the Military Health System (MHS). Since the majority of the graduate students are military officers who serve in military medical treatment facilities (MTFs), tracking their career progression allows assessing the value added of the U.S. Army-Baylor University HCA experience from 1951 to 2001 (n = 2234). The context of Society outcomes includes all the Army MTFs where U.S. Army-Baylor University HCA graduates execute their leadership skills. During the time from 1994 to 2001, all of the Army MTFs in the MHS (n = 38) were examined by the Joint Commission on Accreditation of Healthcare Organizations (JCAHO). In a similar but shorter time frame (1997-2001), DoD patient satisfaction assessments were conducted. The Individual outcomes (career advancement, increase in status, higher professional association membership) demonstrate that the selection criteria used for program admission appear to be successful. The Society outcomes showed higher JCAHO scores and satisfied consumers in Army facilities with Baylor graduates as the Deputy Commander for Administration (DCA). Continued internal program assessments (curriculum reviews) and external reviews (Accrediting Commission on Education for Health Services Administration accreditations of 5 years in 1987, 8 years in 1993 and 7 years in 2001, and 7 ACHE student chapter awards) attest to the strengths of the U.S. Army-Baylor University HCA program. Educating the MHS shareholders (patients, beneficiaries, professional and support staff, senior leaders) and leveraging technology to. share best practices for all administrators (including non-Baylor graduates) will

  2. 40 CFR 303.33 - Filing a claim.

    Science.gov (United States)

    2010-07-01

    ... COMMUNITY RIGHT-TO-KNOW PROGRAMS CITIZEN AWARDS FOR INFORMATION ON CRIMINAL VIOLATIONS UNDER SUPERFUND... regulation is required to file a claim for such an award with the Deputy Assistant Administrator for Criminal... information was provided. (c) All claim submissions must be submitted to the Office of Criminal Enforcement...

  3. 28 CFR 0.19 - Associate Attorney General.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Associate Attorney General. 0.19 Section...-Office of the Associate Attorney General § 0.19 Associate Attorney General. (a) The Associate Attorney General shall advise and assist the Attorney General and the Deputy Attorney General in formulating and...

  4. 5 CFR 2635.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES... ethics official. (c) Agency ethics official refers to the designated agency ethics official or to the alternate designated agency ethics official, referred to in § 2638.202(b) of this chapter, and to any deputy...

  5. 7 CFR 356.7 - Petition for remission or mitigation of forfeiture.

    Science.gov (United States)

    2010-01-01

    ... the petitioner's attorney at law. If the petitioner is a business, the petition must be signed by a partner, officer, or petitioner's attorney at law. (d) Upon receiving the petition, the Deputy... Administrator finds that the forfeiture was incurred without willful negligence or without any intention on the...

  6. 7 CFR 62.204 - Authority to request service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Authority to request service. 62.204 Section 62.204 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... prove his/her financial interest in the product or service at the discretion of the Deputy Administrator. ...

  7. 77 FR 4887 - DOE Patent Licensing Regulations

    Science.gov (United States)

    2012-02-01

    ... administered by the National Nuclear Security Administration (NNSA) for NNSA facilities. The NNSA Deputy... issue a Family Policymaking Assessment for any rule or policy that may affect family well being. This rule will have no impact on family, the autonomy or integrity of the family as an institution...

  8. 78 FR 64941 - Government-Wide Travel Advisory Committee (GTAC); Public Advisory Committee Meetings

    Science.gov (United States)

    2013-10-30

    ... the cancellation of the GTAC November 7, 2013 meeting originally published on September 12, 2013 in... of the GTAC November 7, 2013 meeting originally published in the Federal Register at 78 FR 56231 on...: October 24, 2013. Carolyn Austin-Diggs, Acting Deputy Associate Administrator, Office of Asset and...

  9. 78 FR 26637 - Federal Travel Regulation (FTR); Relocation Allowance-Relocation Income Tax (RIT) Allowable Tables

    Science.gov (United States)

    2013-05-07

    ...: The GSA published FTR Amendment 2008-04, in the Federal Register on June 25, 2008 (73 FR 35952), specifying that GSA would no longer publish the RIT Allowance tables in Title 41 of the Code of Federal..., 2013. Carolyn Austin-Diggs, Principal Deputy Administrator, Office of Asset and Transportation...

  10. 19 July 2013 - Chairman of the Policy Committee, European Cancer Organisation, President, European Association for Cancer Research E. Celis visiting the ATLAS experimental cavern with ATLAS Collaboration Deputy Spokesperson, B. Heinemann and signing the Guest Book with Director for Accelerators and Technology S. Myers. Life Sciences Adviser M. Dosanjh present.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    19 July 2013 - Chairman of the Policy Committee, European Cancer Organisation, President, European Association for Cancer Research E. Celis visiting the ATLAS experimental cavern with ATLAS Collaboration Deputy Spokesperson, B. Heinemann and signing the Guest Book with Director for Accelerators and Technology S. Myers. Life Sciences Adviser M. Dosanjh present.

  11. 23rd May 2011 - University of Liverpool Pro-Vice-Chancellor and Public Orator K. Everest (UK) Mrs Everest in the ATLAS visitor centre with Collaboration Deputy Spokesperson D. Charlton, in LHCb surface building with Collaboration Spokesperson A. Golutvin, accompanied throughout by P. Wells and Liverpool University T. Bowcock and M. Klein.

    CERN Multimedia

    Maximilen Brice

    2011-01-01

    23rd May 2011 - University of Liverpool Pro-Vice-Chancellor and Public Orator K. Everest (UK) Mrs Everest in the ATLAS visitor centre with Collaboration Deputy Spokesperson D. Charlton, in LHCb surface building with Collaboration Spokesperson A. Golutvin, accompanied throughout by P. Wells and Liverpool University T. Bowcock and M. Klein.

  12. 21 October 2008 - LHC Inauguration - Czech Deputy Minister of Education, Youth and Sports, responsible for Science and Universities V. Ruzicka welcomed by CERN Director-General R. Aymar, CERN Chief Scientific Officer J. Engelen and CERN Financial Officer S. Lettow and signing the electronic guest book with CERN user R. Leitner.

    CERN Document Server

    CERN Photo Service

    2008-01-01

    21 October 2008 - LHC Inauguration - Czech Deputy Minister of Education, Youth and Sports, responsible for Science and Universities V. Ruzicka welcomed by CERN Director-General R. Aymar, CERN Chief Scientific Officer J. Engelen and CERN Financial Officer S. Lettow and signing the electronic guest book with CERN user R. Leitner.

  13. 10 February 2012 - Permanent Representative of the Republic of India to the Conference on Disarmament, United Nations Office at Geneva Ambassador Mehta signing the guest book with International Relations Adviser R. Voss;in the LHC tunnel at Point 2 and ALICE underground experimental area with Collaboration Deputy Spokesperson Y. Schutz.

    CERN Document Server

    Maximilien Brice

    2012-01-01

    10 February 2012 - Permanent Representative of the Republic of India to the Conference on Disarmament, United Nations Office at Geneva Ambassador Mehta signing the guest book with International Relations Adviser R. Voss;in the LHC tunnel at Point 2 and ALICE underground experimental area with Collaboration Deputy Spokesperson Y. Schutz.

  14. COMPOSITION OF THE JOINT ADVISORY APPEALS BOARDS 2000/2001 EXERCISE

    CERN Multimedia

    Human Resources Division

    2001-01-01

    Appointed by the Director-General  Appointed by the Staff Association Members Fréderick Bordry /sl Irene Seis/it 1st deputies Christian Fabjan/ep Jean-Claude Carlier/tis 2nd deputies Sue Foffano Morna Robillard/hr Mr Bordry and Mrs Seis have drawn up the following list of staff members from among whom the Chairman of the Board may be chosen when required: Christophe Delamare/est Guy Maurin/ep Maria Dimou/it Mats Moller/as Tobias Dobers/est Alasdair smith/ep Luc Durieu/ps Marilena Streit-Bianchi/tis Lennart Jirden/spl John Poole/sl Mediators [see Administrative Circular N° 6 (Rev. 1) entitled 'Review procedure'] will also be selected from this list of ten staff members.

  15. 7 CFR 330.208 - Courtesy permits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Courtesy permits. 330.208 Section 330.208 Agriculture... PRODUCTS; GARBAGE Movement of Plant Pests § 330.208 Courtesy permits. The Deputy Administrator may issue... subject to regulation under the Plant Protection Actor any other act, as a courtesy to facilitate movement...

  16. 20 CFR 802.206 - Effect of motion for reconsideration on time for appeal.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Effect of motion for reconsideration on time for appeal. 802.206 Section 802.206 Employees' Benefits BENEFITS REVIEW BOARD, DEPARTMENT OF LABOR... administrative law judge or deputy commissioner shall suspend the running of the time for filing a notice of...

  17. Educational Administration and the Social, Policy, and Administrative Sciences.

    Science.gov (United States)

    Kirkpatrick, Samuel A.

    1983-01-01

    The politics of education has been ignored in educational administration programs; it has been not enough taught in American programs for educational administrators and not enough emphasized in discussions of administrative roles. Administration increasingly includes political as well as rational decisions. Thus, administrators need a unified…

  18. S. 1439: Export Reorganization Act of 1976. Hearings before the Joint Committee on Atomic Energy, Congress of the United States, Ninety-Fourth Congress, Second Session on S. 1439, S. 3770, and H.R. 15273

    International Nuclear Information System (INIS)

    Anon.

    1976-01-01

    The hearing of July 28, 1976 on S. 1439, a bill to reorganize certain export functions of the Federal government, included statements from the following: Sen. John O. Pastore, Chairman, JCAE; Sen. Abraham Ribicoff; Sen. Charles H. Percy; Myron B. Kratzer, Deputy Ass't. Secy. for Nuclear Energy and Energy Technology, Dept. of State; Charles W. Robinson, Deputy Secy. of State; Dr. Robert W. Fri, Deputy Administrator, ERDA; Marcus A. Rowden, Chairman, NRC, accompanied by Commissioners Kennedy and Gilinsky; and the joint prepared statement of Senators Glenn, Percy, and Ribicoff. S. 1439 was unanimously rejected by the Joint Committee in open meeting on Aug. 26, 1976. Then on Aug. 31, 1976, the Joint Committee met to receive testimony on the Nuclear Explosive Proliferation Control Act of 1976, S. 3770 and H.R. 15273, the proposed substitute for S. 1439. The Aug. 31 hearing included statements by Rep. Melvin Price, Vice Chairman, JCAE, and Fri, Rowden, and Kratzer. Further background information, mainly letters, is included under ''Additional Materials'' and in three appendixes

  19. An Overview of DoD Policy for and Administration of Independent Research and Development

    Science.gov (United States)

    1975-05-01

    1969-1970) The Congress became directly involved in IR&D policy matters during the floor debate on the FY 1970 Military Procurement Act. This...trial period the’data bank was restricted to DlOD usirs. However, in December 1974 NASA was granted ’access "to the IR&D Data Dank :. 3,4. IM~D DatA...Subject Matter of S3003," Washington, D. C., 11 February 1970. 54. Deputy Secretary of Defense, "Independent Research and Development/Bid and

  20. 77 FR 38085 - Importer of Controlled Substances; Notice of Application; Cambrex Charles City, Inc.

    Science.gov (United States)

    2012-06-26

    ... Application; Cambrex Charles City, Inc. Pursuant to Title 21 Code of Federal Regulations 1301.34 (a), this is notice that on May 4, 2011, Cambrex Charles City, Inc., 1205 11th Street, Charles City, Iowa 50616-3466... II are, and will continue to be, required to demonstrate to the Deputy Assistant Administrator...

  1. 29 November 2013 - U. Humphrey Orjiako Nigerian Ambassador Extraordinary and Plenipotentiary Permanent Mission to the United Nations Office and other international organisations in Geneva signing the Guest Book with Head of International Relations R. Voss, visiting the LHC tunnel at Point 2 and the ALICE cavern with ALICE Collaboration Deputy Spokesperson Y. Schutz.

    CERN Multimedia

    Noemi Caraban

    2013-01-01

    29 November 2013 - U. Humphrey Orjiako Nigerian Ambassador Extraordinary and Plenipotentiary Permanent Mission to the United Nations Office and other international organisations in Geneva signing the Guest Book with Head of International Relations R. Voss, visiting the LHC tunnel at Point 2 and the ALICE cavern with ALICE Collaboration Deputy Spokesperson Y. Schutz.

  2. 16 Augur 2013 -Bulgarian Minister of Education and Sciences A. Klisarova visiting the LHC tunnel with S. Russenschuck and CMS experimental cavern with Deputy Spokesperson T. Camporesi and V. Genchev ; signing the guest book with CERN Director-General R. Heuer. Accompanied throughout by P. Hristov, L. Litov, R. Voss and Z. Zaharieva.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    16 Augur 2013 -Bulgarian Minister of Education and Sciences A. Klisarova visiting the LHC tunnel with S. Russenschuck and CMS experimental cavern with Deputy Spokesperson T. Camporesi and V. Genchev ; signing the guest book with CERN Director-General R. Heuer. Accompanied throughout by P. Hristov, L. Litov, R. Voss and Z. Zaharieva.

  3. 1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

    CERN Multimedia

    Pantelia, Anna

    2014-01-01

    1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.

  4. Administration

    DEFF Research Database (Denmark)

    Bogen handler om den praksis, vi kalder administration. Vi er i den offentlige sektor i Danmark hos kontorfolkene med deres sagsmapper, computere, telefoner,, lovsamlinger,, retningslinier og regneark. I bogen udfoldes en mangfoldighed af konkrete historier om det administrative arbejde fra...... forskellige områder i den offentlige sektor. Hensigten er at forstå den praksis og faglighed der knytter sig til det administrative arbejde...

  5. MOTIVATION OF ADMINISTRATIVE ACTS – GUARANTEE OF GOOD ADMINISTRATION

    Directory of Open Access Journals (Sweden)

    Adelin Mihai ZĂGĂRIN

    2018-05-01

    Full Text Available The present article deals with the aspects of motivating administrative acts, both doctrinaire and practical, of jurisprudence. The duty of the administration to motivate its decisions is submitted in the Charter of Fundamental Rights of the European Union, art. 41. In the current European legal order, the rationale for administrative acts is considered and refers to one of the most important conditions of validity of the administrative act. The Romanian Constitution ensures and emphasizes the motivation, as it is imposed by the Charter. The realization of this fundamental right to motivate administrative acts is possible by calling upon a set of values from the administration, such as transparency, professionalism and the imposition of high quality standards. Motivation is achieved where we have a good administration, and whether citizens are, among other things, respected fundamental rights and freedoms, access to information is guaranteed and motivated their decisions. Although administrative normative acts are motivated by the administration, examples that show that individual ones are unmotivated or incompletely motivated are enough, which made the various employers legally answer for the non-motivation of their decisions to terminate work relationships with several of the employees. The motivation of administrative acts is necessary, mandatory and must be done with rigor. It is highlighted that inadequate, incomplete or vicious reasoning may result in suspension or even annulment of the administrative act by the court.

  6. LOR-interleaving image reconstruction for PET imaging with fractional-crystal collimation

    International Nuclear Information System (INIS)

    Li, Yusheng; Matej, Samuel; Karp, Joel S; Metzler, Scott D

    2015-01-01

    Positron emission tomography (PET) has become an important modality in medical and molecular imaging. However, in most PET applications, the resolution is still mainly limited by the physical crystal sizes or the detector’s intrinsic spatial resolution. To achieve images with better spatial resolution in a central region of interest (ROI), we have previously proposed using collimation in PET scanners. The collimator is designed to partially mask detector crystals to detect lines of response (LORs) within fractional crystals. A sequence of collimator-encoded LORs is measured with different collimation configurations. This novel collimated scanner geometry makes the reconstruction problem challenging, as both detector and collimator effects need to be modeled to reconstruct high-resolution images from collimated LORs. In this paper, we present a LOR-interleaving (LORI) algorithm, which incorporates these effects and has the advantage of reusing existing reconstruction software, to reconstruct high-resolution images for PET with fractional-crystal collimation. We also develop a 3D ray-tracing model incorporating both the collimator and crystal penetration for simulations and reconstructions of the collimated PET. By registering the collimator-encoded LORs with the collimator configurations, high-resolution LORs are restored based on the modeled transfer matrices using the non-negative least-squares method and EM algorithm. The resolution-enhanced images are then reconstructed from the high-resolution LORs using the MLEM or OSEM algorithm. For validation, we applied the LORI method to a small-animal PET scanner, A-PET, with a specially designed collimator. We demonstrate through simulated reconstructions with a hot-rod phantom and MOBY phantom that the LORI reconstructions can substantially improve spatial resolution and quantification compared to the uncollimated reconstructions. The LORI algorithm is crucial to improve overall image quality of collimated PET, which

  7. Tickled to death: analysing public perceptions of 'cute' videos of threatened species (slow lorises - Nycticebus spp.) on Web 2.0 sites.

    Science.gov (United States)

    Anne-Isola Nekaris, K; Nekaris, By K Anne-Isola; Campbell, Nicola; Coggins, Tim G; Rode, E Johanna; Nijman, Vincent

    2013-01-01

    The internet is gaining importance in global wildlife trade and changing perceptions of threatened species. There is little data available to examine the impact that popular Web 2.0 sites play on public perceptions of threatened species. YouTube videos portraying wildlife allow us to quantify these perceptions. Focussing on a group of threatened and globally protected primates, slow lorises, we quantify public attitudes towards wildlife conservation by analysing 12,411 comments and associated data posted on a viral YouTube video 'tickling slow loris' over a 33-months period. In the initial months a quarter of commentators indicated wanting a loris as a pet, but as facts about their conservation and ecology became more prevalent this dropped significantly. Endorsements, where people were directed to the site by celebrities, resulted mostly in numerous neutral responses with few links to conservation or awareness. Two conservation-related events, linked to Wikipedia and the airing of a television documentary, led to an increase in awareness, and ultimately to the removal of the analysed video. Slow loris videos that have gone viral have introduced these primates to a large cross-section of society that would not normally come into contact with them. Analyses of webometric data posted on the internet allow us quickly to gauge societal sentiments. We showed a clear temporal change in some views expressed but without an apparent increase in knowledge about the conservation plight of the species, or the illegal nature of slow loris trade. Celebrity endorsement of videos showing protected wildlife increases visits to such sites, but does not educate about conservation issues. The strong desire of commentators to express their want for one as a pet demonstrates the need for Web 2.0 sites to provide a mechanism via which illegal animal material can be identified and policed.

  8. Tickled to death: analysing public perceptions of 'cute' videos of threatened species (slow lorises - Nycticebus spp. on Web 2.0 sites.

    Directory of Open Access Journals (Sweden)

    K Anne-Isola Nekaris

    Full Text Available BACKGROUND: The internet is gaining importance in global wildlife trade and changing perceptions of threatened species. There is little data available to examine the impact that popular Web 2.0 sites play on public perceptions of threatened species. YouTube videos portraying wildlife allow us to quantify these perceptions. METHODOLOGY/PRINCIPAL FINDINGS: Focussing on a group of threatened and globally protected primates, slow lorises, we quantify public attitudes towards wildlife conservation by analysing 12,411 comments and associated data posted on a viral YouTube video 'tickling slow loris' over a 33-months period. In the initial months a quarter of commentators indicated wanting a loris as a pet, but as facts about their conservation and ecology became more prevalent this dropped significantly. Endorsements, where people were directed to the site by celebrities, resulted mostly in numerous neutral responses with few links to conservation or awareness. Two conservation-related events, linked to Wikipedia and the airing of a television documentary, led to an increase in awareness, and ultimately to the removal of the analysed video. CONCLUSIONS/SIGNIFICANCE: Slow loris videos that have gone viral have introduced these primates to a large cross-section of society that would not normally come into contact with them. Analyses of webometric data posted on the internet allow us quickly to gauge societal sentiments. We showed a clear temporal change in some views expressed but without an apparent increase in knowledge about the conservation plight of the species, or the illegal nature of slow loris trade. Celebrity endorsement of videos showing protected wildlife increases visits to such sites, but does not educate about conservation issues. The strong desire of commentators to express their want for one as a pet demonstrates the need for Web 2.0 sites to provide a mechanism via which illegal animal material can be identified and policed.

  9. COMPOSITION OF THE JOINT ADVISORY APPEALS BOARD

    CERN Multimedia

    2004-01-01

    2004 Exercise Appointed by the Director-GeneralAppointed by the Staff Association Members Lars Leistam / TS Irene Seis / IT 1st deputies Christian Fabjan / PH Jean-François Michaud / TS 2nd deputies Mats Møller / IT Gérard Antoinet / SC Dr Leistam and Mrs Seis have drawn up the following list of staff members from among whom the Chairperson of the Board may be chosen when required : Etienne Carlier / AB Ignacio Reguero / IT Philippe Charpentier / PH Alasdair smith / PH Paula Carvalho Correia / FI Pierre Strubin / AT Hans De Groot / PH Emmanuel Tsesmelis / AT Catherine Delamare / IT Elena Wildner / AT Mediators [see Administrative Circular N° 6 (Rev. 1) entitled "Review procedure"] will also be selected from this list of ten staff members.

  10. 75 FR 20997 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2010-04-22

    ... 77354. Officers: Thomas C. Gaze, President, Qualifying Individual). Lori L. Gaze, Secretary/Treasurer... Services, (Qualifying Individual). George T. Cook, President/Treasurer, Application Type: New OFF License...

  11. Behavioral Public Administration:Combining Insights from Public Administration and Psychology

    OpenAIRE

    Grimmelikhuijsen, Stephan; Jilke, Sebastian; Olsen, Asmus Leth; Tummers, Lars

    2017-01-01

    We propose behavioral public administration as a designated subfield in public administration which explicitly deals with the integration of theories and methods from psychology into the study of public administration. We discuss how scholars in public administration currently draw on both methodological and theoretical innovations in psychology and point to research questions in public administration which could benefit from further integration. Behavioral public administration cannot, and s...

  12. [Expectations of hospital administrators about administrative functions of nurses].

    Science.gov (United States)

    Melo, M R; Fávero, N; Trevizan, M A; Hayashida, M

    1996-01-01

    The objective of the present study was to investigate hospital administrator's expectations about the administrative role played by nurses, utilizing functions proposed by the Neoclassical Theory of Administration: planning, organization, direction, and control as theoretical references. An instrument established in TREVIZAN (1989) was applied to 11 hospital administrators. The results showed they expect the four functions to be done by nurses. Therefore, the interaction between nurses and hospital administrators is critical to improve the patient's assistance.

  13. Administrative Circulars

    CERN Document Server

    Département des Ressources humaines

    2004-01-01

    Administrative Circular N° 2 (Rev. 2) - May 2004 Guidelines and procedures concerning recruitment and probation period of staff members This circular has been revised. It cancels and replaces Administrative Circular N° 2 (Rev. 1) - March 2000. Administrative Circular N° 9 (Rev. 3) - May 2004 Staff members contracts This circular has been revised. It cancels and replaces Administrative Circular N° 9 (Rev. 2) - March 2000. Administrative Circular N° 26 (Rev. 4) - May 2004 Procedure governing the career evolution of staff members This circular has also been revised. It Administrative Circulars Administrative Circular N° 26 (Rev. 3) - December 2001 and brings up to date the French version (Rev. 4) published on the HR Department Web site in January 2004. Operational Circular N° 7 - May 2004 Work from home This circular has been drawn up. Operational Circular N° 8 - May 2004 Dealing with alcohol-related problems...

  14. 7 CFR 301.91-3 - Regulated areas.

    Science.gov (United States)

    2010-01-01

    ...) The Deputy Administrator or an inspector may temporarily designate any nonregulated area in a... Division, 9th Southern Division, 10th Southern Division, and 16th Middle Division. Knox County. The entire... Division. [49 FR 18992, May 4, 1984, as amended at 49 FR 36817, Sept. 20, 1984; 50 FR 7033, Feb. 20, 1985...

  15. William Brinkman (centre), Director of the Department of Energy, U.S.A. at the superconducting magnet test hall SM18 with (from left to right) Coordinator for External Relations F. Pauss, Advisor for Non-Member States J. Ellis, J. Strait from Fermilab and Deputy Head of Technology Department L. Rossi on 13 November 2009.

    CERN Multimedia

    Maximilien Brice; SM18

    2009-01-01

    William Brinkman (centre), Director of the Department of Energy, U.S.A. at the superconducting magnet test hall SM18 with (from left to right) Coordinator for External Relations F. Pauss, Advisor for Non-Member States J. Ellis, J. Strait from Fermilab and Deputy Head of Technology Department L. Rossi on 13 November 2009.

  16. Behavioral Public Administration

    DEFF Research Database (Denmark)

    Grimmelikhuijsen, Stephan; Jilke, Sebastian; Olsen, Asmus Leth

    2017-01-01

    on theories and methods from psychology and related fields and point to research in public administration that could benefit from further integration. An analysis of public administration topics through a psychological lens can be useful to confirm, add nuance to, or extend classical public administration...... theories. As such, behavioral public administration complements traditional public administration. Furthermore, it could be a two-way street for psychologists who want to test the external validity of their theories in a political-administrative setting. Finally, four principles are proposed to narrow......Behavioral public administration is the analysis of public administration from the micro-level perspective of individual behavior and attitudes by drawing on insights from psychology on the behavior of individuals and groups. The authors discuss how scholars in public administration currently draw...

  17. 77 FR 49799 - Medicare and Medicaid Programs; Quarterly Listing of Program Issuances-April Through June 2012

    Science.gov (United States)

    2012-08-17

    ... Regarding Lori Ashby (410) 786-6322 National Coverage Provisions. XI National Oncologic Stuart Caplan, RN... Caplan, RN, (410) 786-8564 Positron Emission MAS. Tomography for Dementia Trials. All Other Information...

  18. COMPOSITION OF THE JOINT ADVISORY APPEALS BOARD - 2003 Exercise

    CERN Multimedia

    2003-01-01

    Appointed by the Director-GeneralAppointed by the Staff Association MembersChristian Fabjan/EPIrene Seis/IT 1st deputies Lars Leistam/ESTJean-Claude Carlier/TIS 2nd deputies Luc Durieu/ABMorna Robillard/HR Dr Fabjan and Mrs Seis have drawn up the following list of staff members from among whom the Chairperson of the Board may be chosen when required : Appointed by the Director-GeneralAppointed by the Staff AssociationPhilippe Charpentier/EPCorrado Pettenati/ETT Christophe Delamare/EST Ignacio Reguero/IT Eugenia Hatziangeli/AB Alasdair smith/EP Tadeusz Kurtyka/EST Pierre Strubin/AT Mats Møller/AS Elena Wildner/AT Mediators [see Administrative Circular N° 6 (Rev. 1) entitled "Review procedure"] will also be selected from this list of ten staff members. Human Resources DivisionTel. 74128

  19. COMPOSITION OF THE JOINT ADVISORY APPEALS BOARD - 2002 Exercise

    CERN Multimedia

    Human Resources Division

    2002-01-01

    Apointed by the Director-General Appointed by the Staff Association Members Christian Fabjan/EP Irene Seis/IT 1st deputies Sue Foffano/AS Jean-Claude Carlier/TIS 2nd deputies Luc Durieu/PS Morna Robillard/HR Dr Fabjan and Mrs Seis have drawn up the following list of staff members from among whom the Chairman of the Board may be chosen when required: Apointed by the Director-General Appointed by the Staff Association Christophe Delamare/eEST Mats Moller/AS Cristina Lara/SPL Corrado Pettenati/ETT Eugenia Hatziangeli/SL Ignacio Reguero/IT Lars Leistam/EST Alasdair smith/EP Guy Maurin/EP Pierre Strubin/LHC Mediators [see Administrative Circular N° 6 (Rev. 1) entitled 'Review procedure'] will also be selected from this list of ten staff members. Human Resources Division Tel. 74128

  20. ADMINISTRATIVE CONTRACTS. DELIMITATIONS

    Directory of Open Access Journals (Sweden)

    Liana Teodora PASCARIU

    2016-12-01

    Full Text Available Article examines whether all contracts of public persons are administrative contracts; in other words, if the administration may conclude contracts that, according to their legal nature, are not administrative. If we start from the definition of administrative contracts as it appears in Law no. 554/2004, these include contracts by public authorities which concern the enhancement of public property execution of works of public interest, public services, public procurement and other administrative contracts provided by special laws and subject to the jurisdiction of the administrative courts.

  1. Administrative Synergy

    Science.gov (United States)

    Hewitt, Kimberly Kappler; Weckstein, Daniel K.

    2012-01-01

    One of the biggest obstacles to overcome in creating and sustaining an administrative professional learning community (PLC) is time. Administrators are constantly deluged by the tyranny of the urgent. It is a Herculean task to carve out time for PLCs, but it is imperative to do so. In this article, the authors describe how an administrative PLC…

  2. Solar Insights from the 2016 RPS Summit | State, Local, and Tribal

    Science.gov (United States)

    educational two days of presentations, panels, group discussions and networking. Lori Bird, Principal Analyst community shared solar, which allows renters and others who do not have adequate roofs for solar panels to

  3. Administrating Solr

    CERN Document Server

    Mohan, Surendra

    2013-01-01

    A fast-paced, example-based guide to learning how to administrate, monitor, and optimize Apache Solr.""Administrating Solr"" is for developers and Solr administrators who have a basic knowledge of Solr and who are looking for ways to keep their Solr server healthy and well maintained. A basic working knowledge of Apache Lucene is recommended, but this is not mandatory.

  4. 20th May 2010 - Malaysian Minister for Science, Technology and Innovation H. F: B. H. Yusof signing the guest book with Coordinator for External Relations F. Pauss and CMS Collaboration Deputy Spokesperson A. De Roeck; visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry; throughout accompanied by CERN Advisers J. Ellis and E. Tsesmelis.

    CERN Document Server

    Maximilien brice

    2010-01-01

    20th May 2010 - Malaysian Minister for Science, Technology and Innovation H. F: B. H. Yusof signing the guest book with Coordinator for External Relations F. Pauss and CMS Collaboration Deputy Spokesperson A. De Roeck; visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry; throughout accompanied by CERN Advisers J. Ellis and E. Tsesmelis.

  5. 5 June 2013 - European Union Ambassador to Switzerland and the Principality of Liechtenstein R. Jones in the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler, in the LHC tunnel at Point 1 with Technology Department Head F. Bordry and signing the guest book with Director-General R. Heuer. Head of the EU Projects Office S. Stavrev present.

    CERN Multimedia

    Jean-Claude Gadmer

    2013-01-01

    5 June 2013 - European Union Ambassador to Switzerland and the Principality of Liechtenstein R. Jones in the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler, in the LHC tunnel at Point 1 with Technology Department Head F. Bordry and signing the guest book with Director-General R. Heuer. Head of the EU Projects Office S. Stavrev present.

  6. 16 December 2013 - P. Lavie President of the Technion Institute of Technology in Israel visiting the ATLAS cavern with ATLAS Deputy Spokesperson T. Wengler; visiting the LHC tunnel at Point 1 with Technology Department Head F. Bordry and signing the Guest Book with CERN Director-General R. Heuer. G. Mikenberg, E. Rabinovici, Y. Rozen and S. Tarem present throughout.

    CERN Multimedia

    Jean-Claude Gadmer

    2013-01-01

    16 December 2013 - P. Lavie President of the Technion Institute of Technology in Israel visiting the ATLAS cavern with ATLAS Deputy Spokesperson T. Wengler; visiting the LHC tunnel at Point 1 with Technology Department Head F. Bordry and signing the Guest Book with CERN Director-General R. Heuer. G. Mikenberg, E. Rabinovici, Y. Rozen and S. Tarem present throughout.

  7. Sustainable Administrative Reform Movements Policy in Joko Widodo's Administration

    Directory of Open Access Journals (Sweden)

    Yogi Suprayogi Sugandi

    2017-05-01

    Full Text Available Joko Widodo (Jokowi is a leader that is widely expected to transform Indonesia into a better country. Hopes and wishes were rising when he was elected as the president of Indonesia. This paper will describe various innovations undertaken before and after his presidential inauguration as well as the assorted innovations made in reforming the administration of his cabinet. As the president of Indonesia, Joko Widodo is required to realize the aspirations of the people in freeing the government from corruption, collusion, and nepotism. The management of ministerial and non-ministerial institutions becomes the very first crucial issue undertaken by Joko Widodo. This led to a polemic in regards to reducing or increasing the number of institutions, as the Jokowi administration actually increased the amount. In Susilo Bambang Yudhoyono's administration, several policies were made systematically and based on legislations that had been approved by the lagislature. Joko Widodo's administration in more partial in nature. The administrative reform program that is highly anticipated is the continuation of the Public Service Act. This law is a step forward from the administrative reform program that aims at the creation of good governance. Changes is career path, salary system, pension and benefits for civil servants, performance-based staffing are various efforts of sustainability carried out by Joko Widodo's administration.

  8. Semantic Modeling of Administrative Procedures from a Spanish Regional Public Administration

    Directory of Open Access Journals (Sweden)

    Francisco José Hidalgo López

    2018-02-01

    Full Text Available Over the past few years, Public Administrations have been providing systems for procedures and files electronic processing to ensure compliance with regulations and provide public services to citizens. Although each administration provides similar services to their citizens, these systems usually differ from the internal information management point of view since they usually come from different products and manufacturers. The common framework that regulations demand, and that Public Administrations must respect when processing electronic files, provides a unique opportunity for the development of intelligent agents in the field of administrative processes. However, for this development to be truly effective and applicable to the public sector, it is necessary to have a common representation model for these administrative processes. Although a lot of work has already been done in the development of public information reuse initiatives and common vocabularies standardization, this has not been carried out at the processes level. In this paper, we propose a semantic representation model of both processes models and processes for Public Administrations: the procedures and administrative files. The goal is to improve public administration open data initiatives and help to develop their sustainability policies, such as improving decision-making procedures and administrative management sustainability. As a case study, we modelled public administrative processes and files in collaboration with a Regional Public Administration in Spain, the Principality of Asturias, which enabled access to its information systems, helping the evaluation of our approach.

  9. A Logic for Inclusion of Administrative Domains and Administrators in Multi-domain Authorization

    Science.gov (United States)

    Iranmanesh, Zeinab; Amini, Morteza; Jalili, Rasool

    Authorization policies for an administrative domain or a composition of multiple domains in multi-domain environments are determined by either one administrator or multiple administrators' cooperation. Several logic-based models for multi-domain environments' authorization have been proposed; however, they have not considered administrators and administrative domains in policies' representation. In this paper, we propose the syntax, proof theory, and semantics of a logic for multi-domain authorization policies including administrators and administrative domains. Considering administrators in policies provides the possibility of presenting composite administration having applicability in many collaborative applications. Indeed, administrators and administrative domains stated in policies can be used in authorization. The presented logic is based on modal logic and utilizes two calculi named the calculus of administrative domains and the calculus of administrators. It is also proved that the logic is sound. A case study is presented signifying the logic application in practical projects.

  10. Behavioral Public Administration : Combining Insights from Public Administration and Psychology

    NARCIS (Netherlands)

    Grimmelikhuijsen, S.G.|info:eu-repo/dai/nl/313875405; Jilke, Sebastian; Leth Olsen, Asmus; Tummers, L.G.|info:eu-repo/dai/nl/341028274

    2016-01-01

    Behavioral public administration is the analysis of public administration from the micro-perspective of individual behavior and attitudes by drawing upon insights from psychology on behavior of individuals and groups. We discuss how scholars in public administration currently draw on theories and

  11. Case of administrative dispute

    Directory of Open Access Journals (Sweden)

    Xhemazie Ibraimi

    2015-11-01

    Full Text Available The activity of administrative bodies includes big numbers of various acts and actions, through which the will of public administration is formed. The will of public administration bodies, expressed in administrative individual and normative acts, in administrative contracts and real acts, finds its reflection in the Constitution, laws and other provisions of legal character. All this activity is not inerrant and therefore, it is not uncontrollable. The supervision of executive activity is subject to political control of administrative acts through authorities designated for this purpose, as well as internal control and the judicial control. The institution of judicial control of administrative acts and actions appears as very important and widely treated in the legal doctrine. The protection of constitutional and legal rights of private persons is accomplished by subjecting administrative activity both to internal administrative control, as well as to the judicial control in accordance with legal provisions. The judicial control of administrative acts represents a constitutional guarantee for citizens to protect their rights through public and fair trial by an independent and impartial court. In this way, the Constitution empowers the common administrative court that invalidates an action or administrative act, but not all administrative acts may be subject to administrative dispute, with the exception of cases against which the administrative conflict cannot be carried out (negative enumeration.

  12. 75 FR 18191 - City of Raleigh; Community Hydro, LLC; Notice of Competing Preliminary Permit Applications...

    Science.gov (United States)

    2010-04-09

    ...: Mr. Thomas A. McCormick, Raleigh City Attorney, P.O. Box 590, Raleigh, North Carolina 27601, e-mail tom.mccormick@ci.raleigh.nc.us . For Community Hydro, LLC: Lori Barg, Community Hydro, LLC, 113...

  13. Brief Intervention Helps Adolescents Curb Substance Use

    Science.gov (United States)

    ... January 02, 2013 Lori Whitten, NIDA Notes Contributing Writer Drug- and alcohol-involved middle and high school ... and Alaska Natives Asians Children College Students Employees Hispanics or Latinos Inmates and Parolees International Populations LGBT ...

  14. Cloudera administration handbook

    CERN Document Server

    Menon, Rohit

    2014-01-01

    An easy-to-follow Apache Hadoop administrator's guide filled with practical screenshots and explanations for each step and configuration. This book is great for administrators interested in setting up and managing a large Hadoop cluster. If you are an administrator, or want to be an administrator, and you are ready to build and maintain a production-level cluster running CDH5, then this book is for you.

  15. KSC-04PD-2010

    Science.gov (United States)

    2004-01-01

    KENNEDY SPACE CENTER, FLA. At Gainesville Elementary School, a NASA Explorer School in Gainesville, Ga., astronaut Leland Melvin hands a patch to a student for answering a question. Melvin joined Jim Jennings, deputy associate administrator for Institutions and Asset Management at NASA Headquarters, on the visit to the school to share the new vision for space exploration with the next generation of explorers. Melvin talked about the importance of teamwork and what it takes for mission success. Also visiting was KSC Deputy Director Woodrow Whitlow Jr., who talked with students about our destiny as explorers, NASAs stepping stone approach to exploring Earth, the Moon, Mars and beyond, how space impacts our lives, and how people and machines rely on each other in space. Melvin talked about the importance of teamwork and what it takes for mission success.

  16. 75 FR 33317 - Antibacterial Resistance and Diagnostic Device and Drug Development Research for Bacterial...

    Science.gov (United States)

    2010-06-11

    ... name, title, firm name, address, telephone, and fax number) to [email protected] . Persons without access to the Internet can call Chris Moser or Lori Benner at 301-796-1300 to register. Persons needing a...

  17. Administrative Reform

    DEFF Research Database (Denmark)

    Plum, Maja

    Through the example of a Danish reform of educational plans in early childhood education, the paper critically addresses administrative educational reforms promoting accountability, visibility and documentation. Drawing on Foucaultian perspectives, the relation between knowledge and governing...... of administrative technology, tracing how the humanistic values of education embed and are embedded within ‘the professional nursery teacher' as an object and subject of administrative practice. Rather than undermining the humanistic potential of education, it is argued that the technology of accounting...

  18. Mapping Russian Media Network: Media’s Role in Russian Foreign Policy and Decision-Making

    Science.gov (United States)

    2017-06-14

    political spheres in target countries. Thus media are ultimately only one instrument, albeit quite an important one, in a much larger toolkit ...2017. 22 Presidential Administration and presidential spokesman, are former career diplomats. First Deputy Chief of Staff Sergey...who serves as President Putin’s foreign policy advisor) is also a career diplomat and a past ambassador to the United States.56 CNA’s analysis

  19. New appointments at the IAEA

    International Nuclear Information System (INIS)

    1999-01-01

    The document shortly presents the following new appointments: the Deputy Director General, Head of the Department of Safeguards (effective as of 1 May 1999), the Director of the Division of Nuclear Fuel Cycle and Waste Technology in the Department of Nuclear Energy, and the Director of the Division of Conference and Document Services in the Department of Administration (effective as of 1 April 1999)

  20. Genetics Home Reference: hypokalemic periodic paralysis

    Science.gov (United States)

    ... M, Franques J, Bendahhou S, Lory P, Hainque B, Fournier E, Nicole S, Fontaine B. Hypokalemic Periodic Paralysis. 2002 ... related congenital muscular dystrophy Melorheostosis Rhabdoid tumor predisposition syndrome All New & Updated Pages Reviewed : October 2017 Published : ...

  1. System administrator`s guide to CDPS. Version 1.0

    Energy Technology Data Exchange (ETDEWEB)

    Didier, B.T.; Portwood, M.H.

    1994-05-01

    The System Administrator`s Guide to CDPS is intended for those responsible for setting up and maintaining the hardware and software of a Common Mapping Standard (CMS) Date Production System (CDPS) installation. This guide assists the system administrator in performing typical administrative functions. It is not intended to replace the Ultrix Documentation Set that should be available for a DCPS installation. The Ultrix Documentation Set will be required to provide details on referenced Ultrix commands as well as procedures for performing Ultrix maintenance functions. There are six major sections in this guide. Section 1 introduces the system administrator to CDPS and describes the assumptions that are made by this guide. Section 2 describes the CDPS platform configuration. Section 3 describes the platform preparation that is required to install the CDPS software. Section 4 describes the CPS software and its installation procedures. Section 5 describes the CDS software and its installation procedures. Section 6 describes various operation and maintenance procedures. Four appendices are also provided. Appendix A contains a list of used acronyms. Appendix B provides a terse description of common Ultrix commands that are used in administrative functions. Appendix C provides sample CPS and CDS configuration files. Appendix D provides a required list and a recommended list of Ultrix software subsets for installation on a CDPS platform.

  2. Teachers' and Administrators' Perceptions of Knowledge Management Competence of High School Administrators

    Science.gov (United States)

    Memisoglu, Salih Pasa

    2016-01-01

    This study aims to determine the teachers' and administrators' perceptions of knowledge management competence in high school administration. The study was conducted using the screening model and the study group consisted of 162 teachers and 35 administrators working at eight high schools in Turkey. Administrators' knowledge management competence…

  3. 76 FR 67472 - Order of Succession for the Office of the Chief Information Officer

    Science.gov (United States)

    2011-11-01

    ...: Juanita Galbreath, Deputy Chief Information Officer for Cyber Security and Privacy, Office of the Chief...) Deputy Chief Information Officer, for IT Operations; (3) Deputy Chief Information Officer, for Cyber Security and Privacy; (4) Deputy Chief Information Officer, for Business and IT Modernization. These...

  4. Voice and silence in an autoethnography about chronic illness

    African Journals Online (AJOL)

    Kate H

    a lecture by Lori Hartwell, a transplant recipient from America. When she told us of her .... surprises of Photovoice and film in a study of chronic illness. International ... Considering the violence of voicelessness: Censorship and self- censorship ...

  5. Land Administration Systems

    DEFF Research Database (Denmark)

    Enemark, Stig

    2014-01-01

    Land administration systems are the operational tool for conceptualizing rights, restrictions and responsibilities (RRRs) in land. Each of the rights, restrictions and responsibilities encompasses a human rights dimension that relates to the overall national land policies and should be unfolded...... as more than just rhetoric. This paper attempts to analyse the aspects of human rights in relation to land administration systems with a special focus on developing countries struggling to build adequate systems for governing the rights, restrictions and responsibilities in land. Human rights....... This relates to national political arrangements and standards for good governance and land administration systems are highly instrumental in this regard. This paper introduces the relation between land administration and human rights. It is argued that human rights and land administration are closely linked...

  6. FRACTAL PROPERTY OF ADMINISTRATION

    OpenAIRE

    Zlatko Brnjas

    2014-01-01

    To understand the constant increase in administration, we need a new approach to the administration. For many years, the administration has intensified as a closed science, associated only with economics, law and political science. However, this approach did not bring anything good, because almost nothing in the administration has improved. Therefore, it is necessary to connect the administration with the natural sciences which give the best description of the world around us. Because of this...

  7. 30 January 2012 - Ecuadorian Ambassador Gallegos Chiriboga, Permanent Representative to the United Nations Office and other International Organisations at Geneva and San Francisco de Quito University Vice Chancellor C. Montùfar visiting CMS surface facilities and underground experimental area with CMS Collaboration L. Sulak and Collaboration Deputy Spokesperson T. Camporesi, throughout accompanied by Head of International Relations F. Pauss.

    CERN Multimedia

    Michael Hoch

    2012-01-01

    30 January 2012 - Ecuadorian Ambassador Gallegos Chiriboga, Permanent Representative to the United Nations Office and other International Organisations at Geneva and San Francisco de Quito University Vice Chancellor C. Montùfar visiting CMS surface facilities and underground experimental area with CMS Collaboration L. Sulak and Collaboration Deputy Spokesperson T. Camporesi, throughout accompanied by Head of International Relations F. Pauss.

  8. HIV testing is associated with increased knowledge and reductions ...

    African Journals Online (AJOL)

    HIV testing is associated with increased knowledge and reductions in sexual risk behaviours among men in Cape Town, South Africa. Lori AJ Scott-Sheldon, Michael P Carey, Kate B Carey, Demetria Cain, Leickness C Simbayi, Vuyelwa Mehlomakhulu, Seth C Kalichman ...

  9. 76 FR 28121 - Notice of Passenger Facility Charge (PFC) Approvals and Disapprovals

    Science.gov (United States)

    2011-05-13

    ... fencing. Acquire radio equipment for emergency operations center. Interactive employee training system... survey and wildlife assessment. Decision Date: March 17, 2011. FOR FURTHER INFORMATION CONTACT: Lori...: Aircraft rescue and firefighting facility. Determination: The approval of this project is limited to the...

  10. Corneal pharmacokinetics of the 2% diacerein eye drops between multiple administration and single administration

    OpenAIRE

    Ke Yang; Shi-Wei Chen; Xin-Yan Dou; Zhi-Rui Zhang; Xin Jin; Hong-Min Zhang

    2018-01-01

    AIM: To compare the pharmacokinetic differences of the 2% diacerein eye drops between conjunctival sac multiple administration and single administration in the cornea, and to provide the experimental basis for clinicians to use the conjunctival sac multiple administration.METHODS: Male Kunming mice were randomly divided into the multiple administration group and the single administration group. The multiple administration group were given diacerein eye drop every 2min(3 times in total). The c...

  11. Contemporary Development Trends in Administrative-Legal Relations in the System of Administrative Justice

    Science.gov (United States)

    Abdikerimova, Aynur A.

    2016-01-01

    The purpose of the study is to determine the main contemporary development trends in administrative-legal relations in the field of administrative justice. In order to examine theoretical and practical issues of modern administrative justice, normative legal acts identifying the relations in the system of administrative justice in the Republic in…

  12. Administrative Behaviors and Emotional and Social Competences of Higher Education Administrators: A Cross-Cultural Study

    Directory of Open Access Journals (Sweden)

    Osman Ferda BEYTEKİN

    2012-01-01

    Full Text Available In this study, higher education administrators, administrative behaviors; as educator, leader and manager, emotional competency; as self awareness and self management and social competency; as social awareness and social skills were compared according to two different cultures. The data was collected by inventories from 165 educators, and head of the departments Istanbul, and Helsinki Universities in 2008-2009 educational year. Elkins' administrative behaviors of higher education administrators inventory and Goleman's emotional and social competence inventory were conducted to test the differences. The manager behaviors of Istanbul University administrators are significantly higher than University of Helsinki administrators. The emotional competences of University of Helsinki administrators are significantly higher than the administrators of Istanbul University in the dimensions of self-awareness, self management, emotional selfcontrol, achievement orientation and positive outlook. The social competencies of University of Helsinki administrators are significantly higher than the administrators of Istanbul University in the dimensions of social awareness, empathy, and conflict management. On the other hand, the social competencies of Istanbul University administrators are significantly higher than the administrators of University of Helsinki in the dimensions of organizational awareness, coach and mentor, influence and teamwork. There is a significant positive relationship between the leadership behaviors and emotional and social competencies administrators in both Istanbul University and University of Helsinki. Significant differences are found between faculties and administrators about the administrative behaviors and emotional and social competences of administrators both at İstanbul University and University of Helsinki.

  13. 5 CFR 831.101 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Administration. 831.101 Section 831.101 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.101 Administration. (a) OPM has charge of the...

  14. Behavioral Public Administration: Connecting Psychology with European Public Administration Research

    NARCIS (Netherlands)

    Leth Olsen, Asmus; Tummers, L.G.|info:eu-repo/dai/nl/341028274; Grimmelikhuijsen, S.G.|info:eu-repo/dai/nl/313875405; Jilke, Sebastian

    2017-01-01

    Well-known public administration scholars have stressed the importance of psychological research for the study of public administration. Neighboring disciplines such as economics and political science, have witnessed the emergence of the psychology-informed subfields of behavioral economics and

  15. Offentlig administration

    DEFF Research Database (Denmark)

    Nielsen, Elof Nellemann; Rehr, Preben René

    En undervisningsbog der henvender sig til administrationsbacheloruddannelsen. Kapitlerne er inddelt efter modulerne på uddannelsen og indeholder derfor elementer af administration, forvaltning, økonomistyring, innovation, samfundsvidenskabelige metoder og politisk styrede organisationer.......En undervisningsbog der henvender sig til administrationsbacheloruddannelsen. Kapitlerne er inddelt efter modulerne på uddannelsen og indeholder derfor elementer af administration, forvaltning, økonomistyring, innovation, samfundsvidenskabelige metoder og politisk styrede organisationer....

  16. Administrative litigation systems in Europe

    Directory of Open Access Journals (Sweden)

    Cătălin-Silviu Săraru

    2017-06-01

    Full Text Available The article, analyzing the administrative litigation in the comparative law, groups the existing types of administrative litigation into four major systems, namely: a States with administrative jurisdictions who have the State Council on top, administrative body with consultative and judicial role (the French system; b States with administrative jurisdictions completely separated from the active and consultative administrations (the German system; c States with administrative jurisdictions included in the judicial system; d States with no administrative jurisdiction (English system. The administrative contentious systems analyzed have developed in line with historical evolution and legal traditions and have been continually adapted to the realities existing in each state. The manner in which the administrative contentious is regulated in a State reflects the degree of democratization of that country, the extent to which the citizen enjoys legal safeguards to defend himself against abuses by public authorities. The scientific novelty of this article is to capture the latest trends in the evolution of the administrative contentious systems analyzed. This study aims to provide an easy working tool for reforming administrative litigation on comparative law in states with young democracy. In the research we used the comparative method, the historical and the logical method.

  17. Decision-making in administrative proceeding

    Directory of Open Access Journals (Sweden)

    Lončar Zoran J.

    2015-01-01

    Full Text Available Administrative decision-making by official who conducting the administrative procedure may have a number of advantages over the decisionmaking by the senior official which manages by the administrative authority. However, to make that such a novelty have positive effects, it is necessary, next to the amendments to the Law on Administrative Procedure, to create a number of legal and factual assumptions, on whom are based highly politicized and professionalised administrative systems today. In order to create the legal conditions for the introduction of innovations in administrative proceedings in the Republic of Serbia, it is necessary to appropriately modify, firstly certain provisions of the Law on Public Administration, as the basic systemic regulation in this area, and then the Law on Civil Servants, as the basic status regulation, so the civil servant career become less dependent on the will of officials who manage by the administrative authorities. Also, it is essential to solve a number of other issues on a proper legal way, such as way of harmonizing administrative practice within the same administrative authority, a way of solving the appeals in the case of first instance decisions made by independent administrative authority, different rules for conflict of interest with the state officers who may be authorized officials in administrative proceedings, etc.

  18. CONSTITUTIONALIZATION OF ADMINISTRATIVE LAW AND REVIEWABILITY OF THE ADMINISTRATIVE DISCRETION

    Directory of Open Access Journals (Sweden)

    Luiz Henrique Urquhart Cademartori

    2016-07-01

    Full Text Available The aim of this article is to conduct an analysis of the constitutionalization of Administrative Law, which results from changes in the rule of law and, under a theoretical standpoint, from the paradigm shift of legal exegesis followed by the advent of neo-constitutionalism, which poses the Constitution as the parameter for the interpretation of the other legal branches. Within this context, considering that the concept of administrative discretion goes through interpretation changes and that administrative activity is performed within the boundaries of discretion, this power/duty must always be used with substantial regulatory criteria in order to get the maximum effectiveness of the constitutional rules, thus being subjected to review. In this sense, it is demonstrated that a public official cannot in any way deviate from the realization of the fundamental rights guaranteed by the Constitution, hence stating the reviewability of the administrative discretion.

  19. Effective environmental protection by the reform of the administrative procedures and administrative legal rights

    International Nuclear Information System (INIS)

    Breuer, R.

    1978-01-01

    The 52nd German Lawyers Meeting will be concerned in its legal department with the question of whether, from the points of view of the guaranteeing of the necessary environmental protection, additional regulations in the administrative procedures and administrative legal rights should be recommended. Here one is concerned, above all, with the problem of whether an administrative legal associations sueing or associations participation in administrative legal procedures is desirable in the interests of environmental protection. A negative answer must be given to this question. Discussion should concentrate on the problematical administrative legal interests, on the strengthening of administrative participation of popular opinion or interests in legal processes, on other improvements in administrative processes and on the legal control by Parliament of environmental protection. (orig.) [de

  20. 7 CFR 56.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administration. 56.3 Section 56.3 Agriculture... EGGS Grading of Shell Eggs General § 56.3 Administration. The Administrator shall perform, for and... administration of the provisions of the Act and the regulations in this part. The Administrator is authorized to...

  1. SAT administrator

    International Nuclear Information System (INIS)

    Havas, A.

    1998-01-01

    SAT Administrator is the Information System for Nuclear Power Plant Personnel Training Program Design. It supports the design of training programs in the following phases: job analysis; task analysis; competency analysis; task competency association; definition of learning objectives to competencies; training program design; definition of test items. The general structure of the database and management software supports application of the SAT Administrator in any nuclear power installation

  2. Drug Enforcement Administration

    Science.gov (United States)

    ... de informacin confidencial --> DEA NEWS The Drug Enforcement Administration and Discovery Education name grand winner of Operation ... JUN 15 (Washington) The United States Drug Enforcement Administration, DEA Educational Foundation and Discovery Education awarded Porter ...

  3. Administration of Anesthesia

    Science.gov (United States)

    ... OMSs) are trained in all aspects of anesthesia administration. Following dental school, they complete at least four ... complications and emergencies that may arise during the administration of anesthesia. Before your surgery, your OMS will ...

  4. Corneal pharmacokinetics of the 2% diacerein eye drops between multiple administration and single administration

    Directory of Open Access Journals (Sweden)

    Ke Yang

    2018-04-01

    Full Text Available AIM: To compare the pharmacokinetic differences of the 2% diacerein eye drops between conjunctival sac multiple administration and single administration in the cornea, and to provide the experimental basis for clinicians to use the conjunctival sac multiple administration.METHODS: Male Kunming mice were randomly divided into the multiple administration group and the single administration group. The multiple administration group were given diacerein eye drop every 2min(3 times in total. The concentrations of the metabolites of diacerein in the cornea were measured by high performance liquid chromatography after given eye drop 5, 15, 30, 60, 120, and 180min. The pharmacokinetic parameters were calculated by pharmacokinetic software(DAS2.1.1. RESULTS: The metabolites of diacerein, rhein, was detected in the cornea at each time point. The concentration of the metabolite of diacerein in the cornea was 318.678±40.88, 210.02±25.66, 188.83±31.74, 112.24±11.70, 90.28±22.01 and 57.67±13.71μg/g after given eye drop 5, 15, 30, 60, 120, and 180min in the multiple administration group. The concentration in the single administration group was 145.17±19.29, 97.95±10.49, 71.18±18.70, 39.11±2.44, 18.10±2.34 and 9.08±2.04μg/g respectively. The concentration of rhein in the cornea was the highest at 5min after the administration in the two groups. The concentration of the multiple administration group was higher than that in the single administration group at 5, 15, 30, 60, 120, and 180min(PCONCLUSION: Compared with the single administration, the conjunctival sac multiple administration has the advantages of high drug concentration and long duration. Therefor the conjunctival sac multiple administration is a more effective method to treat acute infectious corneal diseases.

  5. Administrative Training Needs of Community Service Agency Administrators, c. 1976.

    Science.gov (United States)

    Chamberlain, Petra E.

    The demographic data and model survey instruments used in a study of 444 Wisconsin administrators of schools, universities, hospitals, correction institutions, and governmental agencies are described. A taxonomy of 58 desired competencies grouped by (1) general management techniques, (2) personnel administration, (3) legal requirements, (4)…

  6. 75 FR 58435 - Membership of the Senior Executive Service Standing Performance Review Boards

    Science.gov (United States)

    2010-09-24

    ..., ROBERT N ASSOCIATE DEPUTY ATTORNEY GENERAL MONACO, LISA ASSOCIATE DEPUTY ATTORNEY GENERAL BURROWS... GENERAL MASON, KAROL V DEPUTY ASSOCIATE ATTORNEY GENERAL TRIBE, LARRY H SENIOR COUNSELOR FOR ACCESS TO...

  7. Home - Defense Technology Security Administration

    Science.gov (United States)

    by @dtsamil Defense Technology Security Administration Mission, Culture, and History Executive Official seal of Defense Technology Security Administration Official seal of Defense Technology Security Administration OFFICE of the SECRETARY of DEFENSE Defense Technology Security Administration

  8. Anne-Sylvie Catherin, Head of the Human Resources Department

    CERN Multimedia

    2009-01-01

    Anne-Sylvie Catherin has been appointed Head of the Human Resources Department with effect from 1 August 2009. Mrs Catherin is a lawyer specialized in International Administration and joined CERN in 1996 as legal advisor within the Office of the HR Department Head. After having been promoted to the position of Group Leader responsible for social and statutory conditions in 2000, Mrs Catherin was appointed Deputy of the Head of the Human Resources Department and Group Leader responsible for Strategy, Management and Development from 2005 to date. Since 2005, she has also served as a member of CCP and TREF. In the execution of her mandate as Deputy HR Department Head, Mrs Catherin closely assisted the HR Department Head in the organization of the Department and in devising new HR policies and strategies. She played an instrumental role in the last five-yearly review and in the revision of the Staff Rules and Regulations.

  9. Administration of Anesthesia

    Medline Plus

    Full Text Available ... OMSs) are trained in all aspects of anesthesia administration. Following dental school, they complete at least four ... complications and emergencies that may arise during the administration of anesthesia. Before your surgery, your OMS will ...

  10. 75 FR 34282 - Federal Acquisition Regulation; FAR Case 2009-014, New Designated Country-Taiwan

    Science.gov (United States)

    2010-06-16

    ... Government Procurement. DATES: Effective Date: June 16, 2010. FOR FURTHER INFORMATION CONTACT: Ms. Lori... Government Procurement. The interim rule added Taiwan to the list of World Trade Organization Government... seq., because, although this rule opens up Government procurement to the goods and services of Taiwan...

  11. 78 FR 56710 - Agency Information Collection Activities: Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-09-13

    .... Type of Information Collection Request: Reinstatement without change of a previously approved... Lori Ashby at 410-786-6322.) 2. Type of Information Collection Request: Reinstatement with change of a... provide coverage for carotid artery stenting (CAS) with embolic protection for patients at high risk for...

  12. Administrative Circulars Rev.

    CERN Multimedia

    2003-01-01

    Administrative Circular N° 19 (Rev. 3) - April 2003 Subsistence indemnity - Other expenses necessarily incurred in the course of duty travelAdministrative Circular N° 25 (Rev. 2) - April 2003 Shift work - Special provisions for the Fire and Rescue Service - These circulars have been revised. Human Resources Division Tel. 74128Copies of these circulars are available in the Divisional Secretariats. In addition, administrative and operational circulars, as well as the lists of those in force, are available for consultation on the Web at: http://humanresources.web.cern.ch/humanresources/internal/admin_services/admincirc/listadmincirc.asp

  13. Postmodern Public Administration

    DEFF Research Database (Denmark)

    Bogason, Peter

    2005-01-01

    Discussion of the trends towards more uses of postmodern analysis within the discipline of public administration, particularly in the USA......Discussion of the trends towards more uses of postmodern analysis within the discipline of public administration, particularly in the USA...

  14. Federal Administrative Court recognizes foreclosure of demurer in administrative proceedings, too

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    In its decision of July 17, 1980, the Federal Administrative Court dismissed the appeal lodged by the community S. against the dismissal by the administrative court concerning the action to set aside the license granted for the Wyhl reactor. In doing so, and by giving full reasons, the effectiveness of the foreclosure of demurers in administrative proceedings has been recognized and the notion of demurer has been defined. The amount in litigation was fixed at 50000 DM for the proceedings of appeal. (HSCH) [de

  15. 7 CFR 800.2 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... which would not impair the objectives of the Act, suspend for period determined by the Administrator any... ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS Administration... administration of the United States Grain Standards Act and responsibilities under the Agricultural Marketing Act...

  16. The Europeanization of Public Administration through the General Principles of Good Administration

    Directory of Open Access Journals (Sweden)

    Vasilica NEGRUŢ

    2011-08-01

    Full Text Available The general objective of the paper is based on an extremely present theme of real interest. Using the content analysis, through a descriptive documentary research, the present study aims at identifying the dimensions of the general principles of good administration, in the context of changes at European an implicitly at national level. To this purpose, an analisys of the specific objectives will be made: the concept of good administration, the national dimensions of the right to be heard, the right to access personal files as well as the motivation of administrative acts and the general principles regulated by the European Code of Good Administration will be underlined, in the context of institutional change determined by the Lisbon Treaty. Good administration defines the way in which institutions function, this being possible by ensuring the right to access information, a more efficient protection of fundamental rights as well as the right to defense, publication of acts and their motivation. Good administration is strongly connected to good government, the relation being in our opinion, from part to whole. The final purpose of good government and implicitly of good administration aims at accomplishing the general interest. The two concepts need a higher degree of transparency and responsibility in the public process. If governing represents the modality of exerting power, good government entails the imperative of the consensus of those governed regarding the objectives and methods of government, the responsibility of those governing, the efficiency of governing and the citizens’ right to be informed regarding the use and the distribution of the financial resources in the governing process. This new concept takes into account the implication of the citizens in the decision - making process, allowing a more efficient use of material, human, and financial resources. We assert thus that by applying the general principles of good administration

  17. Understanding land administration systems

    DEFF Research Database (Denmark)

    P. Williamson, Ian; Enemark, Stig; Wallace, Judy

    2008-01-01

    This paper introduces basic land administration theory and highlights four key concepts that are fundamental to understanding modern land administration systems - firstly the land management paradigm and its influence on the land administration framework, secondly the role that the cadastre plays...... in contributing to sustainable development, thirdly the changing nature of ownership and the role of land markets, and lastly a land management vision that promotes land administration in support of sustainable development and spatial enablement of society. We present here the first part of the paper. The second...

  18. 7 CFR 253.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the Department...

  19. 7 CFR 30.61 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Administration. 30.61 Section 30.61 Agriculture... AND STANDARDS Administration § 30.61 Administration. The Director, Tobacco Division, Agricultural... the Division and the performance of all duties assigned thereto in the administration of the Tobacco...

  20. Contemporary Education for Public Administration

    Directory of Open Access Journals (Sweden)

    Ivan Koprić

    2007-01-01

    Full Text Available The paper examines the development of contemporary administrative education, as a crucial criterion without which it is not possible to achieve professionalism in public administration. While the term professionalism has a variety of meanings, today it is largely deemed that specific educational preparation is a foundation without which other elements of professionalism in public administration cannot be achieved. The level of professionalism, competence, education and knowledge thus become critical variables of administration reforms in transitional countries. Afterwards, the author examines the trends in the development of contemporary administrative education, pointing particularly to the importance of establishing a coherent, vertically passable system, i.e. a system which encompasses all levels of education – from secondary school education to doctoral studies. In this matter, one of the most important features in the development of administrative studies is their diversification, with simultaneous strengthening of the general administrative profile. Thus, the general administrative profile becomes modified, updated and extended by new teaching disciplines. In the final section of the paper, the author addresses the performance of administrative education in Croatia, pointing to its underdevelopment. Indeed, the author suggests that there are no sustainable results of reforms without the training of staff for administration.

  1. 9 CFR 381.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Administration. 381.3 Section 381.3... CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Administration; Application of Inspection and Other Requirements § 381.3 Administration. (a) [Reserved] (b) The Administrator may in specific classes of cases...

  2. 14 CFR 1201.103 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Administration. 1201.103 Section 1201.103 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION STATEMENT OF ORGANIZATION AND GENERAL INFORMATION Introduction § 1201.103 Administration. (a) NASA is headed by an Administrator, who is appointed...

  3. Alaska Administrative Manual

    Science.gov (United States)

    Search the Division of Finance site DOF State of Alaska Finance Home Content Area Accounting Charge Cards Division of Finance is to provide accounting, payroll, and travel services for State government Top Department of Administration logo Alaska Department of Administration Division of Finance Search

  4. 7 CFR 29.51 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Administration. 29.51 Section 29.51 Agriculture... INSPECTION Regulations Administration § 29.51 Administration. The Director is charged with the supervision of the Division and the performance of all duties assigned thereto in the administration of the Act...

  5. 7 CFR 29.9231 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Administration. 29.9231 Section 29.9231 Agriculture... Tobacco Produced and Marketed in a Quota Area Administration § 29.9231 Administration. The Director... the administration of the act. The conduct of all services and the licensing or employment of...

  6. 7 CFR 235.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 235.3 Section 235.3 Agriculture... CHILD NUTRITION PROGRAMS STATE ADMINISTRATIVE EXPENSE FUNDS § 235.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the program for payment to...

  7. 9 CFR 354.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Administration. 354.3 Section 354.3... CERTIFICATION VOLUNTARY INSPECTION OF RABBITS AND EDIBLE PRODUCTS THEREOF Administration § 354.3 Administration... prescribed in the regulations in this part and as the Secretary may require in the administration of the...

  8. (CaIman) (Crustacea, Decapoda, Branchiura)

    African Journals Online (AJOL)

    1994-01-25

    Jan 25, 1994 ... (Crustacea, Decapoda, Branchiura), from industrial, mine and sewage-polluted .... and sex dependency in the bioaccumulation of copper were also examined. ...... factors. which include changes in salinity. water hardness. R eprodu ... lOry mechanism breaks down, resulting in an increase in copper levels ...

  9. 28 August 2013 - Director of Technical Quality Management Head of ESTEC Establishment European Space Agency F. Ongaro visiting the LHC tunnel at Point 1 with Technology Department Head F. Bordry and Technology Department J.-P. Tock; visiting the ATLAS experimental area with ATLAS Deputy Spokesperson T. Wengler and signing the guest book with CERN Director-General R. Heuer. Accompanied throughout by F. Bordry and V. Parma.

    CERN Multimedia

    Jean-Claude Gadmer

    2013-01-01

    28 August 2013 - Director of Technical Quality Management Head of ESTEC Establishment European Space Agency F. Ongaro visiting the LHC tunnel at Point 1 with Technology Department Head F. Bordry and Technology Department J.-P. Tock; visiting the ATLAS experimental area with ATLAS Deputy Spokesperson T. Wengler and signing the guest book with CERN Director-General R. Heuer. Accompanied throughout by F. Bordry and V. Parma.

  10. 28 November 2013 - N. N. Kudryavtsev, Russian Rector of the Moscow Institute of Physics and Technology signing an Agreement and the Guest Book with CERN Director-General R. Heuer; visiting the ATLAS cavern with ATLAS Deputy Spokesperson B. Heinemann and visiting the LHC tunnel at Point 1 with AGH University of Science and Technology A. Erokhin. M. Savino, Physics Department, Joint Institute for Nuclear Research also present.

    CERN Multimedia

    Jean-Claude Gadmer

    2013-01-01

    28 November 2013 - N. N. Kudryavtsev, Russian Rector of the Moscow Institute of Physics and Technology signing an Agreement and the Guest Book with CERN Director-General R. Heuer; visiting the ATLAS cavern with ATLAS Deputy Spokesperson B. Heinemann and visiting the LHC tunnel at Point 1 with AGH University of Science and Technology A. Erokhin. M. Savino, Physics Department, Joint Institute for Nuclear Research also present.

  11. 19 January 2011 - British University of Manchester, Vice-President and Dean for the Faculty of Engineering and Physical Sciences Professor of Structural Engineering School of Mechanical, Aerospace and Civil Engineering C. Bailey in CERN Control Centre with Department Head P. Collier; at LHCb with R. Lindner and ATLAS underground experimental area with Deputy Spokesperson D. Charlton, througout accompanied by . Collier with R. Appleby and F. Loebinger

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    19 January 2011 - British University of Manchester, Vice-President and Dean for the Faculty of Engineering and Physical Sciences Professor of Structural Engineering School of Mechanical, Aerospace and Civil Engineering C. Bailey in CERN Control Centre with Department Head P. Collier; at LHCb with R. Lindner and ATLAS underground experimental area with Deputy Spokesperson D. Charlton, througout accompanied by . Collier with R. Appleby and F. Loebinger

  12. 7 CFR 23.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.2 Section 23.2 Agriculture Office... Administration. (a) Title V will be administered by the Administrators of the Extension Service and the... Act of 1914 and the Hatch Act (as amended), August 11, 1955, the administration of the programs shall...

  13. 19th August 2010 - Chinese Chancellor and Chairman of Wuhan Huazhong Normal University Administration Committee L. Ding signing the Guest Book with Head of International Relations F. Pauss and Adviser R. Voss.

    CERN Multimedia

    Michel Blanc

    2010-01-01

    and also: visiting the LHC superconducting magnet test hall, SM18, with L. Walckiers; in the CERN Control Centre with S. Redaelli; visiting ALICE surface buildings with Collaboration Spokesperson J. Schukraft; in the Computer Centre with D. Foster. The delegation is throughout accompanied by Adviser R. Voss and ALICE Collaboration Deputy Spokesperson P. Kuijer.

  14. Exploring Careers in Hospital and Health Administration: An Invitation to a Career in Health Administration.

    Science.gov (United States)

    Health Resources Administration (DHEW/PHS), Bethesda, MD. Bureau of Health Manpower.

    This guide to career possibilities in hospital and health administration describes some of the skills required of a health or hospital administrator--interpersonal skills and managerial abilities; and also some of the varied tasks that such an administrator performs. It provides biographical sketches of several health administrators which…

  15. Gottlieb, the FDA and dumbing down medicine

    OpenAIRE

    Robbins RA

    2017-01-01

    No abstract available. Article truncated at 150 words. In the last few weeks several events have occurred that might impact drug approval in the US. President Donald Trump's pick for FDA commissioner, Dr. Scott Gottlieb. Gottlieb, like many of Trump’s picks for administration healthcare positions, is a physician. He also has experience as deputy FDA commissioner from 2005-7. However, his confirmation hearing before the Senate Committee on Health, Education, Labor and Pensions alarmed some wh...

  16. Memoranda by A.P. Uspensky to the Council of Ministers of the Provisional Siberian government

    OpenAIRE

    Sukhanov Aleksandr

    2015-01-01

    This publication offers a previously unknown memoranda by representative of the diocesan assembly of deputies of the clergy and laity of the Tomsk diocese A. P. Uspensky, addressed to the Council of Ministers of the Provisional Siberian government in July 1918. A.P. Uspensky solicited for formation of the Ministry of confessions in the Provisional Siberian government. Memoranda are initiative documents to the Statute on the Chief Administration of religious denominations adopted by the Council...

  17. Perspectives on academic veterinary administration.

    Science.gov (United States)

    Gelberg, H B; Gelberg, S

    2001-09-15

    It is important for veterinary administrators to apply knowledge bases from other fields to their own unique administrative needs. For example, although some resources are written for business managers, the discussions of four key management competency areas, guidelines for mastering these skills, organizational assessment tools, and other self-help tools may provide interesting food-for-thought for veterinary administrators.(76) In developing their own administrative styles, administrators should seek to apply those principles that seem to intuitively fit with their personal research styles, work situations, managerial styles, administrative preferences, and unique organizational culture. Through strengthening their liaisons with community and university business programs, counseling agencies, employee assistance programs, and psychology researchers, administrators can continue to be exposed to and benefit from new paradigms for consideration in veterinary medical environments. Through these liaisons, the unique needs of veterinary medical environments are also communicated to individuals within the fields of psychology and business, thus stimulating new research that specifically targets veterinary medical environment leadership issues. Each field has unique contributions to help veterinary administrators work toward creating veterinary medical environments that are creative, energetic, visionary, pragmatic, and highly marketable in order to help administrators recruit and nurture the best and brightest veterinary researchers, teachers, and clinicians.

  18. Complex administrative procedures between administrative efficiency and the obligation to protect individual rights

    International Nuclear Information System (INIS)

    Steinberg, R.

    1982-01-01

    Due to their structural premise, administrative procedures possess an inordinate amount of influence, especially in complex situations of judicial decision making, to arrive at the ''right decision'' during the passing of binding regulatory ordinances. Since their system of organization is primarily subject to legislative influence, they are governed by the rules of administrative efficiency in the sense of extensive usage of performance - oriented governmental effectuation of constitutional rights. The demands for adequate judicial protection, of which wide administrative court procedure controls are part, will also serve the goal of reaching the ''right administrative decisions.'' (orig.) [de

  19. Towards a definition of "sport administration"

    OpenAIRE

    清水, 紀宏

    1994-01-01

    In this paper, the concept of "sport administration" was defined. Sport administration is a specialized field of sport sciences as well as a part of the field of business administration classified by each industry. In previous studies on sport administration, there has not been a common understanding of the concept of sport administration among researchers. Accordingly the nature and meanings of sport administration as a special field of business administration was examined in this paper by r...

  20. The Relationship between Job Involvement and School Administrative Effectiveness as Perceived by Administration Teachers

    Science.gov (United States)

    Lin, Ruilin; Xie, Jingchen; Jeng, Yoau-Chau; Wang, Zheng-Hong

    2011-01-01

    The purpose of this study is to explore the relationships between "job involvement" and "school administrative effectiveness" as perceived by junior high school administration teachers. The findings are as follows. (1) The current status of "job involvement" and "school administrative effectiveness" as…

  1. 78 FR 29245 - U.S. General Services Administration Federal Property Management Regulations; Administrative Wage...

    Science.gov (United States)

    2013-05-20

    ... Federal Property Management Regulations; Administrative Wage Garnishment AGENCY: Office of the Chief... the U.S. General Services Administration Property Management Regulation (GSPMR) to remove information... Administrative Wage Garnishment Code of Federal Regulations (CFR) Parts affected are as follows: 41 CFR part 105...

  2. 5 CFR 179.307 - Administrative offset.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Administrative offset. 179.307 Section 179.307 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.307 Administrative offset. (a) If the debtor does not...

  3. 15th December 2010 - Legislative Leadership Institute Academy of Foreign Affairs Wisconsin, United States of America visiting the CMS undergorund area and LHC tunnel at Point 5 with Deputy Collaboration Spokesperson J. Incandela and Head of International Relations F. Pauss.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    Delegation list: Kenneth V. Cockrel, Jr, President, Detroit City Council, United States of America Mr Tim Day, Chairman, Board of Trustees, LLIAFA Christopher Heaton Harris, House of Commons, Kingdom of Great Britain and Northern Ireland Senator W. Briggs Hopson, III, Mississippi State Senate, United States of America Senator Aloisea Inyumba, Republic of Rwanda Deputy Francis Kaboneka, Parliament, Republic of Rwanda Raymond O'Dwyer, County Manager, Waterford, Republic of Ireland Senator John Pippy,Pennsylvania State Legislature, United States of America Senator Jim Walsh, Seanad Éireann, Republic of Ireland Senator Roderick D. Wright, Chairman, Governmental Organization Committee, California State Senate, United States of America Mrs Amy Polasky,President, LLIAFA Mrs Cate Zeuske, Vice President, LLIAFA Mr David Steffen, Staff, LLIAFA Dr Sybille Ambühl Switzerland Official Guide Mr Doug Jenkins Security Detail (US)

  4. Philippines - Revenue Administration Reform

    Data.gov (United States)

    Millennium Challenge Corporation — The Millennium Challenge Account-Philippines' (MCA-P) implementation of the Revenue Administration Reform Project (RARP) is expected to improve tax administration,...

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    classroom discussion emphasizes the effect of titrated volume in potentiometric titrations. Nature Watch has always been the most popular section and, here Sindhu Radhakrishna traces the social behaviour of the slender Loris, a nocturnal prosimian found in India. She recounts the story of the various perils which threaten ...

  6. Queer Girls in Class: Lesbian Teachers and Students Tell Their Classroom Stories

    Science.gov (United States)

    Bridgman, Becky L.

    2012-01-01

    Lori Horvitz's book contains 26 essays from queer students and educators exploring how sexuality can affect classroom dynamics. Although the book's title references lesbians, it also encompasses bisexuals and highlights friendships between gays and lesbians. In addition, many of the essays discuss social justice initiatives as well as illustrate…

  7. Toward (Whose) Morality in Teacher Education?

    Science.gov (United States)

    Milner, H. Richard; Delale-O'Connor, Lori

    2016-01-01

    Richard Milner, and Lori Delale-O'Connor offer their remarks on Daniel Lapsley & Ryan Woodbury's commentary (available in this v38 n3 2016 issue of "Action in Teacher Education") entitled "Moral Character Development for Teacher Education." They begin the conversation by commenting that Lapsley and Woodbury raise some…

  8. 77 FR 3771 - Notice of Issuance of Final Outer Continental Shelf Air Permit for Shell Offshore, Inc.

    Science.gov (United States)

    2012-01-25

    ... locations within Shell's DeSoto Canyon and Lloyd Ridge lease locations on the OCS in the Gulf of Mexico... INFORMATION CONTACT: Lori Shepherd, Air Permits Section, Air Planning Branch, Air, Pesticides and Toxics... effective on December 30, 2011. Dated: January 12, 2012. Beverly H. Banister, Director, Air, Pesticides and...

  9. EPA Administrative Enforcement Dockets

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Administrative Enforcement Dockets database contains the electronic dockets for administrative penalty cases filed by EPA Regions and Headquarters. Visitors...

  10. Human factoring administrative procedures

    International Nuclear Information System (INIS)

    Grider, D.A.; Sturdivant, M.H.

    1991-01-01

    In nonnuclear business, administrative procedures bring to mind such mundane topics as filing correspondence and scheduling vacation time. In the nuclear industry, on the other hand, administrative procedures play a vital role in assuring the safe operation of a facility. For some time now, industry focus has been on improving technical procedures. Significant efforts are under way to produce technical procedure requires that a validated technical, regulatory, and administrative basis be developed and that the technical process be established for each procedure. Producing usable technical procedures requires that procedure presentation be engineered to the same human factors principles used in control room design. The vital safety role of administrative procedures requires that they be just as sound, just a rigorously formulated, and documented as technical procedures. Procedure programs at the Tennessee Valley Authority and at Boston Edison's Pilgrim Station demonstrate that human factors engineering techniques can be applied effectively to technical procedures. With a few modifications, those same techniques can be used to produce more effective administrative procedures. Efforts are under way at the US Department of Energy Nuclear Weapons Complex and at some utilities (Boston Edison, for instance) to apply human factors engineering to administrative procedures: The techniques being adapted include the following

  11. Webmin administrator's cookbook

    CERN Document Server

    Karzynski, Michal

    2014-01-01

    Written in a cookbook format with practical recipes this book helps you to perform various administrative tasks using Webmin and enables you to perform common jobs more efficiently.This book is perfect for System administrators who want to learn more advanced concepts of Webmin and how it can help to set up a server for development, testing or deployment.

  12. 45 CFR 1336.71 - Administrative costs.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Administrative costs. 1336.71 Section 1336.71... Administrative costs. Reasonable administrative costs of the RLF may be paid out of the loan fund. The grant award agreement between the Loan Administrator and ANA will set forth the allowable administrative costs...

  13. Administrative Data Repository (ADR)

    Data.gov (United States)

    Department of Veterans Affairs — The Administrative Data Repository (ADR) was established to provide support for the administrative data elements relative to multiple categories of a person entity...

  14. MACEDONIAN ADMINISTRATIVE JUDICIAL SYSTEM FOR SOLVING ADMINISTRATIVE DISPUTES COMPARABLE TO EUROPEAN SYSTEMS

    Directory of Open Access Journals (Sweden)

    Sladjana Eftimova

    2015-07-01

    Full Text Available The structure of the legal system, through history until today mostly depends on law and policy which is conducted by the country. In European countries, there is position for historical and cultural conceptions for administrative judicature, differences and similarity that leave mark for solving administrative disputes. The obligation – an internal judicial reform to be established in legal system, is conducted by each of the countries after the breaking down and division of Social Federative Republic of Yugoslavia or SFRY due to following the European law for constitution of legitimacy and constitutionality of acts as well as implementing of independent administrative judicature. Analyze of the current condition regarding the independency and objectiveness of the judicature is necessary in our country and it is important to be seen how the conditions for working of the administrative judicature can be improved.

  15. Judicial review of administrative silence

    Directory of Open Access Journals (Sweden)

    Radošević Ratko S.

    2015-01-01

    Full Text Available Administrative silence is a situation in which the competent authority, within the statutory deadline, has not issued an administrative act at the request of the party. In the case of administrative silence, given the fact that the citizens are unable to protect their rights and legal interests without an administrative act, they are provided with legal protection. In this case, the same legal relationship is created, directly on the basis of the statute, as in the situation in which the party's request is rejected. This means that the party may, under the conditions prescribed by the statute, initiate the procedure of judicial review of administrative silence. In the paper, the author explains the conditions under which the judicial review of administrative silence can be initiated and the role of the court in this judicial procedure.

  16. 20 CFR 418.3610 - Is there administrative or judicial review for administrative actions that are not initial...

    Science.gov (United States)

    2010-04-01

    ... Administrative Review Process § 418.3610 Is there administrative or judicial review for administrative actions... reviewed by us, but they are not subject to the administrative or judicial review process as provided by... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Is there administrative or judicial review...

  17. 78 FR 9771 - Federal Highway Administration

    Science.gov (United States)

    2013-02-11

    ... DEPARTMENT OF TRANSPORTATION Federal Highway Administration Notice of Final Federal Agency Action on Proposed Transportation Project in Illinois and Indiana AGENCY: Federal Highway Administration...., Acting Division Administrator, Federal Highway Administration, 3250 Executive Park Drive, Springfield...

  18. 20 CFR 416.105 - Administration.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Administration. 416.105 Section 416.105 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL SECURITY INCOME FOR THE AGED, BLIND, AND DISABLED Introduction, General Provisions and Definitions § 416.105 Administration. The Supplemental...

  19. 7 CFR 1465.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1465.2 Section 1465.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... § 1465.2 Administration. (a) Administration and implementation of AMA's conservation provisions for the...

  20. Association between workarounds and medication administration errors in bar-code-assisted medication administration in hospitals

    NARCIS (Netherlands)

    van der Veen, Willem; van den Bemt, Patricia M L A; Wouters, Hans; Bates, David W; Twisk, Jos W R; de Gier, Johan J; Taxis, Katja

    Objective: To study the association of workarounds with medication administration errors using barcode-assisted medication administration (BCMA), and to determine the frequency and types of workarounds and medication administration errors. Materials and Methods: A prospective observational study in

  1. Beautiful Minds—For How Long.

    Directory of Open Access Journals (Sweden)

    Lori Marino

    2008-07-01

    Full Text Available Lori Marino reviews the new bookBeautiful Minds, which investigates the "parallel lives" of primates and cetaceans and argues that despite the evolutionary distance of these large-brained mammals, they nevertheless share a capacity for complex communication and social behavior, representing a striking example of convergence in intelligence.

  2. Administration and Jurisdictional Policy

    Directory of Open Access Journals (Sweden)

    Eduardo Hernando Nieto

    2009-06-01

    Full Text Available To what extent does studying jurisdictional politics need the knowledge of different administrative theories in general and the science of public administration in particular? This small text proposes such reflection and comes to the conclusion that it is impossible to propose a new approximation to this topic without considering the administrative theory, for that the specialists and thinkers will get more with the contact of this discipline from what it is called a multidisciplinary approach.

  3. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. [75 FR 48277, Aug. 10, 2010] ...

  4. 7 CFR 760.1101 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Administration. 760.1101 Section 760.1101 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE... Administration. (a) This program is administered under the general supervision of the Administrator, Farm Service...

  5. 7 CFR 251.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 251.2 Section 251.2 Agriculture... Administration. (a) Food and Nutrition Service. Within the United States Department of Agriculture (the... this section, any information on changes in program administration, including any changes resulting...

  6. Keynote Address

    OpenAIRE

    Johanns, Mike

    2006-01-01

    Mr. Figueroa was born in San Juan, Puerto Rico on September 9, 1955. He obtained a B.S. Degree in Mechanical Engineering from the University of Puerto Rico, Mayaguez Campus in 1978, and completed advanced courses in Mechanical Engineering at the University of Maryland. He has been a member of the Senior Executive Service of the U.S. Federal Government since 1997.In August 2004 he was appointed to the position of Deputy Associate Administrator for Programs in the Science Mission Directorate at...

  7. The new Administrative Procedure and Administrative Process Law (Law 1.437 of 2011)

    OpenAIRE

    Expósito Vélez, Juan Carlos

    2011-01-01

    The new Administrative Procedure and Administrative Process Law (Law 1.437 of 2011) require a deep analysis, because it brings a new perception of old models of the Administrative Colombian Law: nullity, nullity and reestablishment of rights and the controversies relative to public contracts. El Nuevo Código de Procedimiento Administrativo y de lo Contencioso Administrativo (Ley 1.437 de 2.011) requiere de un análisis profundo, debido al nuevo alcance que trae a figuras tradicionales del ...

  8. Spatially enabled land administration

    DEFF Research Database (Denmark)

    Enemark, Stig

    2006-01-01

    enabling of land administration systems managing tenure, valuation, planning, and development will allow the information generated by these activities to be much more useful. Also, the services available to private and public sectors and to community organisations should commensurably improve. Knowledge....... In other words: Good governance and sustainable development is not attainable without sound land administration or - more broadly – sound land management. The paper presents a land management vision that incorporates the benefits of ICT enabled land administration functions. The idea is that spatial...... the communication between administrative systems and also establish more reliable data due to the use the original data instead of copies. In Denmark, such governmental guidelines for a service-oriented ITarchitecture in support of e-government are recently adopted. Finally, the paper presents the role of FIG...

  9. Humanism, Administration and Education

    DEFF Research Database (Denmark)

    Plum, Maja

    2012-01-01

    are not restricted to the administrative practices, but are part of education and its humanistic legacy as well. As such, the administrative demand of documentation becomes possible and recognisable through its reproductive elements. Elements that are constituted in a transformative conjunction in which......Abstract Through the example of a Danish reform of educational plans in early childhood education, this paper analyses the emergence of a new pedagogical desire related to administrative educational reforms promoting accountability, visibility and documentation. Two arguments are made: first......, it is argued that the changes in administrative practices during the last decade constitute a transformation, but also a reproduction of relations between knowledge and governing that goes back to the big expansion of the welfare state. Second, it is argued that these relations between knowledge and governing...

  10. 5 CFR 2421.9 - Administrative Law Judge.

    Science.gov (United States)

    2010-01-01

    ... Administrative Law Judge. Administrative Law Judge means the Chief Administrative Law Judge or any Administrative Law Judge designated by the Chief Administrative Law Judge to conduct a hearing in cases under 5 U.S.C... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Administrative Law Judge. 2421.9 Section...

  11. The interpretation of administrative contracts

    Directory of Open Access Journals (Sweden)

    Cătălin-Silviu SĂRARU

    2014-06-01

    Full Text Available The article analyzes the principles of interpretation for administrative contracts, in French law and in Romanian law. In the article are highlighted derogations from the rules of contract interpretation in common law. Are examined the exceptions to the principle of good faith, the principle of common intention (willingness of the parties, the principle of good administration, the principle of extensive interpretation of the administrative contract. The article highlights the importance and role of the interpretation in administrative contracts.

  12. NEITHER FISH NOR FOWL: ADMINISTRATIVE JUDGES IN THE MODERN ADMINISTRATIVE STATE

    Directory of Open Access Journals (Sweden)

    Russell L. Weaver

    2010-10-01

    Full Text Available This article examines the role of administrative adjudication in the United States constitutional system. It begins by noting that such adjudication fits uncomfortably within a system of divided powers. Administrative judges, including administrative law judges [ALJs] (who have the highest level of protection and status, are considerably more circumscribed than ordinary Article III judges. Indeed, administrative judges are usually housed in the agencies for which they decide cases, rather than in independent adjudicative bodies, and they do not always have the final say regarding the cases they decide. In many instances, the agency can appeal an adverse administrative judge’s decision directly to the head of the agency, and the agency head retains broad power to overrule the administrative judge’s determinations. In other words, the agency can substitute its judgment for that of the administrative judge regarding factual determinations, legal determinations, and policy choices. As a result, many administrative adjudicative structures involve difficult tradeoffs between independence, political control, and accountability. This article examines issues related to the status and power of administrative judges, as well as the constraints that have been imposed on administrative adjudicative authority, and explores whether those constraints continue to serve the purposes for which they were originally imposed. Cet article examine le rôle du règlement de différends dans le domaine administratif dans le cadre du système constitutionnel des États-Unis. Il note d’abord qu’une telle façon de régler les différends cadre difficilement avec un système où les pouvoirs sont divisés. Les juges administratifs, y inclus les juges de droit administratif (qui jouissent du niveau le plus élevé de protection et de statut, sont considérablement plus restreints que les juges ordinaires sous l’Article III. En effet, les juges administratifs sont

  13. SELinux policy administration

    CERN Document Server

    Vermeulen, Sven

    2013-01-01

    A step-by-step guide to learn how to set up security on Linux servers by taking SELinux policies into your own hands.Linux administrators will enjoy the various SELinux features that this book covers and the approach used to guide the admin into understanding how SELinux works. The book assumes that you have basic knowledge in Linux administration, especially Linux permission and user management.

  14. 7 CFR 1467.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1467.2 Section 1467.2 Agriculture... AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS WETLANDS RESERVE PROGRAM § 1467.2 Administration. (a) The... organizations in program administration. No determination by these agencies or organizations shall compel NRCS...

  15. 7 CFR 281.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 281.2 Section 281.2 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM ADMINISTRATION OF THE FOOD STAMP PROGRAM ON INDIAN RESERVATIONS § 281.2 Administration. (a) Qualification. (1) The appropriate ITO of an established Indian...

  16. 7 CFR 760.1301 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Administration. 760.1301 Section 760.1301 Agriculture... Administration. (a) This subpart establishes, subject to the availability of funds, the terms and conditions... Administration, and Related Agencies Appropriations Act, 2010 (2010 Agriculture Appropriations Bill, Pub. L. 111...

  17. 7 CFR 631.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Administration. 631.3 Section 631.3 Agriculture... AGRICULTURE LONG TERM CONTRACTING GREAT PLAINS CONSERVATION PROGRAM General Provisions § 631.3 Administration. (a) NRCS is responsible for the administration of the Great Plains Conservation Program (GPCP). (b...

  18. 20 CFR 628.310 - Administration.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Administration. 628.310 Section 628.310 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Programs § 628.310 Administration. Funds provided to the...

  19. 42 CFR 403.512 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Administration. 403.512 Section 403.512 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL... Administration. (a) General. Administration of grants will be in accordance with the provisions of this subpart...

  20. 4 CFR 83.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Administration. 83.2 Section 83.2 Accounts GOVERNMENT ACCOUNTABILITY OFFICE RECORDS PRIVACY PROCEDURES FOR PERSONNEL RECORDS § 83.2 Administration. The administration of this part is the duty and responsibility of the Director, Personnel, U.S. Government...

  1. RBAC Administration in Distributed Systems

    NARCIS (Netherlands)

    Dekker, M.A.C.; Crampton, J.; Etalle, Sandro

    2007-01-01

    Despite a large body of literature on the administration of RBAC policies in centralized systems, the problem of the administration of a distributed system has hardly been addressed. We present a formal system for modelling a distributed RBAC system and its administration. We define two basic

  2. Administrative court control in taxation matters

    OpenAIRE

    Nataša Zunić Kovačević

    2016-01-01

    Starting with the current organisation of administrative court control in taxation matters, this paper, after a brief overview of the normative legal framework of control in such matters, provides an analysis of certain indicators of administrative and administrative court control implementation in taxation matters. The experience of the application of administrative control in taxation matters and an analysis of accessible indicators of recent administrative court control in taxation matters...

  3. 7 CFR 634.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Administration. 634.3 Section 634.3 Agriculture... AGRICULTURE LONG TERM CONTRACTING RURAL CLEAN WATER PROGRAM General § 634.3 Administration. At the national.... The Secretary of Agiculture has delegated responsibility for administration of the program (43 FR 8252...

  4. 7 CFR 225.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 225.3 Section 225.3 Agriculture... CHILD NUTRITION PROGRAMS SUMMER FOOD SERVICE PROGRAM General § 225.3 Administration. (a) Responsibility within the Department. FNS shall act on behalf of the Department in the administration of the Program. (b...

  5. 33 CFR 5.07 - Administration.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Administration. 5.07 Section 5.07... § 5.07 Administration. Any authority vested in the Commandant by this part may be delegated by him to... appropriate for the functioning, organization, and internal administration of the Auxiliary. ...

  6. 50 CFR 401.1 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Administration. 401.1 Section 401.1... INTERIOR AND NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT..., DEVELOPMENT AND ENHANCEMENT § 401.1 Administration. The Director of the U.S. Fish and Wildlife Service and the...

  7. 7 CFR 633.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Administration. 633.3 Section 633.3 Agriculture... AGRICULTURE LONG TERM CONTRACTING WATER BANK PROGRAM § 633.3 Administration. (a) The regulations in this part... administration and related policy matters. No determination by the State Technical Committee shall compel the...

  8. 7 CFR 249.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 249.3 Section 249.3 Agriculture... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration. (a) Delegation to FNS. Within FNS, FNS shall act on behalf of the Department in the administration of...

  9. 7 CFR 12.6 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 12.6 Section 12.6 Agriculture Office....6 Administration. (a) General. A determination of ineligibility for benefits in accordance with the... making such determinations, as provided in this section. (b) Administration by FSA. (1) The provisions of...

  10. 7 CFR 227.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 227.3 Section 227.3 Agriculture... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. (b...

  11. The Future of Public Administration.

    Science.gov (United States)

    Cleveland, Harlan

    Past approaches to public administration, the diminishing distinctions between foreign and domestic policy, the role of the public administrator, and leadership qualities are discussed. As a relatively young discipline, public administration first focused on scientific management (1920's). It then shifted to the art and science of getting things…

  12. Kommunernes administrative personaleforbrug 2010-2012

    DEFF Research Database (Denmark)

    Hansen, Sune Welling; Houlberg, Kurt

    KORA har undersøgt kommunernes administrative personaleforbrug i perioden fra 2010 til 2012. Resultaterne viser, at antallet af administrative medarbejdere og personaleudgifterne er faldet over tidsperioden, og at reduktionen i antallet af medarbejdere overvejende har fundet sted blandt...... administrative chefer, særligt decentrale ledere. Antallet af medarbejdere med myndighedsopgaver er derimod steget. Fra 2010 til 2012 har kommunerne gennemsnitligt reduceret antallet af administrative medarbejdere med halvanden til to procent årligt, opgjort i antallet af medarbejdere per 1.000 indbyggere. Det...... viser beregninger baseret på personale- og løndata fra Kommunernes og Regionernes Løndatakontor. Reduktionen har overvejende fundet sted blandt administrative chefer, særligt decentrale ledere, mens antallet af medarbejdere med myndighedsopgaver omvendt er steget. Undersøgelsen viser også...

  13. 49 CFR 98.12 - Administrative sanctions.

    Science.gov (United States)

    2010-10-01

    ... an administrative sanction against a former employee who, after a final administrative decision under... imposed under subsection (a) of this section are: (1) Prohibiting the former employee from making, on... ACTIVITIES Administrative Sanctions § 98.12 Administrative sanctions. (a) The Secretary, in decisions under...

  14. Chronicle 1998, Administrative law/Droit administratif

    NARCIS (Netherlands)

    Bok, A.J.

    1999-01-01

    In this contribution, two recent developments in Dutch administrative law are discussed. The codification of administrative law in a General Administrative Law Act (1994) has contributed much to this field of law, but has also caused additional legal complications for the administration. In 1997 the

  15. 7 CFR 250.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 250.2 Section 250.2 Agriculture... TERRITORIES AND POSSESSIONS AND AREAS UNDER ITS JURISDICTION General § 250.2 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of the...

  16. 7 CFR 57.10 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administration. 57.10 Section 57.10 Agriculture... PRODUCTS INSPECTION ACT) Regulations Governing the Inspection of Eggs General § 57.10 Administration. The... require in the enforcement or administration of the provisions of the act and the regulations in this part...

  17. 7 CFR 210.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 210.3 Section 210.3 Agriculture... CHILD NUTRITION PROGRAMS NATIONAL SCHOOL LUNCH PROGRAM General § 210.3 Administration. (a) FNS. FNS will act on behalf of the Department in the administration of the Program. Within FNS, the CND will be...

  18. 7 CFR 220.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 220.3 Section 220.3 Agriculture... CHILD NUTRITION PROGRAMS SCHOOL BREAKFAST PROGRAM § 220.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program covered by this part. Within...

  19. 7 CFR 70.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administration. 70.3 Section 70.3 Agriculture... PRODUCTS AND RABBIT PRODUCTS Grading of Poultry Products and Rabbit Products General § 70.3 Administration... Secretary may require in the enforcement or administration of the provisions of the Act and the regulations...

  20. 7 CFR 226.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 226.3 Section 226.3 Agriculture... CHILD NUTRITION PROGRAMS CHILD AND ADULT CARE FOOD PROGRAM General § 226.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. (b...

  1. 7 CFR 246.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 246.3 Section 246.3 Agriculture... § 246.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, SFPD and the Regional Offices are responsible...

  2. 10 CFR 725.24 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Administration. 725.24 Section 725.24 Energy DEPARTMENT OF ENERGY PERMITS FOR ACCESS TO RESTRICTED DATA Permits § 725.24 Administration. With respect to each permit... designate a DOE or National Nuclear Security Administration office which will: (a) Process all personnel...

  3. 7 CFR 1415.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1415.2 Section 1415.2 Agriculture... AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS GRASSLANDS RESERVE PROGRAM § 1415.2 Administration. (a) The... administration of GRP. This authority cannot be further delegated. No provision of this part which is required by...

  4. 7 CFR 215.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 215.3 Section 215.3 Agriculture... CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. Within FNS, CND...

  5. 7 CFR 248.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 248.3 Section 248.3 Agriculture... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of...

  6. 28 CFR 36.204 - Administrative methods.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Administrative methods. 36.204 Section 36... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.204 Administrative methods... standards or criteria or methods of administration that have the effect of discriminating on the basis of...

  7. Pro Linux System Administration

    CERN Document Server

    Turnbull, James

    2009-01-01

    We can all be Linux experts, provided we invest the time in learning the craft of Linux administration. Pro Linux System Administration makes it easy for small to medium--sized businesses to enter the world of zero--cost software running on Linux and covers all the distros you might want to use, including Red Hat, Ubuntu, Debian, and CentOS. Authors, and systems infrastructure experts James Turnbull, Peter Lieverdink, and Dennis Matotek take a layered, component--based approach to open source business systems, while training system administrators as the builders of business infrastructure. If

  8. Reproductive Effeciency of an Indigenous Irabian Goat ( Capra Hircus)

    African Journals Online (AJOL)

    It is well known that goat can tolerate harsh conditions; however there are little information about its reproduction functions such as testis histomorphometry and efficiency of sertoli cells. This study aimed to estimate germ cell types and number per sertoli cell of an indigenous Iranian goat (Lori goat). Semen was collected ...

  9. 24 CFR 511.71 - Administrative costs.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Administrative costs. 511.71... Administration § 511.71 Administrative costs. (a) Maximum amount. Any grantee may use not to exceed 10 percent of... years for administrative costs eligible under paragraphs (b) and (c) of this section. Eligible grantees...

  10. 24 CFR 583.135 - Administrative costs.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Administrative costs. 583.135... Administrative costs. (a) General. Up to five percent of any grant awarded under this part may be used for the purpose of paying costs of administering the assistance. (b) Administrative costs. Administrative costs...

  11. 28 CFR 345.57 - Administrative pay.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Administrative pay. 345.57 Section 345.57... (FPI) INMATE WORK PROGRAMS Inmate Pay and Benefits § 345.57 Administrative pay. An inmate excused from a job assignment may receive administrative pay for such circumstances as a general recall for an...

  12. The U.S. Department of Energy Office of Indian Energy Policy and Programs Las Vegas, Nevada, Roundtable Summary

    Energy Technology Data Exchange (ETDEWEB)

    None

    2011-03-16

    LAS VEGAS EXECUTIVE SUMMARY The Las Vegas, Nevada DOE Tribal Roundtable convened on March 16th, at the Las Vegas Hilton. The meeting was hosted by the Department of Energy (DOE) Office of Indian Policy and Programs (DOE Office of Indian Energy) and facilitated by JR Bluehouse, Program Manager, Udall Foundation’s U.S. Institute for Environmental Conflict Resolution (U.S. Institute). Mr. Bluehouse was assisted by Tamara, Underwood, Program Assistant, U.S. Institute.  Tribal leaders and representatives from multiple tribal governments and communities attended the roundtable. Tracey LeBeau, newly appointed Director of the Office of Indian Energy attended.    LaMont Jackson from DOE’s Office of Electricity attended. Also attending from the administration and federal agencies were Kim Teehee, Senior Policy Advisor for Native American Affairs, The White House; Charlie Galbraith, Associate Director of the Office of Public Engagement and Deputy Associate Director of the Office of Intergovernmental Affairs, The White House; Jodi Gillette, Deputy Assistant Secretary for Policy and Economic Development, the Bureau of Indian Affairs.

  13. 75 FR 79949 - Revision of Delegation of Authority

    Science.gov (United States)

    2010-12-21

    ... Marketing and Regulatory Programs (MRP) to the Deputy Under Secretary for MRP to establish the order in... Marketing and Regulatory Programs (MRP) has delegated to the Deputy Under Secretary for MRP the following... exercise that delegation when the MRP mission area has more than one Deputy Under Secretary. The authority...

  14. Socio-Statistical Research on the Internalization of European Administrative Space Principles in the Romanian Public Administration

    OpenAIRE

    Matei, Ani; Matei, Lucica; Iancu, Diana-Camelia

    2011-01-01

    The authors propose an analysis of the public administration reform in Romania by assessing whether the Romanian civil servants perform their duties according to the regulations of the European Administrative Space. The paper offers a socio-statistic perspective on the internalization of the European Administrative Space principles, namely, the rule of law, openness towards citizens, and public administration responsibility in a Romanian context, after the European Union accession. Designed w...

  15. 6th July 2010 - United Kingdom Science and Technology Facilities Council W. Whitehorn signing the guest book with Head of International relations F. Pauss, visiting the Computing Centre with Information Technology Department Head Deputy D. Foster, the LHC superconducting magnet test hall with Technology Department P. Strubin,the Centre Control Centre with Operation Group Leader M. Lamont and the CLIC/CTF3 facility with Project Leader J.-P. Delahaye.

    CERN Multimedia

    Teams : M. Brice, JC Gadmer

    2010-01-01

    6th July 2010 - United Kingdom Science and Technology Facilities Council W. Whitehorn signing the guest book with Head of International relations F. Pauss, visiting the Computing Centre with Information Technology Department Head Deputy D. Foster, the LHC superconducting magnet test hall with Technology Department P. Strubin,the Centre Control Centre with Operation Group Leader M. Lamont and the CLIC/CTF3 facility with Project Leader J.-P. Delahaye.

  16. 27 Febuary 2012 - US DoE Associate Director of Science for High Energy Physics J. Siegrist visiting the LHC superconducting magnet test hall with adviser J.-P. Koutchouk and engineer M. Bajko; in CMS experimental cavern with Spokesperson J. Incadela;in ATLAS experimental cavern with Deputy Spokesperson A. Lankford; in ALICE experimental cavern with Spokesperson P. Giubellino; signing the guest book with Director for Accelerators and Technology S. Myers.

    CERN Multimedia

    Laurent Egli

    2012-01-01

    27 Febuary 2012 - US DoE Associate Director of Science for High Energy Physics J. Siegrist visiting the LHC superconducting magnet test hall with adviser J.-P. Koutchouk and engineer M. Bajko; in CMS experimental cavern with Spokesperson J. Incadela;in ATLAS experimental cavern with Deputy Spokesperson A. Lankford; in ALICE experimental cavern with Spokesperson P. Giubellino; signing the guest book with Director for Accelerators and Technology S. Myers.

  17. Understanding land administration systems

    DEFF Research Database (Denmark)

    P. Williamson, Ian; Enemark, Stig; Wallace, Judy

    2008-01-01

    This paper introduces basic land administration theory and highlights four key concepts that are fundamental to understanding modern land administration systems. Readers may recall the first part of the paper in October issue of Coordinates. Here is the concluding part that focuses on the changing...

  18. [Administration: practices, myths and ideologies].

    Science.gov (United States)

    Spinelli, Hugo

    2017-01-01

    Administration in the social field is examined based on an analysis of its practices, the rationalist myth and its ideological dimensions. In this way, the article discusses the most frequently utilized concepts (administration, management, gerencia, gestión) and their etymologies; the limitations of teaching administration; the complexity of a practice marked by the dimensions of science, art and the social game; and the ideological question underlying the great thought factory that the general theory of administration has been since the start of the 19th century. The article reflects upon the need to construct a theory based in practice contextualized in the global south that goes beyond the classic frames of reference and, above all, to transform administration into a problem to be discussed outside of the knowledge that recognizes it as a technical practice.

  19. Administration of radioisotope production

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1964-01-15

    Current developments in atomic energy, and the administrative problems to which they give rise, were surveyed in a seminar on 'Atomic Energy for Atomic Energy Administrators' held at IAEA headquarters from 30 September to 4 October 1963. The ground covered included protection against radiation, isotopes and radiation sources, research reactors, nuclear power, legal matters, technical and scientific administration, the role of the universities, and the Agency's part in assistance to developing countries. The possibilities and limitations of radioisotope production from research reactors were discussed by Dr. G. B. Cook, of the Division of Research and Laboratories, IAEA in this paper.

  20. Administration of radioisotope production

    International Nuclear Information System (INIS)

    1964-01-01

    Current developments in atomic energy, and the administrative problems to which they give rise, were surveyed in a seminar on 'Atomic Energy for Atomic Energy Administrators' held at IAEA headquarters from 30 September to 4 October 1963. The ground covered included protection against radiation, isotopes and radiation sources, research reactors, nuclear power, legal matters, technical and scientific administration, the role of the universities, and the Agency's part in assistance to developing countries. The possibilities and limitations of radioisotope production from research reactors were discussed by Dr. G. B. Cook, of the Division of Research and Laboratories, IAEA in this paper.

  1. Administrative corruption from sociology perspective and the relationship between administrative corruption and social security

    OpenAIRE

    Mohsen Zarei Jlyany; Gholam Reza Sharafi; Mustafa Tavani; Mansour Haghighatian; Moslem Tavani

    2014-01-01

    certain principles Observance and non- Observance on organizing a social system will have Indisputable effect at the Organization. And administrative systems are not exempt from this, also the selection of the Administration components and also How to Place the components together can affect its performance. Meanwhile, the government's role in the prevalence or no-prevalence, the extent type and the way of administrative corruption influence, in this article, researchers wants to explore the ...

  2. 5 CFR 179.309 - Additional administrative procedures.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Additional administrative procedures. 179.309 Section 179.309 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Administrative Offset § 179.309 Additional administrative procedures. Nothing...

  3. 76 FR 82311 - Food and Drug Administration Transparency Initiative: Food and Drug Administration Report on Good...

    Science.gov (United States)

    2011-12-30

    ...] Food and Drug Administration Transparency Initiative: Food and Drug Administration Report on Good Guidance Practices: Improving Efficiency and Transparency; Availability AGENCY: Food and Drug Administration, HHS. ACTION: Notice of availability; request for comments. SUMMARY: As part of the Transparency...

  4. Centos system administration essentials

    CERN Document Server

    Mallett, Andrew

    2014-01-01

    If you are a Linux administrator who is looking to gain knowledge that differentiates yourself from the crowd, then this is the book for you. Beginners who have a keen interest to learn more about Linux administration will also progress quickly with this resourceful learning guide.

  5. The Art of Administration.

    Science.gov (United States)

    Borelli, Frank L.

    1984-01-01

    Presents ten guidelines for human relations skills that can help elevate the practice of student personnel administration to an art form. Administrators need to develop and perfect leadership skills including respect for individual differences, consistency, listening skills, instinct, being a role model, and establishment of realistic performance…

  6. Microsoft Windows 7 Administration Instant Reference

    CERN Document Server

    Panek, William

    2010-01-01

    An on-the-spot reference for Windows 7 administrators. Hundreds of thousands of IT administrators, network administrators, and IT support technicians work daily with Windows 7. This well-organized, portable reference covers every facet of Windows 7, providing no-nonsense instruction that is readily accessible when you need it. Designed for busy administrators, it features thumb tabs and chapter outlines to make answers easy to find.: Windows 7 administrative and support personnel need quick answers to situations they confront each day; this Instant Reference is designed to provide information,

  7. Tickled to Death: Analysing Public Perceptions of ‘Cute’ Videos of Threatened Species (Slow Lorises – Nycticebus spp.) on Web 2.0 Sites

    Science.gov (United States)

    Nekaris, By K. Anne-Isola; Campbell, Nicola; Coggins, Tim G.; Rode, E. Johanna; Nijman, Vincent

    2013-01-01

    Background The internet is gaining importance in global wildlife trade and changing perceptions of threatened species. There is little data available to examine the impact that popular Web 2.0 sites play on public perceptions of threatened species. YouTube videos portraying wildlife allow us to quantify these perceptions. Methodology/Principal Findings Focussing on a group of threatened and globally protected primates, slow lorises, we quantify public attitudes towards wildlife conservation by analysing 12,411 comments and associated data posted on a viral YouTube video ‘tickling slow loris’ over a 33-months period. In the initial months a quarter of commentators indicated wanting a loris as a pet, but as facts about their conservation and ecology became more prevalent this dropped significantly. Endorsements, where people were directed to the site by celebrities, resulted mostly in numerous neutral responses with few links to conservation or awareness. Two conservation-related events, linked to Wikipedia and the airing of a television documentary, led to an increase in awareness, and ultimately to the removal of the analysed video. Conclusions/Significance Slow loris videos that have gone viral have introduced these primates to a large cross-section of society that would not normally come into contact with them. Analyses of webometric data posted on the internet allow us quickly to gauge societal sentiments. We showed a clear temporal change in some views expressed but without an apparent increase in knowledge about the conservation plight of the species, or the illegal nature of slow loris trade. Celebrity endorsement of videos showing protected wildlife increases visits to such sites, but does not educate about conservation issues. The strong desire of commentators to express their want for one as a pet demonstrates the need for Web 2.0 sites to provide a mechanism via which illegal animal material can be identified and policed. PMID:23894432

  8. Genotypic frequency of calpastatin gene in lori sheep by polymerase ...

    African Journals Online (AJOL)

    Article Metrics. Metrics Loading ... Metrics powered by PLOS ALM · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers · about Open Access · FAQ's · News · AJOL jobs · More about AJOL ...

  9. Genotypic frequency of calpastatin gene in lori sheep by polymerase ...

    African Journals Online (AJOL)

    SAM

    2014-05-07

    May 7, 2014 ... rate of skeletal muscle growth can result from a decree- sed rate of muscle protein degradation, and this is asso- ciated with a decrease in activity of the calpain system, due principally to a large increase in calpastatin activity. (Goll et al., 1998). Associations have been reported between variation in. CAST ...

  10. La bonne administration en droit communautaire et le Code européen de bonne conduite administrative

    NARCIS (Netherlands)

    Mendes, J.

    2009-01-01

    The Code of Good Administrative Behaviour is an important source for understandingthe principle and concept of good administration in European administrative law, since itencompasses certain aspects that tend to be overlooked by the case law of the European Courts andEuropean law scholars.

  11. Inspiring Growth

    Science.gov (United States)

    Fink, Stephen; Markholt, Anneke

    2017-01-01

    In her 24 years as an educator, Principal Lori Duckstein has experienced many kinds of professional development aimed at improving leadership and instruction. And, like school leaders and teachers everywhere, she has completed many one- and two-day training workshops only to return to her school and reflect on her learning in isolation. Recently,…

  12. ADMINISTRATIVE RULEMAKING IN ETHIOPIA:

    African Journals Online (AJOL)

    MLR

    and the theoretical issues in relation to administrative legislation are discussed followed ..... that “laws properly so called” must be distinguished from morals and other ..... 44 William Wade, (1988), Administrative Law (Oxford University Press), p. .... 66 Rule 320, Rules of procedure and conduct of business in the Lok Sabha.

  13. Grant Administration Officer | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Job Summary The Grant Administration Officer is responsible to oversee all ... The incumbent provides administrative and financial advice throughout the life ... and the Chief, External Funds Management (EFM), the administrative and financial ...

  14. Publication of administrative circular

    CERN Multimedia

    HR Department

    2009-01-01

    ADMINISTRATIVE CIRCULAR NO. 23 (REV. 2) – SPECIAL WORKING HOURS Administrative Circular No. 23 (Rev. 2) entitled "Special working hours", approved following discussion in the Standing Concertation Committee on 9 December 2008, will be available on the intranet site of the Human Resources Department as from 19 December 2008: http://cern.ch/hr-docs/admincirc/admincirc.asp It cancels and replaces Administrative Circular No. 23 (Rev. 1) entitled "Stand-by duty" of April 1988. A "Frequently Asked Questions" information document on special working hours will also be available on this site. Paper copies of this circular will shortly be available in Departmental Secretariats. Human Resources Department Tel. 78003

  15. PUBLICATION OF ADMINISTRATIVE CIRCULAR

    CERN Multimedia

    HR Department

    2008-01-01

    ADMINISTRATIVE CIRCULAR NO. 23 (REV. 2) – SPECIAL WORKING HOURS Administrative Circular No. 23 (Rev. 2) entitled "Special working hours", approved following discussion in the Standing Concertation Committee meeting of 9 December 2008, will be available on the intranet site of the Human Resources Department as from 19 December 2008: http://cern.ch/hr-docs/admincirc/admincirc.asp It cancels and replaces Administrative Circular No. 23 (Rev. 1) entitled "Stand-by duty" of April 1988. A "Frequently Asked Questions" information document on special working hours will also be available on this site. Paper copies of this circular will shortly be available in departmental secretariats. Human Resources Department Tel. 78003

  16. The New Epidemiology--A Challenge to Health Administration. Issues in Epidemiology for Administration.

    Science.gov (United States)

    Crichton, Anne, Ed.; Neuhauser, Duncan, Ed.

    The role of epidemiology in health administration is considered in 11 articles, and three course descriptions and a bibliography are provided. Titles and authors include the following: "The Need for Creative Managerial Epidemiology" (Gary L. Filerman); "The Growing Role of Epidemiology in Health Administration" (Maureen M.…

  17. Virtual Reality and Public Administration

    Directory of Open Access Journals (Sweden)

    István TÓZSA

    2013-02-01

    Full Text Available This study serves as an introduction to how virtual reality systems could be applied in public administration and what research tasks would be necessary to accomplish a project. E-government solutions began to emerge in public administration approximately a decade ago all over the developed world. Administration service facilities via the Internet did not attract many customers, because of the digital divide. E-government solutions were extended to mobile devices as well, but the expected breakthrough of usage has not ensued. The virtual reality form of public administration services recommended in this study has the most attractive outlay and the simplest navigation tools if compared to ‘traditional’ Internet based e-government. Thus, in accordance with the worldwide amazingly quick spread of the virtual reality systems of Second Life and 3 D types of entertainment, virtual reality applications in public administration could rely on a wide range of acceptance as well.

  18. 22 CFR 128.2 - Administrative Law Judge.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administrative Law Judge. 128.2 Section 128.2... § 128.2 Administrative Law Judge. The Administrative Law Judge referred to in this part is an Administrative Law Judge appointed by the Department of State. The Administrative Law Judge is authorized to...

  19. 76 FR 77302 - Federal Transit Administration

    Science.gov (United States)

    2011-12-12

    ... DEPARTMENT OF TRANSPORTATION Federal Transit Administration FY 2011 Discretionary Sustainability... Administration (FTA), DOT. ACTION: FTA Sustainability Program Funds: Announcement of Project Selections. SUMMARY: The U.S. Department of Transportation's (DOT) Federal Transit Administration (FTA) announces the...

  20. 76 FR 78966 - Federal Aviation Administration

    Science.gov (United States)

    2011-12-20

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Approval of Noise Compatibility Program for Kona International Airport at Keahole, Keahole, North Kona, HI AGENCY: Federal Aviation Administration, DOT. ACTION: Notice. SUMMARY: The Federal Aviation Administration (FAA) announces its findings on...

  1. 75 FR 6433 - Federal Aviation Administration

    Science.gov (United States)

    2010-02-09

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Notice of Availability of a Draft... 9, West Chicago, IL AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... Surveillance Radar, Model 9, West Chicago, Illinois. SUMMARY: The Federal Aviation Administration (FAA...

  2. 75 FR 12809 - Federal Aviation Administration

    Science.gov (United States)

    2010-03-17

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Notice of Intent To Rule on Request...: Federal Aviation Administration (FAA), DOT. ACTION: Notice of Request to Release Airport Property. SUMMARY... Nicely, Manager, Federal Aviation Administration, Southwest Region, Airports Division, Texas Airports...

  3. 75 FR 18014 - Federal Highway Administration

    Science.gov (United States)

    2010-04-08

    ... DEPARTMENT OF TRANSPORTATION Federal Highway Administration AGENCY: Federal Highway Administration (FHWA), DOT. ACTION: Notice of Availability regarding a Finding of No Significant Impact (FONSI): U.S.... FOR FURTHER INFORMATION CONTACT: Federal Highway Administration, Kentucky Division: Mr. Greg Rawlings...

  4. 78 FR 25524 - Federal Aviation Administration

    Science.gov (United States)

    2013-05-01

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Notice of Request To Release Airport Property AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of Intent to Rule on Request to... address: Lynn D. Martin, Airports Compliance Specialist, Federal Aviation Administration, Airports...

  5. 77 FR 64837 - Federal Aviation Administration

    Science.gov (United States)

    2012-10-23

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Fourth Meeting: RTCA Special Committee 227, Standards of Navigation Performance AGENCY: Federal Aviation Administration (FAA), U.S... Operations Group, Federal Aviation Administration. [FR Doc. 2012-26034 Filed 10-22-12; 8:45 am] BILLING CODE...

  6. 78 FR 41183 - Federal Aviation Administration

    Science.gov (United States)

    2013-07-09

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Meeting: RTCA Program Management Committee AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION... Operations Group, Federal Aviation Administration. [FR Doc. 2013-16464 Filed 7-8-13; 8:45 am] BILLING CODE...

  7. 78 FR 13395 - Federal Aviation Administration

    Science.gov (United States)

    2013-02-27

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Notice of Availability of Draft...: Federal Aviation Administration (FAA), DOT. ACTION: Notice of availability and request for comments... 4. U.S. Mail: Leslie Grey--AAL-614, Federal Aviation Administration, Airports Division, 222 West 7th...

  8. College & University Business Administration. Third Edition.

    Science.gov (United States)

    National Association of College and University Business Officers, Washington, DC.

    This text presents indepth coverage of five areas of college and university business administration, including administrative management, business management, fiscal management, and financial accounting and reporting. The section on administrative management encompasses institutional planning, management information systems and data processing,…

  9. Information in the system of state administration

    OpenAIRE

    Kalytych, G.; Litosh, G.

    2009-01-01

    The article analyses the approaches to the notions of "information", "state administration system", "administrative information". The article considers the importance of of information for the whole state administration system and reveals the criteria which provide the information with administrative status. Special attention is paid to making of administrative decisions on the level of the sate which are based on effective information management.

  10. Financial and Managerial Accounting for School Administrators: Superintendents, School Business Administrators, and Principals.

    Science.gov (United States)

    Everett, R. E.; And Others

    This book updates the classic text "Public School Fund Accounting Principles and Procedures" (Tidwell 1960). The book is designed to be used primarily as a textbook at the graduate level with students training to be school administrators, school business administrators, or principals. A list of topics covered include an overview of school…

  11. How Creativity Came to Reside in the Land of the Gifted (And How to Move It into a New Neighborhood)

    Science.gov (United States)

    Flint, Lori J.

    2014-01-01

    Author Lori Flint, has a PhD in educational psychology/ gifted and creative education and is a board member for the North Carolina Association for the Gifted and Talented. She advocates for students of all ages and abilities, especially the underdogs. She begins this article with a discussion of the origins of creativity in the world of education…

  12. Not Too Big to Fail: How Teacher Education Killed the Foundations

    Science.gov (United States)

    Gabbard, David; Flint, Lori J.

    2013-01-01

    Nearly forty years ago, Jonathan Kozol wrote on the perennial question posed by children: "Why do I have to go to school?" Rightfully, in David Gabbard and Lori Flint's view, he admonishes those who would "act as though it were a foolish question." The authors of this article take issue, however, with his characterization…

  13. Materiel Solutions for Special Operations Forces

    Science.gov (United States)

    2015-03-28

    contract following the initial discussions and conceptualization efforts conducted under this grant. SME SUPPORT: • Dr. Lori Foster Thompson... reactors , and the design of stable nanostructured alloys for extreme temperatures and loading conditions. He has also worked extensively on carbon...modeling capabilities to identify technology trends and patterns relevant to USSOCOM mission requirements. • Business Modeling for Data Fusion

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    Six sigma (11) 72 (CR). Slender loris (1) 64 (FA). Slip velocity (5) 61 (GA). Social organisation (1) 64 (FA). ~oil fertility (6) 6 (GA). Soil science (1) 26 (GA). Solar atmosphere (12) 14 (GA). Solar neutrino detection puzzle (3) 8 (GA). Solar parallax (3) 65 (CR). Solid dispersion (12) 25 (GA). Special relativity. (7) 77, (11) 56 (CR).

  15. Linux System Administration

    CERN Document Server

    Adelstein, Tom

    2007-01-01

    If you're an experienced system administrator looking to acquire Linux skills, or a seasoned Linux user facing a new challenge, Linux System Administration offers practical knowledge for managing a complete range of Linux systems and servers. The book summarizes the steps you need to build everything from standalone SOHO hubs, web servers, and LAN servers to load-balanced clusters and servers consolidated through virtualization. Along the way, you'll learn about all of the tools you need to set up and maintain these working environments. Linux is now a standard corporate platform with user

  16. Violence Against Health Care Workers: A Silent Problem

    Directory of Open Access Journals (Sweden)

    Vahideh Ghorbani sani

    2015-08-01

    Full Text Available Background and objectives: Considering the importance of process improvement and support system,we tried to take a step to clarify logistics processes and initiate quality improvement in health and nutrition faculty of Tabriz Medical Science University using process mapping and decision making matrix. Material and Methods: This study is qualitative and was done in 2012. The data were gathered by interview with those involving in the process and direct observation. In this study we clarified logistics processes of financial and administration deputy using block diagram and detailed flowchart. After clarifying the process, research team analyzed the data and proposed an improved way for process as a suggestive detailed flowchart. At the next stage we compared the processes in decision making matrix and finally the best option for intervention was chose between 10 worst functioned processes in decision making matrix of prioritization. Results: In this study we documented 35 processes using process mapping in general affairs, personnel affairs, secretariat, archive deputy, storage department, accounting, properties, services, supply and financial department. The accounting documenting process had the worst function according to comparison matrix and the purchase and supply process was selected as the best option of intervention. Conclusion: The research's results showed that most of the processes in this deputy have problems in theory and practice, and system improvement is in need of reforming which will improve quality and prevent organization sources to be wasted. Due to the multi department function of processes, the unity of departments and a qualified management is required for better reform.

  17. THE NEW PUBLIC ADMINISTRATION PARADIGM DIRECTIONS

    OpenAIRE

    CHERVYAKOVA OLHA VOLODYMYRIVNA

    2017-01-01

    This article presents aspects of public administration paradigm of using disciplinary matrix, a public management model based on a feedback mechanism in the subject-subject interaction, which is the basis of theoretical and methodological establishment in public administration science (Public administration) in Ukraine.

  18. 78 FR 69133 - Drug Enforcement Administration

    Science.gov (United States)

    2013-11-18

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances..., California 94085, made application by renewal to the Drug Enforcement Administration (DEA) to be registered... Diversion Control, Drug Enforcement Administration. [FR Doc. 2013-27486 Filed 11-15-13; 8:45 am] BILLING...

  19. Accounts Payable Administrator | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Job Summary An Accounts Payable Administrator is responsible for the processing of supplier invoices and grant payment requests (from the Grant Administration Division and regional offices for institutional recipients, participants, scholars, fellows and other awardees). Each Administrator looks after internal cost centers, ...

  20. ORDER SECURITY – NATIONAL SECURITY ADMINISTRATION. NATIONAL SECURITY DEFENSE AS SPECIAL ADMINISTRATION

    OpenAIRE

    Zoltán BALLA

    2009-01-01

    National security administration is the special executivedisposal activity of the national security agencies, the section of the state administration that helps the governmental work by reconnoitering and preventing with secret-servicing methods of the risks that shall harm or endanger the national security’s interests. The main operational principles of national security governing are the followings among others: - controlling the operation of national security organization belongs to the ex...

  1. Fundamentals of the administrative decentralization process

    Directory of Open Access Journals (Sweden)

    Mihaela Lupăncescu

    2017-12-01

    Full Text Available Public administration, as an activity carried out by the administrative authorities, can be achieved through several forms of organization. In this sense, centralization, deconcentration and decentralization, together with its corollary, local autonomy, constitute in organizational regimes of an administrative nature, more or less democratic, and with characteristics that vary according to the degree of dependence between the authorities of the public administration institutions at the central level and local public administration authorities.There is no single form of organization that incorporates the characteristics of a particular regime. The complex expectations of modern society have led to the blending of features of different forms of organization in order to create a balance of activity within the public administration, in order to exercise the functions of executive power for the benefit of citizens, not by conferring unlimited autonomy but by considering the fundamental principle of legality.

  2. Metronidazole distribution following intraarterial administration

    International Nuclear Information System (INIS)

    Konoplyannikov, A.G.; Grigor'ev, A.N.; Zubov, O.G.

    1984-01-01

    An attempt to achieve a high local concentration of metronidazole in tissues at intraarterial administration in experiments with dogs is made. Intraarterial administration makes it possible to ''saturate'' with a radiosensitizer first of all tissues fed by an artery in question. Administration of the drug to a vessel feeding the tumor would, probably, result in a sharp increase in its concentration in the malignant neoplasm as compared with the rest organs and tissues, which should amplify the radiosensitizing effect

  3. Directions in the theory of public administration

    OpenAIRE

    N. Arabadzhiyski

    2014-01-01

    The aim of this development is to provide a brief summary of the main trends in the theory of public administration: the traditional public administration, new public administration (public management and new public management); postmodern global public management and public administration.

  4. 22 CFR 226.47 - Contract administration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Contract administration. 226.47 Section 226.47 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADMINISTRATION OF ASSISTANCE AWARDS TO U.S. NON-GOVERNMENTAL ORGANIZATIONS Post-award Requirements Procurement Standards § 226.47 Contract administration. A...

  5. Administrative Management in NIE. A Report.

    Science.gov (United States)

    Kirk, Irwin

    The purpose of this report is to recommend certain administrative management policies and procedures for the National Institute of Education (NIE). Administrative management activities for NIE are personnel, budget, finance, general services, contracts and grants, and overall administrative management. Management information is included in this…

  6. 48 CFR 3028.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Administration. 3028.106 Section 3028.106 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY... 3028.106 Administration. ...

  7. Administrative bias in South Africa

    Directory of Open Access Journals (Sweden)

    E S Nwauche

    2005-01-01

    Full Text Available This article reviews the interpretation of section 6(2(aii of the Promotion of Administrative Justice Act which makes an administrator “biased or reasonably suspected of bias” a ground of judicial review. In this regard, the paper reviews the determination of administrative bias in South Africa especially highlighting the concept of institutional bias. The paper notes that inspite of the formulation of the bias ground of review the test for administrative bias is the reasonable apprehension test laid down in the case of President of South Africa v South African Rugby Football Union(2 which on close examination is not the same thing. Accordingly the paper urges an alternative interpretation that is based on the reasonable suspicion test enunciated in BTR Industries South Africa (Pty Ltd v Metal and Allied Workers Union and R v Roberts. Within this context, the paper constructs a model for interpreting the bias ground of review that combines the reasonable suspicion test as interpreted in BTR Industries and R v Roberts, the possibility of the waiver of administrative bias, the curative mechanism of administrative appeal as well as some level of judicial review exemplified by the jurisprudence of article 6(1 of the European Convention of Human Rights, especially in the light of the contemplation of the South African Magistrate Court as a jurisdictional route of judicial review.

  8. Fit-For-Purpose Land Administration

    DEFF Research Database (Denmark)

    Enemark, Stig; McLaren, Robin

    2017-01-01

    This paper looks at implementing Fit-For-Purpose land administration solutions at county level. This will require a country specific strategy drawing from the recent GLTN publication on “Fit-For-Purpose Land Administration – Guiding Principles for Country Implementation”. The Fit...... administration; 4) Designing the country specific FFP spatial / legal / institutional frameworks; 5) Capacity development; 6) Country specific instruction manuals; and 7) Economic benefits analysis. Finally, the paper presents some experiences and reflections from a case study on implementing the FFP approach...

  9. Occupational Safety and Health Administration

    Science.gov (United States)

    ... Twitter Instagram RSS Subscribe Occupational Safety and Health Administration English | Spanish MENU OSHA English | Spanish Search A ... STATES DEPARTMENT OF LABOR Occupational Safety and Health Administration 200 Constitution Ave., NW, Washington, DC 20210 800- ...

  10. Land administration in Ecuador; Current situation and opportunities with adoption of fit-for-purpose land administration approach

    NARCIS (Netherlands)

    Todorovski, D.; Salazar, Rodolfo; Jacome, Ginella; Bermeo, Antonio; Orellana, Esteban; Zambrano, Fatima; Teran, Andrea; Mejia, Raul

    2018-01-01

    The aim of this paper is to explore current land administration situation in Ecuador and identify opportunities for fit-for-purpose (FFP) land administration approach that could improve the land administration functions for the country and its citizens. In this paper, initially literature about land

  11. Graham nominated to Head OSTP

    Science.gov (United States)

    President Ronald Reagan has nominated William R. Graham as science advisor and director of the Office of Science and Technology (OSTP). Graham, who is currently deputy director of the National Aeronautics and Space Administration (NASA), had been acting director of the agency until the nomination of James C. Fletcher.Graham's nomination, which must be confirmed by the U.S. Senate, comes 6 months after the resignation of George A. Keyworth from the post. John P. McTague had been acting science advisor since Keyworth's resignation (Eos, December 10, 1985, p. 1219).

  12. Participants at the 4th Controlling Conference of International Public Organisations

    CERN Multimedia

    Jean-Claude Gadmer

    2010-01-01

    The 4th Controlling Conference of International Public Organisations is part of a cycle of yearly conferences which were held the previous years in Frankfurt, Munich, Luxemburg, and which will take place this year on 31 May and 1 June at CERN. The aim of these conferences is to offer a forum for Directors of Administration, Deputy CFOs, Secretary-Generals, Heads of Budget of International Organisations, to exchange experiences on selected themes related to performance management. This year’s theme is “The Reduction of Overheads in International Public Organisations”.

  13. Memoranda by A.P. Uspensky to the Council of Ministers of the Provisional Siberian government

    Directory of Open Access Journals (Sweden)

    Sukhanov Aleksandr

    2015-06-01

    Full Text Available This publication offers a previously unknown memoranda by representative of the diocesan assembly of deputies of the clergy and laity of the Tomsk diocese A. P. Uspensky, addressed to the Council of Ministers of the Provisional Siberian government in July 1918. A.P. Uspensky solicited for formation of the Ministry of confessions in the Provisional Siberian government. Memoranda are initiative documents to the Statute on the Chief Administration of religious denominations adopted by the Council of Ministers of the Russian government on December 27, 1918.

  14. THE DECISIONAL TRANSPARENCY IN PUBLIC ADMINISTRATION

    Directory of Open Access Journals (Sweden)

    OCTAVIA MARIA CILIBIU

    2011-04-01

    Full Text Available The principle of decisional transparency is one of the principles of good administration, fundamental principles of public administration and it is enshrined in the law of many European Union member states, including our country. In their work the public authorities must show transparency reflected by the active involvement of citizens in administrative decision as its primary beneficiary. The citizen information, consultation and his stimulation to participate actively in the elaboration of draft normative acts for their preparation and before that by bringing them to public knowledge, are tasks of the public authorities which exceed the limit of the obligations imposed by internal rules and are significant efforts to modernize the public administration and rallying to the administrative structures.

  15. 42 CFR 417.124 - Administration and management.

    Science.gov (United States)

    2010-10-01

    ... program, administrative and management aspects of the HMO. (3) At a minimum, management by an executive... Administration and management. (a) General requirements. Each HMO must have administrative and managerial... 42 Public Health 3 2010-10-01 2010-10-01 false Administration and management. 417.124 Section 417...

  16. 48 CFR 2828.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Administration. 2828.106 Section 2828.106 Federal Acquisition Regulations System DEPARTMENT OF JUSTICE General Contracting Requirements BONDS AND INSURANCE Bonds 2828.106 Administration. ...

  17. Practical JIRA Administration

    CERN Document Server

    Doar, Matthew

    2011-01-01

    If you're familiar with JIRA for issue tracking, bug tracking, and other uses, you know it can sometimes be tricky to set up and manage. In this concise book, software toolsmith Matt Doar clarifies some of the more confusing aspects by answering difficult and frequently asked questions about JIRA administration. Practical JIRA Administration shows you how JIRA is intended to be used, making it an ideal supplement to the extensive documentation already available. The book's chapters are loosely connected, so you can go straight to the information that best serves your needs. Understand the di

  18. 77 FR 20826 - Guidance for Industry and Food and Drug Administration Staff; Food and Drug Administration and...

    Science.gov (United States)

    2012-04-06

    ...] Guidance for Industry and Food and Drug Administration Staff; Food and Drug Administration and Industry... Administration (FDA) is announcing the availability of the guidance entitled ``Guidance for Industry and Food and... written requests for single copies of the guidance document entitled ``Guidance for Industry and Food and...

  19. Training School Administrators in Computer Use.

    Science.gov (United States)

    Spuck, Dennis W.; Bozeman, William C.

    1988-01-01

    Presents results of a survey of faculty members in doctoral-level educational administration programs that examined the use of computers in administrative training programs. The present status and future directions of technological training of school administrators are discussed, and a sample curriculum for a course in technology and computing is…

  20. Program on Administration in Higher Education.

    Science.gov (United States)

    Karadima, Oscar

    The importance of developing a university level program on administration in higher education in Latin America is discussed. The objective of such a program would provide training to faculty and higher level education and administrative staff in matters related to administration. The program would offer the necessary guidelines in dealing with…

  1. Measurement issues associated with using survey data matched with administrative data from the Social Security Administration.

    Science.gov (United States)

    Davies, Paul S; Fisher, T Lynn

    2009-01-01

    Researchers using survey data matched with administrative data benefit from the rich demographic and economic detail available from survey data combined with detailed programmatic data from administrative records. The research benefits of using these matched data are too numerous to mention. But there are drawbacks as well, and those drawbacks have received less systematic attention from researchers. We focus on survey data matched with administrative data from the Social Security Administration and address the strengths and weaknesses of each in four specific areas: (1) program participation and benefits, (2) disability and health information, (3) earnings, and (4) deferred compensation. We discuss the implications of these strengths and weaknesses for decisions that researchers must make regarding the appropriate data source and definition for the concepts in question. From this discussion, some general conclusions are drawn about measurement issues associated with using matched survey and administrative data for research, policy evaluation, and statistics.

  2. PostgreSQL administration essentials

    CERN Document Server

    Schönig, Hans-Jürgen

    2014-01-01

    If you are a database administrator who needs to get to grips with PostgreSQL quickly and efficiently, then this book is for you. This book will also be highly beneficial if you are a project leader or a developer who is interested in knowing more about database systems or bottleneck detection, as it will enable you to work more closely and cooperatively with your administrators.

  3. 48 CFR 1028.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 1028.106 Section 1028.106 Federal Acquisition Regulations System DEPARTMENT OF THE TREASURY GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds 1028.106 Administration. ...

  4. 49 CFR 386.54 - Administrative Law Judge.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Administrative Law Judge. 386.54 Section 386.54... General Rules and Hearings § 386.54 Administrative Law Judge. (a) Powers of an Administrative Law Judge. The Administrative Law Judge may take any action and may prescribe all necessary rules and regulations...

  5. Nature and scope of public administration

    Directory of Open Access Journals (Sweden)

    Uchem, R.O.

    2013-03-01

    Full Text Available The success and survival of any organizations be they government or not is contingent upon group efforts and cooperation to achieve set goals. This paper discusses the nature and scope of public administration to say that in modern day societies, any administration in the public interest transcends beyond government circles and finds expression in other spheres of human endeavors including the church, mosques, postal services as well as international relations and diplomacy, respectively. The paper discusses the concepts of administration and public administration thereby creating a distinction between the two concepts. Furthermore, the understanding of the scope of administration through the various schools of thought have also been captured, the essence of which is to generate a clearer understanding of the discourse under review. The paper ends with conclusions.

  6. Transcultural perspectives in nursing administration.

    Science.gov (United States)

    Andrews, M M

    1998-11-01

    Population demographics are reshaping the healthcare work force with respect to race, ethnicity, gender, national origin, sexual orientation, age, handicap, disability, and related factors as national sensitivity to various forms of diversity grows. Given the demographic trends, it is inevitable that nurse administrators will need skill in transcultural administration as they manage diversity and identify the cultural origins of conflict in the multicultural workplace. Culture influences the manner in which administrators, staff and patients perceive, identify, define and solve problems. In this article, the complex and interrelated factors that influence workplace diversity are examined.

  7. Environmental recordkeeping: The administrative record

    International Nuclear Information System (INIS)

    Sprouse, B.S.

    1991-08-01

    This document provides information on an environmental records management system. It includes information on environmental recordkeeping; environmental regulations with emphasis on the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA); and the administrative record including a case study of the Hanford Site's administrative record system. This paper will focus on the following objectives: (1) Identify resources that can be used as reference tools; (2) understand the reasons for developing and maintaining an administrative record; and, (3) evaluate an existing system and identify means of complying with the regulations. 15 refs., 2 figs

  8. Performance Analysis of the Romanian Administration

    Directory of Open Access Journals (Sweden)

    Marius Constantin PROFIROIU

    2013-10-01

    Full Text Available The performance of public administration is one of the top priorities of the national governments worldwide, not only for Romania. The role of a performing management system at the level of public administration is to ensure a high quality and efficiency of the adopted policies and strategies, of the provided public services and of the administrative act itself, and to guarantee the advantage of a competitive and efficient administration both in relation to its own citizens, and in competition with other cities and countries throughout Europe and all around the world. Following these considerations, and based upon an empirical research conducted with the aid of a survey regarding ‘The analysis of the performance level of the Romanian public administration’ the article aims to (1 identify modern management tools that determine and influence the performance of Romanian public institutions, (2 analyze the effects of using project management as organizational capacity development instruments by public administration in Romania, and (3 determine the influence and effects of the external factors on the performance and development of Romanian public administration.

  9. 48 CFR 228.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 228.106 Section 228.106 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds 228.106 Administration. ...

  10. 48 CFR 1228.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 1228.106 Section 1228.106 Federal Acquisition Regulations System DEPARTMENT OF TRANSPORTATION GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 1228.106 Administration. ...

  11. 48 CFR 828.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 828.106 Section 828.106 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 828.106 Administration. ...

  12. 48 CFR 428.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Administration. 428.106 Section 428.106 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 428.106 Administration. ...

  13. 48 CFR 1328.106 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Administration. 1328.106 Section 1328.106 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds and Other Financial Protections 1328.106 Administration. ...

  14. Administrative Aspects of Human Experimentation.

    Science.gov (United States)

    Irvine, George W.

    1992-01-01

    The following administrative aspects of scientific experimentation with human subjects are discussed: the definition of human experimentation; the distinction between experimentation and treatment; investigator responsibility; documentation; the elements and principles of informed consent; and the administrator's role in establishing and…

  15. 9 February 2012 - Permanent Representative of the Kingdom of Spain to the United Nations Office at Geneva and other International Organisations, Ambassador A. Santos Maraver signing the guest book with CERN Director-General; in the CERN Control Centre with N. Catalan; visiting the LHC tunnel at Point 5 and CMS underground experimental area with Collaboration Spokesperson J. Incandela; throughout accompanied by Adviser J. Salicio Diez and Former Physics Deputy Department Head L. Alvarez Gaumé.

    CERN Multimedia

    Visual Media Office

    2012-01-01

    9 February 2012 - Permanent Representative of the Kingdom of Spain to the United Nations Office at Geneva and other International Organisations, Ambassador A. Santos Maraver signing the guest book with CERN Director-General; in the CERN Control Centre with N. Catalan; visiting the LHC tunnel at Point 5 and CMS underground experimental area with Collaboration Spokesperson J. Incandela; throughout accompanied by Adviser J. Salicio Diez and Former Physics Deputy Department Head L. Alvarez Gaumé.

  16. 7. Administrative structures.

    Science.gov (United States)

    2014-05-01

    The basic systems of any society rarely can operate independently. Instead, they are dependent and often interdependent upon other entities. Such entities control the resources within their respective systems. Thus, coordination and control agencies require contracts or memoranda of understanding with these entities in order to assure access to the resources required during a crisis. These administrative structures include: (1) governmental institutions and agencies, including the military; (2) intergovernmental organisations; (3) nongovernmental organisations; (4) commercial private sector organisations; and (5) academic institutions. These dependencies create potential barriers to the provision of coordination and control including: (1) the complexity of the administrative structures with which coordination and control must interact; (2) the location of resources; (3) finding responsible person(s); (4) the competence and compatibility; (5) methods of access; (6) payment; (7) contracts and memoranda of understanding; (8) inventories of accessible resources; (9) competition for the mandate, power, and resources; and (10) jealousy. The need for potential interactions between administrative structures requires that agreements for the sharing of resources during crises be reached as part of planning and preparedness. Gaining an understanding of these relationships is an important area for research.

  17. 7 CFR 1435.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1435.4 Section 1435.4 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS SUGAR PROGRAM General Provisions § 1435.4 Administration...

  18. 7 CFR 82.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administration. 82.2 Section 82.2 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... PROGRAMS CLINGSTONE PEACH DIVERSION PROGRAM § 82.2 Administration. The program will be administered under...

  19. 7 CFR 1403.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1403.2 Section 1403.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES DEBT SETTLEMENT POLICIES AND PROCEDURES § 1403.2 Administration...

  20. 7 CFR 1425.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1425.2 Section 1425.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COOPERATIVE MARKETING ASSOCIATIONS § 1425.2 Administration...

  1. 7 CFR 1416.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1416.3 Section 1416.3 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... General Provisions for 2006 Emergency Agricultural Disaster Assistance Programs § 1416.3 Administration...

  2. 7 CFR 1410.1 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1410.1 Section 1410.1 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS CONSERVATION RESERVE PROGRAM § 1410.1 Administration. (a...

  3. 7 CFR 1470.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1470.2 Section 1470.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF....2 Administration. (a) The regulations in this part will be administered under the general...

  4. 7 CFR 1580.501 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1580.501 Section 1580.501 Agriculture Regulations of the Department of Agriculture (Continued) FOREIGN AGRICULTURAL SERVICE, DEPARTMENT OF AGRICULTURE TRADE ADJUSTMENT ASSISTANCE FOR FARMERS § 1580.501 Administration. (a) The application process...

  5. Public Administration and the Crisis of the State. ESA844, Administrative Context of Schooling.

    Science.gov (United States)

    Bates, Richard

    This volume is part of a series of monographs from Australia devoted to outlining an alternative approach, based on neo-Marxist concepts, to educational administration. Beginning with a discussion of the contested relationship between the individual and the state, the politics of administration is set within the debate over liberalism, Marxism and…

  6. River basin administration

    Science.gov (United States)

    Management of international rivers and their basins is the focus of the Centre for Comparative Studies on (International) River Basin Administration, recently established at Delft University of Technology in the Netherlands. Water pollution, sludge, and conflicting interests in the use of water in upstream and downstream parts of a river basin will be addressed by studying groundwater and consumption of water in the whole catchment area of a river.Important aspects of river management are administrative and policy aspects. The Centre will focus on policy, law, planning, and organization, including transboundary cooperation, posing standards, integrated environmental planning on regional scale and environmental impact assessments.

  7. Ethics in Public Administration

    Directory of Open Access Journals (Sweden)

    MSc. Arjeta Hallunovi

    2014-06-01

    Full Text Available The goal of this study is to deal with some ethical causes in the public administration, that aim the avoidance of negative phenomenon’s as theft, corruption, etc. In this direction, the debates about ethics are becoming more and more a global tendency, as an implement through which would be found the way to get out of the crisis. The success in the reforms of the public administrations in major part depends, on the public functionaries and their willingness to make fundamental changes in the way they work. In this direction, the State should strengthen and modernize the public service, should realize an employment system, which should reflect more the merits on its service. For this reason, the government’s attempts should be concentrated on the construction of a positive image for the state and its administration as professional objective, which is oriented to the services. Being aware for the practical restrictions of this study, we firstly chose to concentrate on the local public administrations ethics. The study will be focused on the practical comparative analysis of the city of Shkodra and Durres by the realization of a questionnaire by each of these municipalities and the Agency of Legalization and Urbanization of Informal Zones (ALUIZNI in Shkodra.

  8. TAX ADMINISTRATION: SOME ISSUES AND TRENDS

    Directory of Open Access Journals (Sweden)

    MOGOIU CARMEN MIHAELA

    2018-02-01

    Full Text Available This paper presents a series of practices of tax administrations in different countries of the world, focusing on their functions, mission and responsibilities. Analyzing the main features of tax administrations across the globe, from emerging to top-level, allows self-assessments of their organizations' strengths and weaknesses to describe the current level and identify the steps needed to move to a new level of maturity but I believe that the applicability of best practice should be made after a rigorous analysis of the expected impact and there must be taken into account the differences in national institutional systems, customs, technological progress and the natural resources. A modern and performing tax administration must pay particular attention to the practice of self-evaluation and voluntary compliance, cost reduction and burden diminuation for taxpayers to provide the goods and services needed to increase the standard of living of citizens and ensure economic prosperity. The tax administration plays an important role in developing and modifying fiscal policies by working with other state institutions to monitor the positive or negative impact of fiscal policy and legislation on tax administration, recommending the necessary changes. Studying the best practices of tax administrations around the world can lead to the achievement and maintenance of a high degree of self-assessment and voluntary compliance of taxpayers' tax obligations - the primary objective of any tax administration.

  9. 29 CFR 457.17 - Administrative Law Judge.

    Science.gov (United States)

    2010-07-01

    ... Administrative Law Judge to conduct a hearing in cases under 5 U.S.C. 7120 or 22 U.S.C. 4117 as implemented by... 29 Labor 2 2010-07-01 2010-07-01 false Administrative Law Judge. 457.17 Section 457.17 Labor... GENERAL Meaning of Terms as Used in This Chapter § 457.17 Administrative Law Judge. Administrative Law...

  10. Pharmacokinetics of Alternative Administration Routes of Melatonin

    DEFF Research Database (Denmark)

    Zetner, D.; Andersen, L. P.H.; Rosenberg, J.

    2016-01-01

    Background: Melatonin is traditionally administered orally but has a poor and variable bioavailability. This study aims to present an overview of studies investigating the pharmacokinetics of alternative administration routes of melatonin. Methods: A systematic literature search was performed...... and included experimental or clinical studies, investigating pharmacokinetics of alternative administration routes of melatonin in vivo. Alternative administration routes were defined as all administration routes except oral and intravenous. Results: 10 studies were included in the review. Intranasal....... Subcutaneous injection of melatonin displayed a rapid absorption rate compared to oral administration. Conclusion: Intranasal administration of melatonin has a large potential, and more research in humans is warranted. Transdermal application of melatonin has a possible use in a local application, due to slow...

  11. Detection of polymorphism in booroola gene and growth ...

    African Journals Online (AJOL)

    [12] and Davis et al [17], forced PCR–RFLP DNA test was used to detect the mutations of FecB and GDF9 in Lori breed sheep. The primer sequences used for the FecB AvaII site and. GDF9 HhaI site are presented in Table 1. Polymerase chain reactions were performed in a. 25 μL reaction mixture containing approximately.

  12. Neo-Taylorism in Educational Administration?

    Science.gov (United States)

    Gronn, Peter C.

    1982-01-01

    Reviews eight recent observational studies of school administrators and criticizes the studies' use of "time and motion" assumptions drawn from Frederick Winslow Taylor's ideas. Outlines an alternate approach based on "thick" description of administrators' work, including their talk, as exemplified in James Boswell's biography…

  13. 7 CFR 1400.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1400.2 Section 1400.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS General Provisions § 1400.2 Administration. (a) The regulations in...

  14. 7 CFR 1412.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1412.2 Section 1412.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... REVENUE ELECTION PROGRAM FOR THE 2008 AND SUBSEQUENT CROP YEARS General Provisions § 1412.2 Administration...

  15. 33 CFR 174.103 - Administration.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Administration. 174.103 Section 174.103 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED....103 Administration. The State casualty reporting system must be administered by a State agency that...

  16. 7 CFR 1466.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1466.2 Section 1466.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... § 1466.2 Administration. (a) The funds, facilities, and authorities of the Commodity Credit Corporation...

  17. 7 CFR 625.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Administration. 625.3 Section 625.3 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF AGRICULTURE WATER RESOURCES HEALTHY FORESTS RESERVE PROGRAM § 625.3 Administration. (a) The regulations in...

  18. 7 CFR 1424.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1424.2 Section 1424.2 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS BIOENERGY PROGRAM § 1424.2 Administration. This part shall...

  19. 7 CFR 782.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Administration. 782.3 Section 782.3 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS END-USE CERTIFICATE PROGRAM General § 782.3 Administration. The end-use certificate...

  20. 7 CFR 783.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Administration. 783.2 Section 783.2 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS TREE ASSISTANCE PROGRAM § 783.2 Administration. (a) The program will be administered...

Some links on this page may take you to non-federal websites. Their policies may differ from this site.