Fan, Zhaoyang; Hodnett, Philip A; Davarpanah, Amir H; Scanlon, Timothy G; Sheehan, John J; Varga, John; Carr, James C; Li, Debiao
2011-08-01
: To develop a flow-sensitive dephasing (FSD) preparative scheme to facilitate multidirectional flow-signal suppression in 3-dimensional balanced steady-state free precession imaging and to validate the feasibility of the refined sequence for noncontrast magnetic resonance angiography (NC-MRA) of the hand. : A new FSD preparative scheme was developed that combines 2 conventional FSD modules. Studies using a flow phantom (gadolinium-doped water 15 cm/s) and the hands of 11 healthy volunteers (6 males and 5 females) were performed to compare the proposed FSD scheme with its conventional counterpart with respect to the signal suppression of multidirectional flow. In 9 of the 11 healthy subjects and 2 patients with suspected vasculitis and documented Raynaud phenomenon, respectively, 3-dimensional balanced steady-state free precession imaging coupled with the new FSD scheme was compared with spatial-resolution-matched (0.94 × 0.94 × 0.94 mm) contrast-enhanced magnetic resonance angiography (0.15 mmol/kg gadopentetate dimeglumine) in terms of overall image quality, venous contamination, motion degradation, and arterial conspicuity. : The proposed FSD scheme was able to suppress 2-dimensional flow signal in the flow phantom and hands and yielded significantly higher arterial conspicuity scores than the conventional scheme did on NC-MRA at the regions of common digitals and proper digitals. Compared with contrast-enhanced magnetic resonance angiography, the refined NC-MRA technique yielded comparable overall image quality and motion degradation, significantly less venous contamination, and significantly higher arterial conspicuity score at digital arteries. : The FSD-based NC-MRA technique is improved in the depiction of multidirectional flow by applying a 2-module FSD preparation, which enhances its potential to serve as an alternative magnetic resonance angiography technique for the assessment of hand vascular abnormalities.
International Nuclear Information System (INIS)
Zou Liqiu; Liu Xiaoyi; Liu Xin; Feng Fei; Qi Yulong; Liu Pengcheng
2011-01-01
Objective: To investigate balanced steady-state free precession with flow-sensitive dephasing magnetization preparation (FSD-bSSFP) in the assessment of arteries of foot in diabetic patients. Methods: The lower-extremity peripheral arteries of 43 diabetic patients were evaluated by FSD-bSSFP no contrast MRA and contrast-enhanced MRA (CE-MRA) in. Two experienced observers assessed the image quality, degree of venous contaminated and visibility of pedal artery branches by FSD-bSSFP and CE-MRA respectively in consensus. The signal intensity (SI), signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) of the source images of both groups were measured and Wilcoxon and t tests were performed. Results: The image score of FSD-bSSFP group was 2.7±1.1 and CE-MRA was 2.6±0.8, there was no statistical difference (Z= 0.134, P>0.05). The image score of demonstration of the pedal artery branches and degree of venous contamination on FSD-bSSFP were 3.2±0.9 and 1.8±0.4 respectively which were superior to that of CE-MRA (2.5±0.9 and 2.1±0.8 respectively). Significant statistical difference existed between the two groups in demonstration of pedal artery branches (Z=5.246, P 0.05). But CNR of CE-MRA was superior to that of FSD-bSSFP and significant statistical difference existed between these two methods (t=5.113, P<0.01). Conclusion: FSD-bSSFP without contrast could be used in the evaluation of foot arteries in patients of renal dysfunction and diabetes. (authors)
Zhang, Nan; Fan, Zhaoyang; Luo, Nan; Bi, Xiaoming; Zhao, Yike; An, Jing; Liu, Jiayi; Chen, Zhong; Fan, Zhanming; Li, Debiao
2016-02-01
To evaluate the feasibility and diagnostic performance of flow-sensitive dephasing (FSD)-prepared steady-state free precession (SSFP) MR angiography (MRA) for imaging infragenual arteries at 3.0T, with contrast enhanced MR angiography (CE MRA) as reference. Twenty consecutive patients with suspicion of lower extremity arterial disease undergoing routine CE MRA were recruited. FSD MRA was performed at calf before CE MRA. Image quality and stenosis degree of infragenual arteries from both techniques were independently evaluated and compared. Six patients in this study underwent DSA examination. Three undiagnostic segments were excluded with severe venous contamination in CE MRA. A total of 197 calf arterial segments images were analyzed. No significant difference existed in the relative signal intensity (rSI) of arterial segments between FSD MRA and CE MRA techniques (0.92 ± 0.09 versus 0.93 ± 0.05; P = 0.207). However, the subjective image quality score was slightly higher in FSD MRA (3.66 ± 0.81 versus 3.49 ± 0.87; P = 0.050). With CE MRA images as reference standard, slight overestimation existed in FSD MRA (2.19 ± 1.24 versus 2.09 ± 1.18; P = 0.019), with total agreement of 84.3% on the basis of all arterial segments. The sensitivity, specificity, negative predictive value, and positive predictive value of FSD MRA was 96.4%, 93.0%, 98.5%, and 84.1%. No significant difference in the stenosis degree score was detected between MRA (FSD MRA and CE MRA) and DSA (P > 0.05). FSD MRA performed on at 3.0T without the use of contrast medium provides diagnostic images allowing for arterial stenosis assessment of calf arteries that was highly comparable with CE MRA. Moreover, venous contamination was less problematic with FSD MRA. © 2015 Wiley Periodicals, Inc.
Datta, Anjali; Cheng, Joseph Y; Hargreaves, Brian A; Baron, Corey A; Nishimura, Dwight G
2018-06-01
To mitigate artifacts from through-plane flow at the locations of steady-state stopbands in balanced steady-state free precession (SSFP) using partial dephasing. A 60° range in the phase accrual during a TR was created over the voxel by slightly unbalancing the slice-select dephaser. The spectral profiles of SSFP with partial dephasing for various constant flow rates and during pulsatile flow were simulated to determine if partial dephasing decreases through-plane flow artifacts originating near SSFP dark bands while maintaining on-resonant signal. Simulations were then validated in a flow phantom. Lastly, phase-cycled SSFP cardiac cine images were acquired with and without partial dephasing in six subjects. Partial dephasing decreased the strength and non-linearity of the dependence of the signal at the stopbands on the through-plane flow rate. It thus mitigated hyper-enhancement from out-of-slice signal contributions and transient-related artifacts caused by variable flow both in the phantom and in vivo. In six volunteers, partial dephasing noticeably decreased artifacts in all of the phase-cycled cardiac cine datasets. Partial dephasing can mitigate the flow artifacts seen at the stopbands in balanced SSFP while maintaining the sequence's desired signal. By mitigating hyper-enhancement and transient-related artifacts originating from the stopbands, partial dephasing facilitates robust multiple-acquisition phase-cycled SSFP in the heart. Magn Reson Med 79:2944-2953, 2018. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.
Genomic structure, expression and association study of the porcine FSD2.
Lim, Kyu-Sang; Lee, Kyung-Tai; Lee, Si-Woo; Chai, Han-Ha; Jang, Gulwon; Hong, Ki-Chang; Kim, Tae-Hun
2016-09-01
The fibronectin type III and SPRY domain containing 2 (FSD2) on porcine chromosome 7 is considered a candidate gene for pork quality, since its two domains, which were present in fibronectin and ryanodine receptor. The fibronectin type III and SPRY domains were first identified in fibronectin and ryanodine receptor, respectively, which are candidate genes for meat quality. The aim of this study was to elucidate the genomic structure of FSD2 and functions of single nucleotide polymorphisms (SNPs) within FSD2 that are related to meat quality in pigs. Using a bacterial artificial chromosome clone sequence, we revealed that porcine FSD2 consisted of 13 exons encoding 750 amino acids. In addition, FSD2 was expressed in heart, longissimus dorsi muscle, psoas muscle, and tendon among 23 kinds of porcine tissues tested. A total of ten SNPs, including four missense mutations, were identified in the exonic region of FSD2, and two major haplotypes were obtained based on the SNP genotypes of 633 Berkshire pigs. Both haplotypes were associated significantly with intramuscular fat content (IMF, P meat color, affecting yellowness (P = 0.002). These haplotype effects were further supported by the alteration of putative protein structures with amino acid substitutions. Taken together, our results suggest that FSD2 haplotypes are involved in regulating meat quality including IMF, MP, and meat color in pigs, and may be used as meaningful molecular makers to identify pigs with preferable pork quality.
Fiber-optic sensor demonstrator (FSD) for the monitoring of spacecraft subsystems on ESA's PROBA-2
Kruzelecky, Roman V.; Zou, Jing; Mohammed, Najeeb; Haddad, Emile; Jamroz, Wes; Ricci, Francesco; Lamorie, Joshua; Edwards, Eric; McKenzie, Iain; Vuilleumier, Pierrik
2017-11-01
MPB Communications (MPBC) is developing solutions to the monitoring requirements of spacecraft based on its fiber-laser and Fiber Bragg Grating expertise. This is cumulating in the Fiber Sensor Demonstrator for ESA's Proba-2 that is scheduled for launch in 2007. The advantages of the MPBC approach include a central interrogation system that can be used to control a variety of different fiber-optic sensors including temperature, pressure, actuator status, and propellant leakage. This paper reviews the design and ground qualification of the FSD system in preparation for integration with Proba-2. The FSD will provide monitoring for various Proba-2 subsystems, including a hybrid propulsion system. Some of the challenges associated with using fiber-optics in space are discussed.
Benford's law and the FSD distribution of economic behavioral micro data
Villas-Boas, Sofia B.; Fu, Qiuzi; Judge, George
2017-11-01
In this paper, we focus on the first significant digit (FSD) distribution of European micro income data and use information theoretic-entropy based methods to investigate the degree to which Benford's FSD law is consistent with the nature of these economic behavioral systems. We demonstrate that Benford's law is not an empirical phenomenon that occurs only in important distributions in physical statistics, but that it also arises in self-organizing dynamic economic behavioral systems. The empirical likelihood member of the minimum divergence-entropy family, is used to recover country based income FSD probability density functions and to demonstrate the implications of using a Benford prior reference distribution in economic behavioral system information recovery.
Qubit dephasing due to quasiparticle tunneling
Energy Technology Data Exchange (ETDEWEB)
Zanker, Sebastian; Marthaler, Michael; Schoen, Gerd [Institut fuer Theoretische Festkoerperphysik, Karlsruhe Institute of Technology, D-76128 Karlsruhe (Germany)
2015-07-01
We study dephasing of a superconducting qubit due to quasiparticle tunneling through a Josephson junction. While qubit decay due to tunneling processes is well understood within a golden rule approximation, pure dephasing due to BCS quasiparticles gives rise to a divergent golden rule rate. We calculate qubit dephasing due to quasiparticle tunneling beyond lowest order approximation in coupling between qubit and quasiparticles. Summing up a certain class of diagrams we show that qubit dephasing due to purely longitudinal coupling to quasiparticles leads to dephasing ∝ exp(-x(t)) where x(t) ∝ t{sup 3/2} for short time scales and x(t) ∝ tlog(t) for long time scales.
Full system decontamination (FSD) at NPP Stade prior to dismantling activities
International Nuclear Information System (INIS)
Christoph Stiepani; Karl Seidelmann
2006-01-01
Full text of publication follows: Introduction: Minimization of personnel dose rates and generation of material free for release is of the highest priority and requires Full System Decontamination (FSD) as a first and important measure when decommissioning Nuclear Power Plants. Framatome ANP has many years experience with Full System Decontaminations for operating nuclear power plants in general and for decommissioning in particular. The latest decommissioning project was the FSD at the PWR Stade which was permanently shut down in November 2003 after 31 years of operation. FSD was scheduled within a short period after shutdown and prior to decommissioning activities. Full System Decontamination at Stade: The PWR Stade is a 4 loop design. FSD included the entire primary circuit with RPV and the auxiliary systems (RHR, VCS and RWCU). The decontamination circuit had a total volume of ∼310 m 3 and an overall surface of ∼17000 m 2 . The Framatome ANP decontamination process HP/CORD R UV was selected for application. The decontamination was performed by using NPP systems in combination with the Framatome mobile decontamination equipment AMDA R (Automated Mobile Decontamination Appliance). A total of 4 decontamination cycles were performed and excellent results were obtained. The average decontamination factor (DF) was 160 for the steam generators with an outstanding ambient dose reduction factor (DRF) of 75. Conclusions: FSD at the PWR Stade has shown that the HP/CORD UV process yields excellent results in primary and auxiliary systems. The significant ambient dose reduction factor of 75 is remarkable. This very high DRF, no other decontamination application came even close, will result in excellent cost-benefit ratios for additional decommissioning activities at Stade. The applied HP/CORD UV process is not a specific decontamination process for decommissioning. Therefore the obtained decontamination and dose reduction factors demonstrate the advantage/potential for
Universal dephasing control during quantum computation
International Nuclear Information System (INIS)
Gordon, Goren; Kurizki, Gershon
2007-01-01
Dephasing is a ubiquitous phenomenon that leads to the loss of coherence in quantum systems and the corruption of quantum information. We present a universal dynamical control approach to combat dephasing during all stages of quantum computation, namely, storage and single- and two-qubit operators. We show that (a) tailoring multifrequency gate pulses to the dephasing dynamics can increase fidelity; (b) cross-dephasing, introduced by entanglement, can be eliminated by appropriate control fields; (c) counterintuitively and contrary to previous schemes, one can increase the gate duration, while simultaneously increasing the total gate fidelity
Female sexual dysfunction (FSD): Prevalence and impact on quality of life (QoL).
Nappi, Rossella E; Cucinella, Laura; Martella, Silvia; Rossi, Margherita; Tiranini, Lara; Martini, Ellis
2016-12-01
Female sexual dysfunction (FSD) and quality of life (QOL) are both multidimensional and have a bidirectional relationship across the reproductive life span and beyond. Methodological difficulties exist in estimating the real prevalence of FSD because it is hard to determine the level of distress associated with sexual symptoms in a large-scale survey. Approximately 40-50% of all women report at least one sexual symptom, and some conditions associated with hormonal changes at menopause, such as vulvovaginal atrophy (VVA) and hypoactive sexual desire disorder (HSDD), have a significant impact on sexual function and QOL. Sexual distress peaks at midlife, declines with age and is strongly partner-related. Many postmenopausal women are still sexually active, especially if they are in a stable partnership. Even though sexual functioning is impaired, a variety of psychosocial factors may maintain sexual satisfaction. That being so, health care providers (HCPs) should proactively address sexual symptoms at midlife and in older women, from a balanced perspective. Adequate counselling should be offered. Women with distressing symptoms may benefit from tailored hormonal and non-hormonal therapies, whereas women without distress related to their sexual experiences should not receive any specific treatment. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Coherence-generating power of quantum dephasing processes
Styliaris, Georgios; Campos Venuti, Lorenzo; Zanardi, Paolo
2018-03-01
We provide a quantification of the capability of various quantum dephasing processes to generate coherence out of incoherent states. The measures defined, admitting computable expressions for any finite Hilbert-space dimension, are based on probabilistic averages and arise naturally from the viewpoint of coherence as a resource. We investigate how the capability of a dephasing process (e.g., a nonselective orthogonal measurement) to generate coherence depends on the relevant bases of the Hilbert space over which coherence is quantified and the dephasing process occurs, respectively. We extend our analysis to include those Lindblad time evolutions which, in the infinite-time limit, dephase the system under consideration and calculate their coherence-generating power as a function of time. We further identify specific families of such time evolutions that, although dephasing, have optimal (over all quantum processes) coherence-generating power for some intermediate time. Finally, we investigate the coherence-generating capability of random dephasing channels.
Dephasing of optically generated electron spins in semiconductors
International Nuclear Information System (INIS)
Idrish Miah, M.
2010-01-01
Dephasing of optically generated electron spins in the presence of the external magnetic field and electric bias in semiconductor nano-structures has been studied by time- and polarization-resolved spectrometry. The obtained experimental data are presented in dependence of the strength of the magnetic field. The optically generated electron-spin precession frequency and dephasing time and rate are estimated. It is found that both the spin precession frequency and dephasing rate increase linearly with the external magnetic field up to about 9 T. However, the spin dephasing time is within sub-μs and is found to decrease exponentially with the strength of the external magnetic field. The results are discussed by exploring possible mechanisms of spin dephasing in low-dimensional semiconductor structures, where the quantum-confinement persists within the nano-range.
Dephasing of optically generated electron spins in semiconductors
Energy Technology Data Exchange (ETDEWEB)
Idrish Miah, M., E-mail: m.miah@griffith.edu.a [Department of Physics, University of Chittagong, Chittagong, Chittagong - 4331 (Bangladesh)
2010-09-13
Dephasing of optically generated electron spins in the presence of the external magnetic field and electric bias in semiconductor nano-structures has been studied by time- and polarization-resolved spectrometry. The obtained experimental data are presented in dependence of the strength of the magnetic field. The optically generated electron-spin precession frequency and dephasing time and rate are estimated. It is found that both the spin precession frequency and dephasing rate increase linearly with the external magnetic field up to about 9 T. However, the spin dephasing time is within sub-{mu}s and is found to decrease exponentially with the strength of the external magnetic field. The results are discussed by exploring possible mechanisms of spin dephasing in low-dimensional semiconductor structures, where the quantum-confinement persists within the nano-range.
Which are the male factors associated with female sexual dysfunction (FSD)?
Maseroli, E; Fanni, E; Mannucci, E; Fambrini, M; Jannini, E A; Maggi, M; Vignozzi, L
2016-09-01
It has been generally assumed that partner's erectile dysfunction, premature, and delayed ejaculation play a significant role in determining female sexual dysfunction (FSD). This study aimed to evaluate the role of the male partner's sexual function, as perceived by women, in determining FSD. A consecutive series of 156 heterosexual women consulting our clinic for FSD was retrospectively studied. All patients underwent a structured interview and completed the Female Sexual Function Index (FSFI). FSFI total score decreased as a function of partner's age, conflicts within the couple, relationship without cohabitation and the habit of engaging in intercourse to please the partner; FSFI total score increased as a function of frequency of intercourse, attempts to conceive and fertility-focused intercourse. FSFI total score showed a negative, stepwise correlation with partner's perceived hypoactive sexual desire (HSD) (r = -0.327; p dysfunction, premature and delayed ejaculation. In an age-adjusted model, partner's HSD was negatively related to FSFI total score (Wald = 9.196, p = 0.002), arousal (Wald = 7.893, p = 0.005), lubrication (Wald = 5.042, p = 0.025), orgasm (Wald = 9.293, p = 0.002), satisfaction (Wald = 12.764, p sexual pleasure, and with a higher frequency of masturbation, even after adjusting for age. In patients not reporting any reduction in libido, FSFI total score was significantly lower when their partner's libido was low (p = 0.041); the correlation disappeared if the patient also experienced HSD. In conclusion, the presence of erectile dysfunction, premature, and delayed ejaculation of the partner may not act as a primary contributing factor to FSD, as determined by FSFI scores; conversely, women's sexuality seems to be mostly impaired by the perceived reduction in their partner's sexual interest. © 2016 American Society of Andrology and European Academy of Andrology.
Room-Temperature Dephasing in InAs Quantum Dots
DEFF Research Database (Denmark)
Borri, Paola; Langbein, Wolfgang; Mørk, Jesper
2000-01-01
The room temperature dephasing in InAs/InGaAs/GaAs self-assembled quantum dots, embedded in a waveguide for laser applications, is measured using two independent methods: spectral hole burning and four-wave mixing. Without the application of bias current for electrical carrier injection......, a dephasing time of ~260 fs, weakly dependent on the optical excitation density, is found and attributed to phonon interaction. The application of bias current, leading to population inversion in the dot ground state and optical gain, strongly decreases the dephasing time to less than 50 fs, likely due...
FSD: Frequency Space Differential measurement of CMB spectral distortions
Mukherjee, Suvodip; Silk, Joseph; Wandelt, Benjamin D.
2018-04-01
Although the Cosmic Microwave Background agrees with a perfect blackbody spectrum within the current experimental limits, it is expected to exhibit certain spectral distortions with known spectral properties. We propose a new method, Frequency Space Differential (FSD) to measure the spectral distortions in the CMB spectrum by using the inter-frequency differences of the brightness temperature. The difference between the observed CMB temperature at different frequencies must agree with the frequency derivative of the blackbody spectrum, in the absence of any distortion. However, in the presence of spectral distortions, the measured inter-frequency differences would also exhibit deviations from blackbody which can be modeled for known sources of spectral distortions like y & μ. Our technique uses FSD information for the CMB blackbody, y, μ or any other sources of spectral distortions to model the observed signal. Successful application of this method in future CMB missions can provide an alternative method to extract spectral distortion signals and can potentially make it feasible to measure spectral distortions without an internal blackbody calibrator.
Dephasing in self-organized InAlGaAs quantum dots
DEFF Research Database (Denmark)
Leosson, K.; Birkedal, Dan; Hvam, Jørn Märcher
2002-01-01
We report the first direct measurements of dephasing in III-V semiconductor quantum dots at low temperature using degenerate four-wave mixing. At OK, the coherence time is limited by the population lifetime whereas pure dephasing due to exciton-phonon interactions appears only at finite temperatu......We report the first direct measurements of dephasing in III-V semiconductor quantum dots at low temperature using degenerate four-wave mixing. At OK, the coherence time is limited by the population lifetime whereas pure dephasing due to exciton-phonon interactions appears only at finite...
Dephasing in coherent communication with weak signal states
International Nuclear Information System (INIS)
Jarzyna, Marcin; Banaszek, Konrad; Demkowicz-Dobrzański, Rafał
2014-01-01
We analyse the ultimate quantum limit on the accessible information for an optical communication scheme when time bins carry coherent light pulses prepared in one of several orthogonal modes and the phase undergoes diffusion after each channel use. This scheme, an example of a quantum memory channel, can be viewed as noisy pulse position modulation (PPM) keying with phase fluctuations occurring between consecutive PPM symbols. We derive a general expression for the output states in the Fock basis and implement a numerical procedure to calculate the Holevo quantity. Using asymptotic properties of Toeplitz matrices, we also present an analytic expression for the Holevo quantity valid for very weak signals and sufficiently strong dephasing when the dominant contribution comes from the single-photon sector in the Hilbert space of signal states. Based on numerical results we conjecture an inequality for contributions to the Holevo quantity from multiphoton sectors which implies that in the asymptotic limit of weak signals, for arbitrarily small dephasing the accessible information scales linearly with the average number of photons contained in the pulse. Such behaviour presents a qualitative departure from the fully coherent case. (paper)
Zhang, Dawei; Lazim, Raudah; Mun Yip, Yew
2017-09-01
We conducted an all-atom ab initio folding of FSD-EY, a protein with a ββα configuration using non-polarizable (AMBER) and polarizable force fields (PHB designed by Gao et al.) in implicit solvent. The effect of reducing the polarization effect integrated into the force field by the PHB model, termed the PHB0.7 was also examined in the folding of FSD-EY. This model incorporates into the force field 70% of the original polarization effect to minimize the likelihood of over-stabilizing the backbone hydrogen bonds. Precise folding of the β-sheet of FSD-EY was further achieved by relaxing the REMD structure obtained in explicit water.
Dephasing in InAs/GaAs quantum dots
DEFF Research Database (Denmark)
Borri, Paola; Langbein, Wolfgang Werner; Mørk, Jesper
1999-01-01
The room-temperature dephasing in InAs/GaAs self-assembled quantum dots is measured using two independent methods: spectal-hole burning and four-wave mixing. Dephasing times weakly dependent on the excitation density are found, with a low density value of 290+/-80 fs from spectal-hole burning...
Coherence and dephasing in self-assembled quantum dots
DEFF Research Database (Denmark)
Hvam, Jørn Märcher; Leosson, K.; Birkedal, Dan
2003-01-01
We measured dephasing times in InGaAl/As self-assembled quantum dots at low temperature using degenerate four-wave mixing. At 0K, the coherence time of the quantum dots is lifetime limited, whereas at finite temperatures pure dephasing by exciton-phonon interactions governs the quantum dot...
Influence of pure dephasing on emission spectra from single photon sources
DEFF Research Database (Denmark)
Næsby Rasmussen, Andreas; Skovgård, Troels Suhr; Kristensen, Philip Trøst
2008-01-01
We investigate the light-matter interaction of a quantum dot with the electromagnetic field in a lossy microcavity and calculate emission spectra for nonzero detuning and dephasing. It is found that dephasing shifts the intensity of the emission peaks for nonzero detuning. We investigate the char......We investigate the light-matter interaction of a quantum dot with the electromagnetic field in a lossy microcavity and calculate emission spectra for nonzero detuning and dephasing. It is found that dephasing shifts the intensity of the emission peaks for nonzero detuning. We investigate...
Prisoners' dilemma in the presence of collective dephasing
International Nuclear Information System (INIS)
Nawaz, Ahmad
2012-01-01
We quantize prisoners' dilemma in the presence of collective dephasing with a dephasing rate γ. It is shown that for a two-parameter set of strategies, Q⊗Q is Nash equilibrium below a cut-off value of time. Beyond this cut-off it bifurcates into two new Nash equilibria Q⊗D and D⊗Q. Furthermore, for the maximum value of decoherence C⊗D and D⊗C also become Nash equilibria. At this stage the game has four Nash equilibria. On the other hand, for a three-parameter set of strategies, there is no pure strategy Nash equilibrium; however, there is a mixed strategy (non-unique) Nash equilibrium that is not affected by collective dephasing. (paper)
Dephasing times in quantum dots due to elastic LO phonon-carrier collisions
DEFF Research Database (Denmark)
Uskov, A. V.; Jauho, Antti-Pekka; Tromborg, Bjarne
2000-01-01
Interpretation of experiments on quantum dot (QD) lasers presents a challenge: the phonon bottleneck, which should strongly suppress relaxation and dephasing of the discrete energy states, often seems to be inoperative. We suggest and develop a theory for an intrinsic mechanism for dephasing in Q......: second-order elastic interaction between quantum dot charge carriers and LO phonons. The calculated dephasing times are of the order of 200 fs at room temperature, consistent with experiments. The phonon bottleneck thus does not prevent significant room temperature dephasing....
Constraints on dephasing widths and shifts in three-level quantum systems
International Nuclear Information System (INIS)
Berman, P.R.; O'Connell, Ross C.
2005-01-01
It is shown that the density matrix equations for a three-level quantum system interacting with external radiation fields can lead to negative populations if arbitrary dephasing rates and shifts are included in these equations. To guarantee non-negative populations, the equations themselves impose certain restrictions on the dephasing widths and shifts. The constraints on the widths are shown to be identical to those that can be derived from a model of Markovian dephasing events, independent of any atom-field interaction
Magneto-exciton dephasing in a single quantum dot
Rodriguez, F. J.; Reyes, A.; Olaya-Castro, A.; Quiroga, L.
2001-03-01
Ultrafast spectroscopy experiments on single quantum dot (SQD) in magnetic fields provide a variety of unexpected results, one of them being the recently reported entanglement of exciton states. In order to explore the entanglement robustness, dephasing mechanisms must be considered. By calculating the non-linear time resolved optical spectrum of a SQD, we present a theoretical study on the exciton-exciton scattering contribution to the magneto-exciton dephasing time. Our results show that the time evolution of \\chi^(3) presents, under non-steady-state condition, a beating between the bound biexciton and the first unbound biexciton state in the strong confinement regime. The contribution coming from both left and right polarized emitted photons allows us to predict the creation of exciton entanglement, in agreement with recent experimental results. Previous theoretical works have only addressed the stationary optical response. By contrast, our results based on a full time dependent calculation show new features specially for the fast dephasing case.
A comparative study of two phenomenological models of dephasing in series and parallel resistors
International Nuclear Information System (INIS)
Bandopadhyay, Swarnali; Chaudhuri, Debasish; Jayannavar, Arun M.
2010-01-01
We compare two recent phenomenological models of dephasing using a double barrier and a quantum ring geometry. While the stochastic absorption model generates controlled dephasing leading to Ohm's law for large dephasing strengths, a Gaussian random phase based statistical model shows many inconsistencies.
Dephasing in semiconductor-superconductor structures by coupling to a voltage probe
DEFF Research Database (Denmark)
Mortensen, Niels Asger; Jauho, Antti-Pekka; Flensberg, Karsten
2000-01-01
We study dephasing in semiconductor-superconductor structures caused by coupling to a voltage probe. We consider structures where the semiconductor consists of two scattering regions between which partial dephasing is possible. As a particular example we consider a situation with a double barrier...
International Nuclear Information System (INIS)
Stellwag, Bernhard; Hoffmann-Wankerl, Stephan; Schuetz, Sigrid; Jacob, Astrid
2012-09-01
Full-system decontamination (FSD) or replacement of steam generators (SG) and other large components in mature PWR plants results in large bare metal surfaces in the reactor system. The AREVA chemistry concept for sustainable dose rate reduction at such plants includes a passivation treatment for formation of high-quality oxide films in the reactor system and high pH operation in combination with zinc injection during subsequent power operation. The effectiveness of these measures has been proven by plant operation experience. The systematic evaluation of plant-specific experience is used for further optimization of the concept. These measures were also applied at the 1350 MW-class 4-loop PWR Grafenrheinfeld after an FSD with the AREVA decontamination process HP/CORD R UV in 28 th outage. The passivation treatment consisted of zinc injection during plant heat-up and parallel adjustment of a high pH value. It was carried out in the plant operation condition 'subcritical hot' for 200 hours and a pH (300 deg. C) of 7.1. During the cycle, the pH value was increased to 7.4 and zinc injection was continued. This paper evaluates the recontamination of the plant inclusive the first refueling outage since the FSD. The evaluation is based on routine chemistry and dose rate surveillance data and on the results of special measurement programs conducted at the plant before and after the FSD. Results of surface gamma activity measurements and fuel crud analyses are also described. Data is evaluated with regard to release, transport and deposition of corrosion products and nuclides in the reactor system. The plant-specific contamination sources and their pathways are outlined. Compared to the first refueling outage of the plant in 1983, the dose rate level at the main loops could be more than halved in spite of already activated core internals and crud on fuel assemblies, the in-core instrumentation and the control rods including guide assemblies and drive rods. The FSD
Exciton dephasing and biexciton binding in CdSe/ZnSe islands
DEFF Research Database (Denmark)
Wagner, Hans Peter; Tranitz, H.-P.; Preis, H
1999-01-01
The dephasing of excitons and the formation of biexcitons in self-organized CdSe/ZnSe islands grown by molecular-beam epitaxy is investigated using spectrally resolved four-wave mixing. A distribution of exciton-exciton scattering efficiencies and dephasing times in the range of 0.5-10 ps...
Dephasing and hyperfine interaction in carbon nanotubes double quantum dots
DEFF Research Database (Denmark)
Reynoso, Andres Alejandro; Flensberg, Karsten
2012-01-01
We study theoretically the return probability experiment, which is used to measure the dephasing time T-2*, in a double quantum dot (DQD) in semiconducting carbon nanotubes with spin-orbit coupling and disorder-induced valley mixing. Dephasing is due to hyperfine interaction with the spins of the C...... with these for DQDs in clean nanotubes, whereas the disorder effect is always relevant when the magnetic field is perpendicular to the nanotube axis....
Feedback controlled dephasing and population relaxation in a two-level system
International Nuclear Information System (INIS)
Wang Jin
2009-01-01
This Letter presents the maximum achievable stability and purity that can be obtained in a two-level system with both dephasing and population relaxation processes by using homodyne-mediated feedback control. An analytic formula giving the optimal amplitudes of the driving and feedback for the steady-state is also presented. Experimental examples are used to show the importance of controlling the dephasing process.
Willems, Pierre Dominique
The purpose of this case study was to research how science teachers balance both religion and evolution in the science classroom with as little controversy as possible. In this study I attempted to provide some insight on how teachers are currently teaching evolution in their science classes in light of the religious beliefs of the students as well as their own. The case study was conducted in a school district in Florida where I attempted to answer the following questions: (a) How do science teachers in the Florida School District (FSD) approach the religion--evolution issue in preparing students for a career in a field of science? (b) How do science teachers in the FSD reconcile the subject of evolution with the religious views of their students? (c) How do science teachers in the FSD reconcile their own religious views with the teaching of evolution? (d) How do science teachers in the FSD perceive the relationship between religion and science? The data was collected through interviews with two high school teachers, and one middle school teacher, by observing each participant teach, by collecting site documents and by administering an exploratory survey to student volunteers. Analysis was conducted by open coding which produced four themes from which the research questions were answered and the survey answers were counted to produce the percentages displayed in the tables in chapter four. The teachers avoided discussion on religiously oriented questions or statements by the students and did not reveal their own religious orientation. The topic of microevolution appeared to reduce stress in the classroom environment, as opposed to addressing macroevolution.
Choo, Kenny; Bissbort, Ulf; Poletti, Dario
2017-01-01
We study the response of a particle current to dissipative dephasing in an interacting, few-body fermionic lattice system. The particles are prepared in the ground state in presence of an artificial magnetic gauge field, which is subsequently quenched to zero. The initial current decays non-trivially in the dissipative environment and we explore the emerging dynamics and its dependence on various system parameters.
Heat transport in the XXZ spin chain: from ballistic to diffusive regimes and dephasing enhancement
International Nuclear Information System (INIS)
Mendoza-Arenas, J J; Al-Assam, S; Clark, S R; Jaksch, D
2013-01-01
In this work we study the heat transport in an XXZ spin-1/2 Heisenberg chain with homogeneous magnetic field, incoherently driven out of equilibrium by reservoirs at the boundaries. We focus on the effect of bulk dephasing (energy-dissipative) processes in different parameter regimes of the system. The non-equilibrium steady state of the chain is obtained by simulating its evolution under the corresponding Lindblad master equation, using the time evolving block decimation method. In the absence of dephasing, the heat transport is ballistic for weak interactions, while being diffusive in the strongly interacting regime, as evidenced by the heat current scaling with the system size. When bulk dephasing takes place in the system, diffusive transport is induced in the weakly interacting regime, with the heat current monotonically decreasing with the dephasing rate. In contrast, in the strongly interacting regime, the heat current can be significantly enhanced by dephasing for systems of small size. (paper)
Exciton dephasing in ZnSe quantum wires
DEFF Research Database (Denmark)
Wagner, Hans Peter; Langbein, Wolfgang Werner; Hvam, Jørn Märcher
1998-01-01
The homogeneous linewidths of excitons in wet-etched ZnSe quantum wires of lateral sizes down to 23 nm are studied by transient four-wave mixing. The low-density dephasing time is found to increase with decreasing wire width. This is attributed mainly to a reduction of electron-exciton scattering...
Spin-Dephasing Anisotropy for Electrons in a Diffusive Quasi-1D GaAs Wire
Liu, J.; Last, T.; Koop, E. J.; Denega, S.; van Wees, B. J.; van der Wal, C. H.
We present a numerical study of dephasing of electron spin ensembles in a diffusive quasi-one-dimensional GaAs wire due to the D'yakonov-Perel' spin-dephasing mechanism. For widths of the wire below the spin precession length and for equal strength of Rashba and linear Dresselhaus spin-orbit fields
Vibronic dephasing model for coherent-to-incoherent crossover in DNA
Karasch, Patrick; Ryndyk, Dmitry A.; Frauenheim, Thomas
2018-05-01
In this paper, we investigate the interplay between coherent and incoherent charge transport in cytosine-guanine (GC-) rich DNA molecules. Our objective is to introduce a physically grounded approach to dephasing in large molecules and to understand the length-dependent charge transport characteristics, and especially the crossover from the coherent tunneling to incoherent hopping regime at different temperatures. Therefore, we apply the vibronic dephasing model and compare the results to the Büttiker probe model which is commonly used to describe decoherence effects in charge transport. Using the full ladder model and simplified one-dimensional model of DNA, we consider molecular junctions with alternating and stacked GC sequences and compare our results to recent experimental measurements.
Quantum Metrology beyond the Classical Limit under the Effect of Dephasing
Matsuzaki, Yuichiro; Benjamin, Simon; Nakayama, Shojun; Saito, Shiro; Munro, William J.
2018-04-01
Quantum sensors have the potential to outperform their classical counterparts. For classical sensing, the uncertainty of the estimation of the target fields scales inversely with the square root of the measurement time T . On the other hand, by using quantum resources, we can reduce this scaling of the uncertainty with time to 1 /T . However, as quantum states are susceptible to dephasing, it has not been clear whether we can achieve sensitivities with a scaling of 1 /T for a measurement time longer than the coherence time. Here, we propose a scheme that estimates the amplitude of globally applied fields with the uncertainty of 1 /T for an arbitrary time scale under the effect of dephasing. We use one-way quantum-computing-based teleportation between qubits to prevent any increase in the correlation between the quantum state and its local environment from building up and have shown that such a teleportation protocol can suppress the local dephasing while the information from the target fields keeps growing. Our method has the potential to realize a quantum sensor with a sensitivity far beyond that of any classical sensor.
Binding-energy distribution and dephasing of localized biexcitons
DEFF Research Database (Denmark)
Langbein, Wolfgang Werner; Hvam, Jørn Märcher; Umlauff, M.
1997-01-01
We report on the binding energy and dephasing of localized biexciton states in narrow ZnSe multiple quantum wells. The measured binding-energy distribution of the localized biexcitons shows a width of 2.2 meV centered at 8.5 meV, and is fairly independent of the exciton localization energy. In fo...
Dissipation, dephasing and quantum Darwinism in qubit systems with random unitary interactions
Balaneskovic, Nenad; Mendler, Marc
2016-09-01
We investigate the influence of dissipation and decoherence on quantum Darwinism by generalizing Zurek's original qubit model of decoherence and the establishment of pointer states [W.H. Zurek, Nat. Phys. 5, 181 (2009); see also arXiv: quant-ph/0707.2832v1, pp. 14-19.]. Our model allows for repeated multiple qubit-qubit couplings between system and environment which are described by randomly applied two-qubit quantum operations inducing entanglement, dissipation and dephasing. The resulting stationary qubit states of system and environment are investigated. They exhibit the intricate influence of entanglement generation, dissipation and dephasing on this characteristic quantum phenomenon.
Wave attenuation model for dephasing and measurement of ...
Indian Academy of Sciences (India)
There are different ways to model dephasing in mesoscopic systems. An interesting method is to attach a voltage probe [3] to the sample as in the inset of figure 1 (Buttiker's model). In this model, an electron captured by a voltage probe is injected back with an uncorrelated phase leading to irreversible loss of phase memory ...
Resonance Raman and optical dephasing study of tricarbocyanine dyes
Ashworth, SH; Kummrow, A; Lenz, K
Fluorescence lineshape analysis based on resonance Raman spectra of the dye HITCI was used to determine the details and magnitude of the vibrational part of the line broadening function, Forced light scattering (FLS) was applied to measure optical dephasing of HITCI in ethylene glycol, pumping at
Reducing dephasing in coupled quantum dot-cavity systems by engineering the carrier wavefunctions
DEFF Research Database (Denmark)
Nysteen, Anders; Nielsen, Per Kær; Mørk, Jesper
2012-01-01
We demonstrate theoretically how photon-assisted dephasing by the electron-phonon interaction in a coupled cavity-quantum dot system can be significantly reduced for specific QD-cavity detunings. Our starting point is a recently published theory,1 which considers longitudinal acoustic phonons......, described by a non-Markovian model, interacting with a coupled quantum dot-cavity system. The reduction of phonon-induced dephasing is obtained by placing the cavity-quantum dot system inside an infinite slab, assuming spherical electronic wavefunctions. Based on our calculations, we expect this to have...
Semiclassical Monte Carlo simulation studies of spin dephasing in InP and InSb nanowires
Directory of Open Access Journals (Sweden)
Ashish Kumar
2012-03-01
Full Text Available We use semiclassical Monte Carlo approach to investigate spin polarized transport in InP and InSb nanowires. D’yakonov-Perel (DP relaxation and Elliott-Yafet (EY relaxation are the two main relaxation mechanisms for spin dephasing in III-V channels. The DP relaxation occurs because of bulk inversion asymmetry (Dresselhaus spin-orbit interaction and structural inversion asymmetry (Rashba spin-orbit interaction. The injection polarization direction studied is that along the length of the channel. The dephasing rate is found to be very strong for InSb as compared to InP which has larger spin dephasing lengths. The ensemble averaged spin components vary differently for both InP and InSb nanowires. The steady state spin distribution also shows a difference between the two III-V nanowires.
Factors affecting the effectiveness of a projection dephaser in 2D gradient-echo imaging
International Nuclear Information System (INIS)
Bakker, Chris J G; Peters, Nicky H G M; Vincken, Koen L; Bom, Martijn van der; Seppenwoolde, Jan-Henry
2007-01-01
Projection dephasers are often used for background suppression and dynamic range improvement in thick-slab 2D imaging in order to promote the visibility of subslice structures, e.g., blood vessels and interventional devices. In this study, we explored the factors that govern the effectiveness of a projection dephaser by simulations and phantom experiments. This was done for the ideal case of a single subslice hyper- or hypointensity against a uniform background in the absence of susceptibility effects. Simulations and experiments revealed a pronounced influence of the slice profile, the nominal flip angle and the TE and TR of the acquisition, the size, intraslice position and MR properties of the subslice structure, and T 1 of the background. The complexity of the ideal case points to the necessity of additional explorations when considering the use of projection dephasers under less ideal conditions, e.g., in the presence of tissue heterogeneities and susceptibility gradients
International Nuclear Information System (INIS)
Kang, Da-wei; Sun, Meng-le; Zuo, Zheng-wei; Wang, Hui-xian; Lv, Shi-jie; Li, Xin-zhong; Li, Li-ben
2016-01-01
The charge transport properties of the G4-DNA molecular device in the presence of counter ions and dephasing effect are investigated based on the Green function method and Landauer–Büttiker theory. The currents through the G4-DNA molecular device depend on the interference patterns at different coupling configurations. There is an effective electrostatic interaction between the counter ions and the G4-DNA molecule which introduces disorder into the on-site energies of G bases. The current through the device can be enhanced by the small disorder which avoids the strong interference of electrons at the same energy in some coupling configurations, however the diagonal disorder can suppress the overall current due to the Anderson localization of charge carriers when the disorder is large. In the presence of dephasing effect the current through the device at all coupling configurations can be enhanced as a result of the phase coherence losing of electron. As for the magnetic field response, the magnetoresistance of the device is always suppressed by the counter ions and dephasing effect. - Highlights: • The counter ions can some times enhance the current through G4-DNA molecule. • The dephasing effect can enhance the current of the device at all four coupling configurations. • The magnetoresistance is always suppressed by the counter ions and dephasing effect.
Sun, Qi-C.; Ding, Yuchen; Goodman, Samuel M.; H. Funke, Hans; Nagpal, Prashant
2014-10-01
Copper metal can provide an important alternative for the development of efficient, low-cost and low-loss plasmonic nanoparticles, and selective nanocatalysts. However, poor chemical stability and lack of insight into photophysics and plasmon decay mechanisms has impeded study. Here, we use smooth conformal ALD coating on copper nanoparticles to prevent surface oxidation, and study dephasing time for localized surface plasmons on different sized copper nanoparticles. Using dephasing time as a figure of merit, we elucidate the role of electron-electron, electron-phonon, impurity, surface and grain boundary scattering on the decay of localized surface plasmon waves. Using our quantitative analysis and different temperature dependent measurements, we show that electron-phonon interactions dominate over other scattering mechanisms in dephasing plasmon waves. While interband transitions in copper metal contributes substantially to plasmon losses, tuning surface plasmon modes to infrared frequencies leads to a five-fold enhancement in the quality factor. These findings demonstrate that conformal ALD coatings can improve the chemical stability for copper nanoparticles, even at high temperatures (>300 °C) in ambient atmosphere, and nanoscaled copper is a good alternative material for many potential applications in nanophotonics, plasmonics, catalysis and nanoscale electronics.Copper metal can provide an important alternative for the development of efficient, low-cost and low-loss plasmonic nanoparticles, and selective nanocatalysts. However, poor chemical stability and lack of insight into photophysics and plasmon decay mechanisms has impeded study. Here, we use smooth conformal ALD coating on copper nanoparticles to prevent surface oxidation, and study dephasing time for localized surface plasmons on different sized copper nanoparticles. Using dephasing time as a figure of merit, we elucidate the role of electron-electron, electron-phonon, impurity, surface and grain
Directory of Open Access Journals (Sweden)
Chiara Borghi
2017-03-01
Full Text Available Female Sexual Disorders (FSD include a complex, multidimensional, individual experience that can change as an individual age, suggesting that these problems are caused by multiple factors including psychosocial factors, personal relationships, pathologic changes caused by diseases, and pharmacologic influences. Menopause is an important time for middle aged women and postmenopausal physiological changes could have a significant role in the development of FSD. Few is still known about their correct definition and treatment. Their incidence, prevalence and risk factors are difficult to define because of a high level of overlap in the experience of problems with desire, arousal, and orgasm. Little evidences are known about the best therapeutic approach, and both non-pharmacological and pharmacological treatment options have been described. Among these, phosphodiesterase type 5 inhibitors could be an effective option for many subtypes of female sexual disorders, with an improvement in different aspects of sexual function, such as desire, arousal, orgasm and sexual satisfaction. In this paper authors reviewed what is already known about the use of these vasoactive agents, particularly tadalafil, as a treatment option for female sexual disturbances.
Dynamical decoupling sequences for multi-qubit dephasing suppression and long-time quantum memory
International Nuclear Information System (INIS)
Paz-Silva, Gerardo A; Lee, Seung-Woo; Green, Todd J; Viola, Lorenza
2016-01-01
We consider a class of multi-qubit dephasing models that combine classical noise sources and linear coupling to a bosonic environment, and are controlled by arbitrary sequences of dynamical decoupling pulses. Building on a general transfer filter-function framework for open-loop control, we provide an exact representation of the controlled dynamics for arbitrary stationary non-Gaussian classical and quantum noise statistics, with analytical expressions emerging when all dephasing sources are Gaussian. This exact characterization is used to establish two main results. First, we construct multi-qubit sequences that ensure maximum high-order error suppression in both the time and frequency domain and that can be exponentially more efficient than existing ones in terms of total pulse number. Next, we show how long-time multi-qubit storage may be achieved by meeting appropriate conditions for the emergence of a fidelity plateau under sequence repetition, thereby generalizing recent results for single-qubit memory under Gaussian dephasing. In both scenarios, the key step is to endow multi-qubit sequences with a suitable displacement anti-symmetry property, which is of independent interest for applications ranging from environment-assisted entanglement generation to multi-qubit noise spectroscopy protocols. (paper)
Relaxometry and Dephasing Imaging of Superparamagnetic Magnetite Nanoparticles Using a Single Qubit
Schmid-Lorch, Dominik; Häberle, Thomas; Reinhard, Friedemann; Zappe, Andrea; Slota, Michael; Bogani, Lapo; Finkler, Amit; Wrachtrup, Jörg
2015-08-01
To study the magnetic dynamics of superparamagnetic nanoparticles we use scanning probe relaxometry and dephasing of the nitrogen-vacancy (NV) center in diamond, characterizing the spin-noise of a single 10-nm magnetite particle. Additionally, we show the anisotropy of the NV sensitivity's dependence on the applied decoherence measurement method. By comparing the change in relaxation (T 1 ) and dephasing (T 2 ) time in the NV center when scanning a nanoparticle over it, we are able to extract the nanoparticle's diameter and distance from the NV center using an Ornstein-Uhlenbeck model for the nanoparticle's fluctuations. This scanning-probe technique can be used in the future to characterize different spin label substitutes for both medical applications and basic magnetic nanoparticle behavior.
Raman study of vibrational dephasing in liquid CH3CN and CD3CN
International Nuclear Information System (INIS)
Schroeder, J.; Schiemann, V.H.; Sharko, P.T.; Jonas, J.
1977-01-01
The Raman line shapes of the ν 1 (a 1 ) C--H and C--D fundamentals in liquid acetonitrile and acetonitrile-d 3 have been measured as a function of pressure up to 4 kbar within the temperature interval 30--120 degreeC. Densities have also been determined. From the isotropic component of the vibrational Raman band shape the vibrational relaxation times have been obtained as a function of temperature and pressure (density). The experimental results can be summarized as follows: (i) as T increases at constant density rho, the vibrational relaxation rate (tau/sub vib/) -1 increases; (ii) at constant T as density is raised tau/sub vib/ -1 increases; (iii) at constant pressure the T increase produces higher tau/sub vib/ -1 , however, the change is more pronounced for the CD 3 CN liquid. Isotopic dilution studies of the CH 3 CN/CD 3 CN mixtures shows no significant effect on (tau/sub vib/ -1 ). The experimental data are interpreted in terms of the Kubo stochastic line shape theory and the dephasing model of Fischer and Laubereau. The results based on Kubo formalism indicate that dephasing is the dominant relaxation mechanism and that the modulation is fast. The isolated binary collision model proposed by Fischer and Laubereau for vibrational dephasing reproduces the essential features of the density and temperature dependence of the (tau/sub vib/) -1 and suggests that pure dephasing is the dominant broadening mechanism for the isotropic line shapes studied. In the calculation the elastic collision times were approximated by the Enskog relaxation times
Energy Technology Data Exchange (ETDEWEB)
Kahnoj, Sina Soleimani; Touski, Shoeib Babaee [School of Electrical and Computer Engineering, University of Tehran, P.O. Box 14395-515, Tehran (Iran, Islamic Republic of); Pourfath, Mahdi, E-mail: pourfath@ut.ac.ir, E-mail: pourfath@iue.tuwien.ac.at [School of Electrical and Computer Engineering, University of Tehran, P.O. Box 14395-515, Tehran (Iran, Islamic Republic of); Institute for Microelectronics, TU Wien, Gusshausstrasse 27–29/E360, 1040 Vienna (Austria)
2014-09-08
The effect of dephasing induced by electron-electron interaction on electronic transport in graphene nanoribbons is theoretically investigated. In the presence of disorder in graphene nanoribbons, wavefunction of electrons can set up standing waves along the channel and the conductance exponentially decreases with the ribbon's length. Employing the non-equilibrium Green's function formalism along with an accurate model for describing the dephasing induced by electron-electron interaction, we show that this kind of interaction prevents localization and transport of electrons remains in the diffusive regime where the conductance is inversely proportional to the ribbon's length.
The effect of dephasing on edge state transport through p-n junctions in HgTe/CdTe quantum wells.
Zhang, Ying-Tao; Song, Juntao; Sun, Qing-Feng
2014-02-26
Using the Landauer-Büttiker formula, we study the effect of dephasing on the transport properties of the HgTe/CdTe p-n junction. It is found that in the HgTe/CdTe p-n junction the topologically protected gapless helical edge states manifest a quantized 2e²/h plateau robust against dephasing, in sharp contrast to the case for the normal HgTe/CdTe quantum well. This robustness of the transport properties of the edge states against dephasing should be attributed to the special construction of the HgTe/CdTe p-n junction, which limits the gapless helical edge states to a very narrow region and thus weakens the influence of the dephasing on the gapless edge states to a large extent. Our results demonstrate that the p-n junction could be a substitute device for use in experimentally observing the robust edge states and quantized plateau. Finally, we present a feasible scheme based on current experimental methods.
Observation of the in-plane spin-dephasing anisotropy in [111]-grown GaAs/AlGaAs quantum well
International Nuclear Information System (INIS)
Zhao, Chunbo; Li, Junbin; Yu, Ying; Ni, Haiqiao; Niu, Zhichuan; Zhang, Xinhui
2014-01-01
The electron density and temperature dependent in-plane spin-dephasing anisotropy in [111]-grown GaAs quantum well (QW) has been investigated by time-resolved magneto-Kerr rotation technique. Due to the specific symmetry of [111]-grown quantum well, the in-plane Rashba and linear Dresselhaus effective spin-orbit magnetic field is parallel to each other for electron wave vectors in all directions. However, an obvious in-plane spin-dephasing anisotropy comparing [2 ¯ 11] with [01 ¯ 1] crystalline orientations has been observed and discussed in this work. Our results demonstrate the innegligible spin dephasing channel through inhomogeneous broadening induced by the out-of-plane non-linear Dresselhaus field, which arises naturally from the C 3 symmetry of [111]-grown GaAs QW
Spatial correlation in matter-wave interference as a measure of decoherence, dephasing, and entropy
Chen, Zilin; Beierle, Peter; Batelaan, Herman
2018-04-01
The loss of contrast in double-slit electron diffraction due to dephasing and decoherence processes is studied. It is shown that the spatial intensity correlation function of diffraction patterns can be used to distinguish between dephasing and decoherence. This establishes a measure of time reversibility that does not require the determination of coherence terms of the density matrix, while von Neumann entropy, another measure of time reversibility, does require coherence terms. This technique is exciting in view of the need to understand and control the detrimental experimental effect of contrast loss and for fundamental studies on the transition from the classical to the quantum regime.
Many-Particle Dephasing after a Quench
Kiendl, Thomas; Marquardt, Florian
2017-03-01
After a quench in a quantum many-body system, expectation values tend to relax towards long-time averages. However, temporal fluctuations remain in the long-time limit, and it is crucial to study the suppression of these fluctuations with increasing system size. The particularly important case of nonintegrable models has been addressed so far only by numerics and conjectures based on analytical bounds. In this work, we are able to derive analytical predictions for the temporal fluctuations in a nonintegrable model (the transverse Ising chain with extra terms). Our results are based on identifying a dynamical regime of "many-particle dephasing," where quasiparticles do not yet relax but fluctuations are nonetheless suppressed exponentially by weak integrability breaking.
International Nuclear Information System (INIS)
Burr, G.W.; Harris, Todd L.; Babbitt, Wm. Randall; Jefferson, C. Michael
2004-01-01
We describe the incorporation of excitation-induced dephasing (EID) into the Maxwell-Bloch numerical simulation of photon echoes. At each time step of the usual numerical integration, stochastic frequency jumps of ions--caused by excitation of neighboring ions--is modeled by convolving each Bloch vector with the Bloch vectors of nearby frequency detunings. The width of this convolution kernel follows the instantaneous change in overall population, integrated over the simulated bandwidth. This approach is validated by extensive comparison against published and original experimental results. The enhanced numerical model is then used to investigate the accuracy of experiments designed to extrapolate to the intrinsic dephasing time T 2 from data taken in the presence of EID. Such a modeling capability offers improved understanding of experimental results, and should allow quantitative analysis of engineering tradeoffs in realistic optical coherent transient applications
Quantum capacity of dephasing channels with memory
International Nuclear Information System (INIS)
D'Arrigo, A; Benenti, G; Falci, G
2007-01-01
We show that the amount of coherent quantum information that can be reliably transmitted down a dephasing channel with memory is maximized by separable input states. In particular, we model the channel as a Markov chain or a multimode environment of oscillators. While in the first model, the maximization is achieved for the maximally mixed input state, in the latter it is convenient to exploit the presence of a decoherence-protected subspace generated by memory effects. We explicitly compute the quantum channel capacity for the first model while numerical simulations suggest a lower bound for the latter. In both cases memory effects enhance the coherent information. We present results valid for arbitrary input size
International Nuclear Information System (INIS)
Geddes, C.G.R.; Toth, Cs.; Tilborg, J. van; Esarey, E.; Schroeder, C.B.; Bruhwiler, D.; Nieter, C.; Cary, J.; Leemans, W.P.
2005-01-01
High-quality electron beams, with a few 10 9 electrons within a few percent of the same energy above 80 MeV, were produced in a laser wakefield accelerator by matching the acceleration length to the length over which electrons were accelerated and outran (dephased from) the wake. A plasma channel guided the drive laser over long distances, resulting in production of the high-energy, high-quality beams. Unchanneled experiments varying the length of the target plasma indicated that the high-quality bunches are produced near the dephasing length and demonstrated that channel guiding was more stable and efficient than relativistic self-guiding. Consistent with these data, particle-in-cell simulations indicate production of high-quality electron beams when trapping of an initial bunch of electrons suppresses further injection by loading the wake. The injected electron bunch is then compressed in energy by dephasing, when the front of the bunch begins to decelerate while the tail is still accelerated
Rapid adiabatic passage in quantum dots: Influence of scattering and dephasing
DEFF Research Database (Denmark)
Schuh, K.; Jahnke, F.; Lorke, Michael
2011-01-01
Theoretical investigations for the realization of population inversion of semiconductor quantum dot ground-state transitions by means of adiabatic passage with chirped optical pulses are presented. While the inversion due to Rabi oscillations depends sensitively on the resonance condition...... to describe carrier scattering and dephasing in the corresponding simulations and allow to quantify the conditions to simultaneously invert an ensamble of quantum dots....
Time-resolved photoelectron spectrometry of a dephasing process in pyrazine
International Nuclear Information System (INIS)
Pavlov, R.L.; Pavlov, L.I.; Delchev, Ya.I.; Pavlova, S.I.
2001-01-01
The first femtosecond time-resolved photoelectron imaging (PEI) is presented. The method is characterized by photoionization of NO and further applied to ultrafast dephasing in pyrazine. Intermediate case behaviour in radiationless transition is clearly observed in time-resolved photoelectron kinetic energy distribution. Femtosecond PEI is with much improved efficiency than conventional photoelectron spectroscopies. It is anticipated that the unifield approach of time-resolved photoelectron and photoion imaging opens the possibility of observing photon-induced dynamics in real time
Song, Ya-Ju; Tan, Qing-Shou; Kuang, Le-Man
2017-03-08
We investigate the possibility to control quantum evolution speed of a single dephasing qubit for arbitrary initial states by the use of periodic dynamical decoupling (PDD) pulses. It is indicated that the quantum speed limit time (QSLT) is determined by initial and final quantum coherence of the qubit, as well as the non-Markovianity of the system under consideration during the evolution when the qubit is subjected to a zero-temperature Ohmic-like dephasing reservoir. It is shown that final quantum coherence of the qubit and the non-Markovianity of the system can be modulated by PDD pulses. Our results show that for arbitrary initial states of the dephasing qubit with non-vanishing quantum coherence, PDD pulses can be used to induce potential acceleration of the quantum evolution in the short-time regime, while PDD pulses can lead to potential speedup and slow down in the long-time regime. We demonstrate that the effect of PDD on the QSLT for the Ohmic or sub-Ohmic spectrum (Markovian reservoir) is much different from that for the super-Ohmic spectrum (non-Markovian reservoir).
Towards optimized suppression of dephasing in systems subject to pulse timing constraints
International Nuclear Information System (INIS)
Hodgson, Thomas E.; D'Amico, Irene; Viola, Lorenza
2010-01-01
We investigate the effectiveness of different dynamical decoupling protocols for storage of a single qubit in the presence of a purely dephasing bosonic bath, with emphasis on comparing quantum coherence preservation under uniform versus nonuniform delay times between pulses. In the limit of instantaneous bit-flip pulses, this is accomplished by establishing a different representation of the controlled qubit evolution, where the decoherence behavior after an arbitrary number of pulses is directly expressed in terms of the uncontrolled decoherence function. In particular, analytical expressions are obtained for approximation of the long- and short-term coherence behavior for both Ohmic and supra-Ohmic environments. By focusing on the realistic case of pure dephasing in an excitonic qubit, we quantitatively assess the impact of physical constraints on achievable pulse separations, and show that little advantage of high-level decoupling schemes based on concatenated or optimal design may be expected if pulses cannot be applied sufficiently fast. In such constrained scenarios, we demonstrate how simple modifications of repeated periodic-echo protocols can offer significantly improved coherence preservation in realistic parameter regimes. We expect similar conclusions to be relevant to other constrained qubit devices exposed to quantum or classical phase noise.
DEFF Research Database (Denmark)
Lundeman, Jesper Holm; Jensen, Ole Bjarlin; Andersen, Peter E.
2009-01-01
We present a measurement series of the efficiency of periodically poled KTP used for second-harmonic generation in an external phase-locked cavity. Due to the high absorption (0.01 cm^−1) in the PPKTP crystal at the pump wavelength a strong thermal dephasing of the periodically poled grating...
International Nuclear Information System (INIS)
Stanton, C.J.; Kenrow, J.; El Sayed, K.; Jho, Y.D.; Kim, D.S.; Song, J.J.; Fischer, Arthur Joseph
2004-01-01
Femtosecond differential reflectivity spectroscopy (DRS) and four-wave mixing (FWM) experiments were performed simultaneously to study the initial temporal dynamics of the exciton line-shapes in GaN epilayers. Beats between the A-B excitons were found only for positive time delay in both DRS and FWM experiments. The rise time at negative time delay for the DRS was much slower than the FWM signal or differential transmission spectroscopy at the exciton resonance. A numerical solution of a six band semiconductor Bloch equation model including nonlinearities at the Hartree-Fock level shows that this slow rise in the DRS results from excitation induced dephasing, that is, the strong density dependence of the dephasing time which changes with the laser excitation energy.
Exciton dephasing in single InGaAs quantum dots
DEFF Research Database (Denmark)
Leosson, Kristjan; Østergaard, John Erland; Jensen, Jacob Riis
2000-01-01
The homogeneous linewidth of excitonic transitions is a parameter of fundamental physical importance. In self-assembled quantum dot systems, a strong inhomogeneous broadening due to dot size fluctuations masks the homogeneous linewidth associated with transitions between individual states....... The homogeneous and inhomogeneous broadening of InGaAs quantum dot luminescence is of central importance for the potential application of this material system in optoelectronic devices. Recent measurements of MOCVD-grown InAs/InGaAs quantum dots indicate a large homogeneous broadening at room temperature due...... to fast dephasing. We present an investigation of the low-temperature homogeneous linewidth of individual PL lines from MBE-grown In0.5Ga0.5As/GaAs quantum dots....
Joo, Taiha; Albrecht, A. C.
1993-06-01
Time-resolved degenerate four-wave mixing (TRDFWM) for an electronically resonant system in a phase-matching configuration that measures population decay is reported. Because the spectral width of input light exceeds the vibrational Bohr frequency of a strong Raman active mode, the vibrational coherence produces strong oscillations in the TRDFWM signal together with the usual population decay from the excited electronic state. The data are analyzed in terms of a four-level system: ground and excited electronic states each split by a vibrational quantum of a Raman active mode. Absolute frequencies and their dephasing times of the vibrational modes at ≈590 cm -1 are obtained for the excited as well as the ground electronic state. The vibrational dephasing rate in the excited electronic state is about an order of magnitude faster than that in the ground state, the origin of which is speculated upon.
International Nuclear Information System (INIS)
Goan, Hsi-Sheng; Jian, Chung-Chin; Chen, Po-Wen
2010-01-01
We evaluate the non-Markovian finite-temperature two-time correlation functions (CF's) of system operators of a pure-dephasing spin-boson model in two different ways, one by the direct exact operator technique and the other by the recently derived evolution equations, valid to second order in the system-environment interaction Hamiltonian. This pure-dephasing spin-boson model that is exactly solvable has been extensively studied as a simple decoherence model. However, its exact non-Markovian finite-temperature two-time system operator CF's, to our knowledge, have not been presented in the literature. This may be mainly due to the fact, illustrated in this article, that in contrast to the Markovian case, the time evolution of the reduced density matrix of the system (or the reduced quantum master equation) alone is not sufficient to calculate the two-time system operator CF's of non-Markovian open systems. The two-time CF's obtained using the recently derived evolution equations in the weak system-environment coupling case for this non-Markovian pure-dephasing model happen to be the same as those obtained from the exact evaluation. However, these results significantly differ from the non-Markovian two-time CF's obtained by wrongly directly applying the quantum regression theorem (QRT), a useful procedure to calculate the two-time CF's for weak-coupling Markovian open systems. This demonstrates clearly that the recently derived evolution equations generalize correctly the QRT to non-Markovian finite-temperature cases. It is believed that these evolution equations will have applications in many different branches of physics.
DEFF Research Database (Denmark)
Wagner, Hans Peter; Schätz, A.; Maier, R.
1998-01-01
We investigate the interaction and dephasing of the excitons in wide ZnSe/Zn0.94Mg0.06Se quantum wells by spectrally resolved, femtosecond four-wave mixing (FWM). Polarization-dependent measurements indicate that excitation-induced dephasing is the dominant FWM process. The biexcitons of the center...... repulsion for coherent excitons. The exciton interaction rates with acoustic and optical phonons are deduced by their temperature dependencies. The acoustic-phonon scattering is found to be strongly reduced in the investigated wide wells due to the reduced accessible phonon wave vector....
Gallart, M.; Ziegler, M.; Crégut, O.; Feltin, E.; Carlin, J.-F.; Butté, R.; Grandjean, N.; Hönerlage, B.; Gilliot, P.
2017-07-01
Applying four-wave mixing spectroscopy to a high-quality GaN/AlGaN single quantum well, we report on the experimental determination of excitonic dephasing times at different temperatures and exciton densities in III-nitride heterostructures. By comparing the evolution with the temperature of the dephasing and the spin-relaxation rate, we conclude that both processes are related to the rate of excitonic collisions. When spin relaxation occurs in the motional-narrowing regime, it remains constant over a large temperature range as the spin-precession frequency increases linearly with temperature, hence compensating for the observed decrease in the dephasing time. From those measurements, a value of the electron-hole exchange interaction strength of 0.45 meV at T =10 K is inferred.
DEFF Research Database (Denmark)
Langbein, Wolfgang Werner; Hvam, Jørn Märcher; Zimmermann, R.
1999-01-01
). This method determines the decays of intensity and coherence separately, thus distinguishing lifetime from pure dephasing. The secondary emission of excitons in semiconductor quantum wells is investigated. Here the combination of static disorder and inelastic scattering leads to a partially coherent emission....... The temperature dependence is well explained by phonon scattering....
Interactions, Disorder and Dephasing in Superconducting Films and Quantum Hall Systems
International Nuclear Information System (INIS)
Auerbach, A.
1999-01-01
It is shown that a large class of two dimensional Superconductor to Insulator (SC-I), and (Quantum Hall to Insulator (QH-I) transitions can be understood by assuming that the thermodynamic transition in the clean system is first order. The finite correlation lengths at that transition yield a natural separation of the disorder into short and long wavelengths which are then straightforward to incorporate perturbatively and semi classically respectively. This approach reduces problems of disorder+interactions to puddle network models, whose studies have already yielded insight into experiments of QH-I and SC-I. For the CQH-I, the difference between Landauer-Buttiker and Boltzman theories highlights effects of dephasing
Ultrafast Dephasing and Incoherent Light Photon Echoes in Organic Amorphous Systems
Yano, Ryuzi; Matsumoto, Yoshinori; Tani, Toshiro; Nakatsuka, Hiroki
1989-10-01
Incoherent light photon echoes were observed in organic amorphous systems (cresyl violet in polyvinyl alcohol and 1,4-dihydroxyanthraquinone in polymethacrylic acid) by using temporally-incoherent nanosecond laser pulses. It was found that an echo decay curve of an organic amorphous system is composed of a sharp peak which decays very rapidly and a slowly decaying wing at the tail. We show that the persistent hole burning (PHB) spectra were reproduced by the Fourier-cosine transforms of the echo decay curves. We claim that in general, we must take into account the multi-level feature of the system in order to explain ultrafast dephasing at very low temperatures.
Temporal fluctuations after a quantum quench: Many-particle dephasing
Marquardt, Florian; Kiendl, Thomas
After a quantum quench, the expectation values of observables continue to fluctuate in time. In the thermodynamic limit, one expects such fluctuations to decrease to zero, in order for standard statistical physics to hold. However, it is a challenge to determine analytically how the fluctuations decay as a function of system size. So far, there have been analytical predictions for integrable models (which are, naturally, somewhat special), analytical bounds for arbitrary systems, and numerical results for moderate-size systems. We have discovered a dynamical regime where the decrease of fluctuations is driven by many-particle dephasing, instead of a redistribution of occupation numbers. On the basis of this insight, we are able to provide exact analytical expressions for a model with weak integrability breaking (transverse Ising chain with additional terms). These predictions explicitly show how fluctuations are exponentially suppressed with system size.
Quantum correlation of high dimensional system in a dephasing environment
Ji, Yinghua; Ke, Qiang; Hu, Juju
2018-05-01
For a high dimensional spin-S system embedded in a dephasing environment, we theoretically analyze the time evolutions of quantum correlation and entanglement via Frobenius norm and negativity. The quantum correlation dynamics can be considered as a function of the decoherence parameters, including the ratio between the system oscillator frequency ω0 and the reservoir cutoff frequency ωc , and the different environment temperature. It is shown that the quantum correlation can not only measure nonclassical correlation of the considered system, but also perform a better robustness against the dissipation. In addition, the decoherence presents the non-Markovian features and the quantum correlation freeze phenomenon. The former is much weaker than that in the sub-Ohmic or Ohmic thermal reservoir environment.
Hole dephasing caused by hole-hole interaction in a multilayered black phosphorus.
Li, Lijun; Khan, Muhammad Atif; Lee, Yoontae; Lee, Inyeal; Yun, Sun Jin; Youn, Doo-Hyeb; Kim, Gil-Ho
2017-11-01
We study the magnetotransport of holes in a multilayered black phosphorus in a temperature range of 1.9 to 21.5 K. We observed a negative magnetoresistance at magnetic fields up to 1.5 T. This negative magetoresistance was analyzed by weak localization theory in diffusive regime. At the lowest temperature and the highest carrier density we found a phase coherence length of 48 nm. The linear temperature dependence of the dephasing rate shows that the hole-hole scattering processes with small energy transfer are the dominant contribution in breaking the carrier phase coherence.
Chmelíčková, Hana
2008-01-01
Title: Balance-related excercise as a preparation to cross-country skiing practice in visually impaired children. Objectives of the Thesis: The goal of this thesis is to test the possibilitiy of implementation of selected balance- related excercise in visually impaired children. Method: The testing pool consisted of six pupils attending the Special school for Visually Impaired Children between 14 and 15 years of age. Over the period of ten weeks, selected exercise geared towards the cross-cou...
Reducing pure dephasing of quantum bits by collective encoding in quantum dot arrays
International Nuclear Information System (INIS)
Grodecka, A; Machnikowski, P; Jacak, L
2006-01-01
We show that phonon-induced pure dephasing of an excitonic (charge) quantum bit in a quantum dot (QD) may be reduced by collective encoding of logical qubits in QD arrays. We define the logical qubit on an array of 2, 4 and 8 QDs, connecting the logical 0) state with the presence of excitons in the appropriately chosen half of dots and the logical 1) state with the other half of the dots occupied. We give quantitative estimates of the resulting total error of a single qubit operation for an InAs/GaAs system
Role of energy exchange in vibrational dephasing processes in liquids and solids
International Nuclear Information System (INIS)
Marks, S.
1981-08-01
Three theories which claim relevance to the dephasing of molecular vibrations in condensed phase matter are presented. All of these theories predict (in certain limiting cases) that the widths and shifts of molecular vibrations will obey an Arrhenius temperature dependence. The basic tenets of the theories are detailed so that the differences between them may be used in an experiment to distinguish between them. One model, based on intermolecular energy exchange of low-frequency modes, results in dephasing the high-frequency modes when anharmonic coupling is present. A computer analysis of temperature dependent experimental lineshapes can result in the extraction of various parameters such as the anharmonic shifts and the exchange rates. It is shown that, in order to properly assess the relative validity of the three models, other evidence must be obtained such as the spectral parameters of the low-frequency modes, the combination bands, and the isotopic dilution behavior. This evidence is presented for d 14 -durene (perdeutero-1,2,4,5-tetramethylbenzene) and compared to previous data obtained on pure h 14 -durene. An extension of the (HSC) intermolecular energy exchange model which allows for the possibility of partial delocalization of the low-frequency modes gives an adequate description of the experimental evidence. Isotopic dilution experiments, in particular, have resulted in a detailed picture of the energy transfer dynamics of the low-frequency modes. A section in which some spontaneous Raman spectra support a model of inhomogeneous broadening in liquids based on results of picosecond stimulated Raman spectroscopy is presented. The model is that a distribution of environmental sites is created by a distribution in the local density and thus creates inhomogeneous broadening
International Nuclear Information System (INIS)
Cosottini, M.; Calabrese, R.; Murri, L.; Puglioli, M.; Zampa, V.; Michelassi, M.C.; Ortori, S.; Bartolozzi, C.
2003-01-01
The aim of this study was to evaluate diagnostic accuracy of contrast-enhanced MRA (CEMRA) compared with digital subtraction angiography (DSA) in studying neck vessels of 48 patients. In three groups of patients, we used three MRA protocols differing for voxel size to assess if intravoxel dephasing effects could modify accuracy of CEMRA. Accuracy and correlation with DSA results were calculated in all patients and separately in the three groups. A qualitative analysis of the likeness between morphology of the stenosis in CEMRA and DSA images was also assessed. In all patients accuracy and agreement with DSA were 96% and k=0.85 in subclavian arteries, 96% and k=0.84 in vertebral artery, 97% and k=0.88 in common carotid arteries, and 94% and k=0.86 in internal carotid arteries. In the three groups accuracy and agreement with DSA did not show any significant difference. Qualitative analysis of CEMRA and DSA images revealed a better agreement in depicting the morphology of stenosis using a smaller voxel size. The CEMRA represents a powerful tool for the non-invasive evaluation of neck vessels. Overestimation trend of CEMRA is confirmed and the reduction of voxel size, decreasing the dephasing intravoxel effect, allows to have a better overlapping of stenosis morphology on CEMRA compared with DSA, but it does not yield diagnostic gain in the stenosis grading. (orig.)
Acoustic phonon dephasing in shallow GaAs/Ga 1- xAl xAs single quantum wells
Cassabois, G.; Meccherini, S.; Roussignol, Ph.; Bogani, F.; Gurioli, M.; Colocci, M.; Planel, R.; Thierry-Mieg, V.
1998-07-01
The intermediate dimensionality regime is studied on a set of shallow GaAs/Ga 1- xAl xAs single quantum wells. Such heterostructures exhibit 2D strong excitonic electroabsorption together with near 3D fast transport properties. We report dephasing time measurements ( T2) of the heavy-hole exciton and we show that the acoustic phonon contribution decreases with x to a value in good agreement with theoretical predictions for GaAs bulk.
Dephasing of LO-phonon-plasmon hybrid modes in n-type GaAs
Vallée, F.; Ganikhanov, F.; Bogani, F.
1997-11-01
The relaxation dynamics of coherent phononlike LO-phonon-plasmon hybrid modes is investigated in n-doped GaAs using an infrared time-resolved coherent anti-Stokes Raman scattering technique. Measurements performed for different crystal temperatures in the range 10-300 K as a function of the electron density injected by doping show a large reduction of the hybrid mode dephasing time compared to the bare LO-phonon one for densities larger than 1016 cm-3. The results are interpreted in terms of coherent decay of the LO-phonon-plasmon mixed mode in the weak-coupling regime and yield information on the plasmon and electron relaxation. The estimated average electron momentum relaxation times are smaller than those deduced from Hall mobility measurements, as expected from our theoretical model.
General solution to inhomogeneous dephasing and smooth pulse dynamical decoupling
Zeng, Junkai; Deng, Xiu-Hao; Russo, Antonio; Barnes, Edwin
2018-03-01
In order to achieve the high-fidelity quantum control needed for a broad range of quantum information technologies, reducing the effects of noise and system inhomogeneities is an essential task. It is well known that a system can be decoupled from noise or made insensitive to inhomogeneous dephasing dynamically by using carefully designed pulse sequences based on square or delta-function waveforms such as Hahn spin echo or CPMG. However, such ideal pulses are often challenging to implement experimentally with high fidelity. Here, we uncover a new geometrical framework for visualizing all possible driving fields, which enables one to generate an unlimited number of smooth, experimentally feasible pulses that perform dynamical decoupling or dynamically corrected gates to arbitrarily high order. We demonstrate that this scheme can significantly enhance the fidelity of single-qubit operations in the presence of noise and when realistic limitations on pulse rise times and amplitudes are taken into account.
Dynamics of electronic dephasing in the Fenna-Matthews-Olson complex
International Nuclear Information System (INIS)
Hayes, Dugan; Panitchayangkoon, Gitt; Fransted, Kelly A; Caram, Justin R; Freed, Karl F; Engel, Gregory S; Wen Jianzhong
2010-01-01
Electronic coherence has been shown to persist in the Fenna-Matthews-Olson (FMO) antenna complex from green sulfur bacteria at 77 K for at least 660 fs, several times longer than the typical lifetime of a coherence in a dynamic environment at this temperature. Such long-lived coherence was proposed to improve energy transfer efficiency in photosynthetic systems by allowing an excitation to follow a quantum random walk as it approaches the reaction centre. Here we present a model for bath-induced electronic transitions, demonstrating that the protein matrix protects coherences by globally correlating fluctuations in transition energies. We also quantify the dephasing rates for two particular electronic coherences in the FMO complex at 77 K using two-dimensional Fourier transform electronic spectroscopy and find that the lifetimes of individual coherences are distinct. Within the framework of noise-assisted transport, this result suggests that the FMO complex has been locally tuned by natural selection to optimize transfer efficiency by exploiting quantum coherence.
Directory of Open Access Journals (Sweden)
Nilanjan Chakraborty
2011-01-01
nature of the correlations remains unaffected. The dependence of displacement speed on strain rate and curvature is found to weaken with increasing turbulent Reynolds number when either Damköhler or Karlovitz number is held constant, but the qualitative nature of the correlation remains unaltered. The implications of turbulent Reynolds number effects in the context of Flame Surface Density (FSD modelling have also been addressed, with emphasis on the influence of displacement speed on the curvature and propagation terms in the FSD balance equation.
Denega, S.Z.; Last, Thorsten; Liu, J.; Slachter, A.; Rizo, P.J.; Loosdrecht, P.H.M. van; Wees, B.J. van; Reuter, D.; Wieck, A.D.; Wal, C.H. van der
2010-01-01
We report a study of suppressed spin dephasing for quasi-one-dimensional electron ensembles in wires etched into a GaAs/AlGaAs heterojunction system. Time-resolved Kerr-rotation measurements show a suppression that is most pronounced for wires along the [110] crystal direction. This is the
Santiago-Rivas, Marimer; Velicer, Wayne F; Redding, Colleen
2015-01-01
Mediation analyses of sun protection were conducted testing structural equation models using longitudinal data with three waves. An effect was said to be mediated if the standardised path between processes of change, decisional balance and sun protection outcomes was significant. Longitudinal models of sun protection using data from individuals in the precontemplation (N = 964) and preparation (N = 463) stages who participated of an expert system intervention. Nine processes of change for sun protection, decisional balance constructs of sun protection (pros and cons), sun avoidance behaviour and sunscreen use. With the exception of two processes in the preparation stage, processes of change predicted the pros (r = .126-.614), and the pros predicted the outcomes (r = .181-.272). Three models with the cons as mediator in the preparation stage, and none in the precontemplation stage, showed a mediated relationship between processes and outcomes. In general, mediation analyses found both the process of change-to-pros and pros-to-behaviour paths significant for both precontemplation and preparation stages, and for both sun avoidance and sunscreen use outcomes. Findings provide support for the importance of assessing the role of underlying risk cognitions in improving sun protection adherence.
International Nuclear Information System (INIS)
Kuz'min, E.S.; Balagurov, A.M.; Bokuchava, G.D.; Zhuk, V.V.; Kudryashev, V.A.; Bulkin, A.P.; Trunov, V.A.
2001-01-01
At the IBR-2 pulsed reactor (FLNP, JINR, Dubna), a specialized time-of-flight instrument Fourier-Stress-Diffractometer (FSD) intended for the measurement of internal stresses in bulk samples by using high-resolution neutron diffraction is under construction. One of the main components of the diffractometer is a new-type detector with combined electronic - geometrical focusing uniting a large solid angle and a small geometry contribution to the instrumental resolution. The first two modules of the detector, based on scintillation screen ZnS(Ag)/ 6 LiF with wavelength shifting fibers readout have been developed and tested. The design of the detector and associated electronics are described. The method of time focusing surface approximation, using the screen flexibility is proposed. Characteristics of the tested modules in comparison with a detector of the previous generation are presented and advantages of the new detector design for high-resolution diffractometry are discussed
International Nuclear Information System (INIS)
Marks, S.; Cornelius, P.A.; Harris, C.B.
1980-01-01
A series of experiments have been conducted in order to evaluate the relative importance of several recent theories of vibrational dephasing in solids. The theories are discussed briefly, and are used to interpret the temperature dependence of the C--H and C--D stretch bands in the spontaneous Raman spectra of h 14 - and d 14 -1,2,4,5-tetramethyl benzene (durene). The infrared spectra of these same molecules are also reported in the region of the combination bands involving C--H (or C--D) stretches and low-frequency modes. The results support the applicability of the model of Harris et al., [C. B. Harris, R. M. Shelby and P. A. Cornelius, Phys. Rev. Lett. 38, 1415 (1977); Chem Phys. Lett. 57, 8 (1978); R. M. Shelby, C. B. Harris, and P. A. Cornelius, J. Chem. Phys. 70, 34 (1979)], based on energy exchange in anharmonically coupled low-frequency modes. This theory is then used, in connection with Raman spectra obtained in isotopically mixed samples of durene, to elucidate the vibrational dynamics underlying the dephasing. It is found that the results are consistent with the hypothesis that some low-frequency modes in this molecule are significantly delocalized or ''excitonic'' in character, and that this delocalization may be studied by means of Raman spectroscopy on the low-frequency modes themselves, as well as by exchange analysis of the coupled high-frequency modes. These conclusions represent a generalization and extension of the previously published exchange model [R. M. Shelby, C. B. Harris, and P. A. Cornelius, J. Chem Phys. 70, 34 (1979)
Roy, Chiranjeeb; John, Sajeev
2010-02-01
We derive a quantum theory of the role of acoustic and optical phonons in modifying the optical absorption line shape, polarization dynamics, and population dynamics of a two-level atom (quantum dot) in the “colored” electromagnetic vacuum of a photonic band-gap (PBG) material. This is based on a microscopic Hamiltonian describing both radiative and vibrational processes quantum mechanically. We elucidate the extent to which phonon-assisted decay limits the lifetime of a single photon-atom bound state and derive the modified spontaneous emission dynamics due to coupling to various phonon baths. We demonstrate that coherent interaction with undamped phonons can lead to an enhanced lifetime of a photon-atom bound state in a PBG. This results in reduction of the steady-state atomic polarization but an increase in the fractionalized upper state population in the photon-atom bound state. We demonstrate, on the other hand, that the lifetime of the photon-atom bound state in a PBG is limited by the lifetime of phonons due to lattice anharmonicities (breakup of phonons into lower energy phonons) and purely nonradiative decay. We also derive the modified polarization decay and dephasing rates in the presence of such damping. This leads to a microscopic, quantum theory of the optical absorption line shapes. Our model and formalism provide a starting point for describing dephasing and relaxation in the presence of external coherent fields and multiple quantum dot interactions in electromagnetic reservoirs with radiative memory effects.
International Nuclear Information System (INIS)
Roy, Chiranjeeb; John, Sajeev
2010-01-01
We derive a quantum theory of the role of acoustic and optical phonons in modifying the optical absorption line shape, polarization dynamics, and population dynamics of a two-level atom (quantum dot) in the ''colored'' electromagnetic vacuum of a photonic band-gap (PBG) material. This is based on a microscopic Hamiltonian describing both radiative and vibrational processes quantum mechanically. We elucidate the extent to which phonon-assisted decay limits the lifetime of a single photon-atom bound state and derive the modified spontaneous emission dynamics due to coupling to various phonon baths. We demonstrate that coherent interaction with undamped phonons can lead to an enhanced lifetime of a photon-atom bound state in a PBG. This results in reduction of the steady-state atomic polarization but an increase in the fractionalized upper state population in the photon-atom bound state. We demonstrate, on the other hand, that the lifetime of the photon-atom bound state in a PBG is limited by the lifetime of phonons due to lattice anharmonicities (breakup of phonons into lower energy phonons) and purely nonradiative decay. We also derive the modified polarization decay and dephasing rates in the presence of such damping. This leads to a microscopic, quantum theory of the optical absorption line shapes. Our model and formalism provide a starting point for describing dephasing and relaxation in the presence of external coherent fields and multiple quantum dot interactions in electromagnetic reservoirs with radiative memory effects.
Dephasing due to Nuclear Spins in Large-Amplitude Electric Dipole Spin Resonance.
Chesi, Stefano; Yang, Li-Ping; Loss, Daniel
2016-02-12
We analyze effects of the hyperfine interaction on electric dipole spin resonance when the amplitude of the quantum-dot motion becomes comparable or larger than the quantum dot's size. Away from the well-known small-drive regime, the important role played by transverse nuclear fluctuations leads to a Gaussian decay with characteristic dependence on drive strength and detuning. A characterization of spin-flip gate fidelity, in the presence of such additional drive-dependent dephasing, shows that vanishingly small errors can still be achieved at sufficiently large amplitudes. Based on our theory, we analyze recent electric dipole spin resonance experiments relying on spin-orbit interactions or the slanting field of a micromagnet. We find that such experiments are already in a regime with significant effects of transverse nuclear fluctuations and the form of decay of the Rabi oscillations can be reproduced well by our theory.
Factors associated with sexual dysfunction in Jordanian women and their sexual attitudes
International Nuclear Information System (INIS)
Ali, Ruba M. Abu; AlHajeri Rabaa M; Khader, Yousef S; Ajlouni, Kamel M
2009-01-01
Female sexual dysfunction (FSD) is defined as disorders of libido, arousal, and orgasm, as well as sexual pain, that leads to personal distress or interpersonal difficulties. Social aspects of FSD have been understudied. The aim of this study was to explore the social aspects of FSD and sexual attitudes of Jordanian women. Six hundred thirteen married females were studied between October 2006 and August 2007 at the National Center for Diabetes, Endocrinology and Genetics (NCDEG), Amman, Jordan. Females were interviewed using a special questionnaire that was suitable to our culture and added to the Arabic translation of the Female Sexual Function Index (FSFI) Questionnaire. Older age was associated with a decreased total FSD index and its domain scores. Women with obesity were more likely to have impaired arousability and impaired capability of reaching orgasm. About 58.5% of women reported that they prepared themselves if they had sexual desire and 68.2% reported wearing special attire for this purpose. Only 37.2% of women could ask their husband for a special excitement. FSD is prevalent in Jordan. Its social aspects are understudied and need more research in the future. (author)
International Nuclear Information System (INIS)
Topf, C.; Sempere Belda, L.
2017-01-01
As a consequence of the nuclear phase-out decreed by the German government, several nuclear power plants in the country have already ceased operation. The remaining ones will cease operation by 2022. This has turned Germany into one of the most active regions worldwide in the field of nuclear decommissioning, with new and emerging technologies being deployed on the field, and already preexisting technologies being put to the test, optimized and developed into full maturity. The chemistry services division of AREVA GmbH has already performed 5 Full System Decontaminations (FSD) in preparation for decommissioning in this period - three in PWRs and two in BWRs - along with other international projects of relevance for decommissioning operations. During a FSD, the complete primary circuit of a nuclear power plant including auxiliary systems is subject to a chemical treatment; designed to remove radioactive matter accumulated onto system surfaces during operation. Through the effective removal of this radioactive accumulations contact dose rates on the different components of the primary circuit can be consistently reduced by factors larger than 50. This results in much lower ambient dose rates and, hence, in very significant dose savings for subsequent decommissioning activities. Additionally, dismantlement operations of large components are considerably simplified and can be performed under conditions that wouldn't have been possible before. The project specific objectives and challenges, the technologies employed, and the results obtained are presented and commented here. (authors)
Energy Technology Data Exchange (ETDEWEB)
Schnöller, Johannes, E-mail: johannes.schnoeller@chello.at; Aschenbrenner, Philipp; Hahn, Manuel; Fellner, Johann; Rechberger, Helmut
2014-11-15
Highlights: • An alternative sample comminution procedure for SRF is tested. • Proof of principle is shown on a SRF model mixture. • The biogenic content of the SRF is analyzed with the adapted balance method. • The novel method combines combustion analysis and a data reconciliation algorithm. • Factors for the variance of the analysis results are statistically quantified. - Abstract: The biogenic fraction of a simple solid recovered fuel (SRF) mixture (80 wt% printer paper/20 wt% high density polyethylene) is analyzed with the in-house developed adapted balance method (aBM). This fairly new approach is a combination of combustion elemental analysis (CHNS) and a data reconciliation algorithm based on successive linearisation for evaluation of the analysis results. This method shows a great potential as an alternative way to determine the biomass content in SRF. However, the employed analytical technique (CHNS elemental analysis) restricts the probed sample mass to low amounts in the range of a few hundred milligrams. This requires sample comminution to small grain sizes (<200 μm) to generate representative SRF specimen. This is not easily accomplished for certain material mixtures (e.g. SRF with rubber content) by conventional means of sample size reduction. This paper presents a proof of principle investigation of the sample preparation and analysis of an SRF model mixture with the use of cryogenic impact milling (final sample comminution) and the adapted balance method (determination of biomass content). The so derived sample preparation methodology (cutting mills and cryogenic impact milling) shows a better performance in accuracy and precision for the determination of the biomass content than one solely based on cutting mills. The results for the determination of the biogenic fraction are within 1–5% of the data obtained by the reference methods, selective dissolution method (SDM) and {sup 14}C-method ({sup 14}C-M)
Binding energy and dephasing of biexcitons in In0.18Ga0.82As/GaAs single quantum wells
DEFF Research Database (Denmark)
Borri, Paola; Langbein, Wolfgang Werner; Hvam, Jørn Märcher
1999-01-01
Biexciton binding energies and biexciton dephasing in In0.18Ga0.82As/GaAs single quantum wells have been measured by time-integrated and spectrally resolved four-wave mixing. The biexciton binding energy increases from 1.5 to 2.6 meV for well widths increasing from 1 to 4 nm. The ratio between...... exciton and biexciton binding energy changes from 0.23 to 0.3 with increasing inhomogeneous broadening, corresponding to increasing well width. From the temperature dependence of the exciton and biexciton four-wave mixing signal decay, we have deduced the acoustic-phonon scattering of the exciton...
International Nuclear Information System (INIS)
Zhao, B.; Jerkiewicz, G.
2006-01-01
Uniform and crack-free passive layers on Ti are prepared using AC voltage in 7.5 wt.% aq. NH 4 ·BF 4 at 25 o C. The passive layers possess coloration (wide spectrum of colors) that depends on the experimental conditions. The biocompatibility of such prepared passive layers is evaluated using corrosion science and analytical techniques. Their corrosion behavior, Ti-ion release, surface roughness, and wettability in Hank's Balanced Salt Solution (HBSS) at 37 o C are the main focus of this work. Open-circuit potential and polarization measurements demonstrate that the corrosion potential (E corr ) of the passive layers becomes more positive than that of the untreated Ti. The value of E corr increases as we increase the AC voltage (VAC). Their corrosion rate (CR) is lower than that of the untreated Ti, and they reduced the Ti-ion release level from 230 to 15 ppb. An increase in the AC voltage frequency (f) leads to a slightly higher level of the Ti-ion release (∼50 ppb). Surface profilometry, optical microscopy, and scanning electron microscopy (SEM) analyses show that prolonged exposure of the passive layers to HBSS results in changes to their surface topography. The passive layers prepared by the application of AC voltage are rougher and more hydrophilic than the untreated Ti. Our methodology of preparing biocompatible passive layers on Ti might be applied as a new surface treatment procedure for Ti implants. (author)
Shamim, Saquib; Mahapatra, S; Scappucci, G; Klesse, W M; Simmons, M Y; Ghosh, Arindam
2017-05-04
We report quantum transport measurements on two dimensional (2D) Si:P and Ge:P δ-layers and compare the inelastic scattering rates relevant for weak localization (WL) and universal conductance fluctuations (UCF) for devices of various doping densities (0.3-2.5 × 10 18 m -2 ) at low temperatures (0.3-4.2 K). The phase breaking rate extracted experimentally from measurements of WL correction to conductivity and UCF agree well with each other within the entire temperature range. This establishes that WL and UCF, being the outcome of quantum interference phenomena, are governed by the same dephasing rate.
DEFF Research Database (Denmark)
Borri, Paola; Langbein, Wolfgang; Mørk, Jesper
1999-01-01
We demonstrate a new detection scheme for pump-probe and four-wave mixing heterodyne experiments, using balanced detection and a dual-phase lock-in for spectral filtering. The technique allows the use of low repetition-rate laser systems, as is demonstrated on an InGaAsP/InP bulk optical amplifier...... at 1.53 mym. Ultrafast pump-induced changes in the amplitude and phase of the transmitted probe signal are simultaneously measured, going from small to large signal changes and with no need of an absolute phase calibration, showing the versatility and the sensitivity of this detection scheme....... The results for small perturbations are consistent with previous pump-probe experiments reported in literature. Time-resolved four-wave mixing in the absorption regime of the device is measured, and compared with numerical simulations, indicating a 100 fs dephasing time....
Orbital hyperfine interaction and qubit dephasing in carbon nanotube quantum dots
Palyi, Andras; Csiszar, Gabor
2015-03-01
Hyperfine interaction (HF) is of key importance for the functionality of solid-state quantum information processing, as it affects qubit coherence and enables nuclear-spin quantum memories. In this work, we complete the theory of the basic hyperfine interaction mechanisms (Fermi contact, dipolar, orbital) in carbon nanotube quantum dots by providing a theoretical description of the orbital HF. We find that orbital HF induces an interaction between the nuclear spins of the nanotube lattice and the valley degree of freedom of the electrons confined in the quantum dot. We show that the resulting nuclear-spin-electron-valley interaction (i) is approximately of Ising type, (ii) is essentially local, in the sense that an effective atomic interaction strength can be defined, and (iii) has a strength that is comparable to the combined strength of Fermi contact and dipolar interactions. We argue that orbital HF provides a new decoherence mechanism for single-electron valley qubits and spin-valley qubits in a range of multi-valley materials. We explicitly evaluate the corresponding inhomogeneous dephasing time T2* for a nanotube-based valley qubit. We acknowledge funding from the EU Marie Curie CIG-293834, OTKA Grant PD 100373, and EU ERC Starting Grant CooPairEnt 258789. AP is supported by the Janos Bolyai Scholarship of the Hungarian Academy of Sciences.
Beer as colon lavage preparation
International Nuclear Information System (INIS)
Kinnunen, J.; Linden, H.; Pietilae, J.; Juutilainen, T.
1987-01-01
Six patients received beer preparation prior to double contrast barium enema. The beer group scored slightly better (though not statistically significantly) both in the cleanliness and in the mucosal coating of the bowel than the control group with standard preparation. The fluid balance was unaltered. The patients in the beer group felt surprisingly well, likely due to the good fluid and energy balance provided by the beer. The beer preparation could be used in cases, when the patients are ready to intake beer and want to maintain a good nutritional status. (orig.) [de
Coherence properties and quantum state transportation in an optical conveyor belt.
Kuhr, S; Alt, W; Schrader, D; Dotsenko, I; Miroshnychenko, Y; Rosenfeld, W; Khudaverdyan, M; Gomer, V; Rauschenbeutel, A; Meschede, D
2003-11-21
We have prepared and detected quantum coherences of trapped cesium atoms with long dephasing times. Controlled transport by an "optical conveyor belt" over macroscopic distances preserves the atomic coherence with slight reduction of coherence time. The limiting dephasing effects are experimentally identified, and we present an analytical model of the reversible and irreversible dephasing mechanisms. Our experimental methods are applicable at the single-atom level. Coherent quantum bit operations along with quantum state transport open the route towards a "quantum shift register" of individual neutral atoms.
On the origins of the weak folding cooperativity of a designed ββα ultrafast protein FSD-1.
Wu, Chun; Shea, Joan-Emma
2010-11-18
FSD-1, a designed small ultrafast folder with a ββα fold, has been actively studied in the last few years as a model system for studying protein folding mechanisms and for testing of the accuracy of computational models. The suitability of this protein to describe the folding of naturally occurring α/β proteins has recently been challenged based on the observation that the melting transition is very broad, with ill-resolved baselines. Using molecular dynamics simulations with the AMBER protein force field (ff96) coupled with the implicit solvent model (IGB = 5), we shed new light into the nature of this transition and resolve the experimental controversies. We show that the melting transition corresponds to the melting of the protein as a whole, and not solely to the helix-coil transition. The breadth of the folding transition arises from the spread in the melting temperatures (from ∼325 K to ∼302 K) of the individual transitions: formation of the hydrophobic core, β-hairpin and tertiary fold, with the helix formed earlier. Our simulations initiated from an extended chain accurately predict the native structure, provide a reasonable estimate of the transition barrier height, and explicitly demonstrate the existence of multiple pathways and multiple transition states for folding. Our exhaustive sampling enables us to assess the quality of the Amber ff96/igb5 combination and reveals that while this force field can predict the correct native fold, it nonetheless overstabilizes the α-helix portion of the protein (Tm = ∼387K) as well as the denatured structures.
Chemical decontamination for decommissioning - the Jose Cabrera (Zorita) NPP
International Nuclear Information System (INIS)
Madrid Garcia, F.; Holgado, A.; Pomar, C.; Gammon, Th.; Bradbury, D.
2008-01-01
The Jose Cabrera (Zorita) NPP is located in the Guadalajara province of Spain approximately 66 km northeast of Madrid. It is a single loop Westinghouse Pressurized Water Reactor (PWR) design cooled by the waters of the River Tajo. The plant was synchronized to the grid in 1968 and was permanently shutdown on April 30, 2006. UNION FENOSA Generacion has been the owner and operator of the plant and will hand over decommissioning activities to Empresa Nacional de Residuous Radiactivos, S.A. (ENRESA) in approximately two years. During the fall and winter of 2006, Westinghouse Electric Company performed a Full System Decontamination (FSD) in preparation for decommissioning activities. The FSD was performed on the Reactor Coolant System (RCS) including the Residual Heat Removal System (RHRS) and the Chemical Volume and Control System (CVCS). The FSD was performed to facilitate decommissioning activities by reducing general area dose rates and lowering contamination levels to reduce disposal costs. (authors)
On the origins of the weak folding cooperativity of a designed ββα ultrafast protein FSD-1.
Directory of Open Access Journals (Sweden)
Chun Wu
Full Text Available FSD-1, a designed small ultrafast folder with a ββα fold, has been actively studied in the last few years as a model system for studying protein folding mechanisms and for testing of the accuracy of computational models. The suitability of this protein to describe the folding of naturally occurring α/β proteins has recently been challenged based on the observation that the melting transition is very broad, with ill-resolved baselines. Using molecular dynamics simulations with the AMBER protein force field (ff96 coupled with the implicit solvent model (IGB = 5, we shed new light into the nature of this transition and resolve the experimental controversies. We show that the melting transition corresponds to the melting of the protein as a whole, and not solely to the helix-coil transition. The breadth of the folding transition arises from the spread in the melting temperatures (from ∼325 K to ∼302 K of the individual transitions: formation of the hydrophobic core, β-hairpin and tertiary fold, with the helix formed earlier. Our simulations initiated from an extended chain accurately predict the native structure, provide a reasonable estimate of the transition barrier height, and explicitly demonstrate the existence of multiple pathways and multiple transition states for folding. Our exhaustive sampling enables us to assess the quality of the Amber ff96/igb5 combination and reveals that while this force field can predict the correct native fold, it nonetheless overstabilizes the α-helix portion of the protein (Tm = ∼387K as well as the denatured structures.
Lawless, Mary K.; Mathies, Richard A.
1992-06-01
Absolute resonance Raman cross sections are measured for Nile blue 690 perchlorate dissolved in ethylene glycol with excitation at 514, 531, and 568 nm. These values and the absorption spectrum are modeled using a time-dependent wave packet formalism. The excited-state equilibrium geometry changes are quantitated for 40 resonance Raman active modes, seven of which (590, 1141, 1351, 1429, 1492, 1544, and 1640 cm-1 ) carry 70% of the total resonance Raman intensity. This demonstrates that in addition to the prominent 590 and 1640 cm-1 modes, a large number of vibrational degrees of freedom are Franck-Condon coupled to the electronic transition. After exposure of the explicit vibrational progressions, the residual absorption linewidth is separated into its homogeneous [350 cm-1 half-width at half-maximum (HWHM)] and inhomogeneous (313 cm-1 HWHM) components through an analysis of the absolute Raman cross sections. The value of the electronic dephasing time derived from this study (25 fs) compares well to previously published results. These data should be valuable in multimode modeling of femtosecond experiments on Nile blue.
Novel diyne-bridged dyes for efficient dye-sensitized solar cells
Energy Technology Data Exchange (ETDEWEB)
Fang, Jing-Kun, E-mail: fjk@njust.edu.cn [Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Xiaolingwei Street No. 200, Nanjing, 210094 (China); Sun, Tengxiao [Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Xiaolingwei Street No. 200, Nanjing, 210094 (China); Tian, Yi [Advanced Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, 980-8577 (Japan); Zhang, Yingjun, E-mail: ZhangYingjun@hec.cn [HEC Pharm Group, HEC R& D Center, Dongguan, 523871 (China); Jin, Chuanfei [HEC Pharm Group, HEC R& D Center, Dongguan, 523871 (China); Xu, Zhimin; Fang, Yu; Hu, Xiangyu; Wang, Haobin [Department of Chemistry, School of Chemical Engineering, Nanjing University of Science and Technology, Xiaolingwei Street No. 200, Nanjing, 210094 (China)
2017-07-01
Three new metal free organic dyes (FSD101-103) were synthesized to investigate the influence of diyne unit on dye molecules. FSD101 and FSD102 with diyne unit and FSD103 with monoyne unit were applied as sensitizers in the dye-sensitized solar cells (DSSCs). The optical and electrochemical properties, theoretical studies, and photovoltaic parameters of DSSCs sensitized by these dyes were systematically investigated. By replacing the monoyne unit with a diyne unit, FSD101 exhibited broader absorption spectrum, lower IP, higher EA, lower band gap energy, higher oscillator strength, more efficient electron injection ability, broader IPCE response range and higher τ{sub e} in comparison with FSD103. Hence, DSSC sensitized by FSD101 showed higher J{sub sc} and V{sub oc} values, and demonstrated a power conversion efficiency of 3.12%, about 2-fold as that of FSD103 (1.55%). FSD102 showed similar results as FSD101, with a power conversion efficiency of 2.98%, despite a stronger electron withdraw cyanoacrylic acid group was introduced. This may be due to the lower efficiency of the electron injection from dye to TiO{sub 2} and lower τ{sub e} of FSD102 than that of FSD101. These results indicate that the performance of DSSCs can be significantly improved by introducing a diyne unit into this type of organic dyes. - Highlights: • Diyne-bridge was introduced into dye molecules by a transition-metal-free protocol. • Power conversion efficiency grows from 1.55% to 3.12% by replacing monoyne unit with diyne unit. • FSD101 with diyne unit shows the highest electron lifetime resulting in a higher V{sub oc}.
McKenna, Thomas; Macgill, Alice; Porat, Gail; Friedenberg, Frank K
2012-12-01
Four liters of polyethylene glycol 3350 (PEG) with balanced electrolytes for colonoscopy preparation has had poor acceptance. Another approach is the use of electrolyte-free PEG combined with 1.9 L of Gatorade. Despite its widespread use, there are no data on metabolic safety and minimal data on efficacy. Our aim was to assess the efficacy and electrolyte safety of these two PEG-based preparations. This was a prospective, randomized, single-blind, non-inferiority trial. Patients were randomized to 238 g PEG + 1.9 L Gatorade or 4 L of PEG-ELS containing 236 g PEG. Split dosing was not performed. On procedure day blood was drawn for basic chemistries. The primary outcome was preparation quality from procedure photos using the Boston Bowel Preparation Scale. We randomized 136 patients (66 PEG + Gatorade, 70 PEG-ELS). There were no differences in preparation scores between the two agents in the ITT analysis (7.2 ± 1.9 for PEG-ELS and 7.0 ± 2.1 for PEG + Gatorade; p = 0.45). BBPS scores were identical for those who completed the preparation and dietary instructions as directed (7.4 ± 1.7 for PEG-ELS, and 7.4 ± 1.8 for PEG + Gatorade; p = 0.98). There were no statistical differences in serum electrolytes between the two preparations. Patients who received PEG + Gatorade gave higher overall satisfaction scores for the preparation experience (p = 0.001), and had fewer adverse effects. Use of 238 g PEG + 1.9 L Gatorade appears to be safe, better tolerated, and non-inferior to 4 L PEG-ELS. This preparation may be especially useful for patients who previously tolerated PEG-ELS poorly.
Implementation of multi-regional energy balances for Slovenia
International Nuclear Information System (INIS)
Suvorov, B.; Schechtner, O.; Zelle, K.; Andjelic, M.W.
1994-01-01
The system used for preparing energy balances for Styria and 17 Styrian districts, which was developed by ADIP-GRAZ in accordance with the federal energy balance of Austria, is being applied to Slovenia. Energy balances are a necessary tool for monitoring the impact of measures initiated by the energy policy. Therefore balances are of a basic mutual interest, also in connection with balances of air pollutants that can be calculated from energy balances. The official Slovenian energy balance for the year 1990 is the basis for implementation of regional balances for five chosen regions (Maribor region, Celje region, Ljubljana region, Littoral region, and Upper-Slovenia region). Results are presented according to defined concepts and structures which are closely related to the MEDEE-RS methodology. (Author)
McKenna, Thomas; Macgill, Alice; Porat, Gail; Friedenberg, Frank K.
2013-01-01
Background Four liters of polyethylene glycol 3350 with balanced electrolytes for colonoscopy preparation has had poor acceptance. Another approach is the use of electrolyte-free PEG combined with 1.9L of Gatorade. Despite its widespread use, there are no data on metabolic safety and minimal data on efficacy. Our aim was to assess the efficacy and electrolyte safety of these two PEG-based preparations. Methods This was a prospective, randomized, single-blind, non-inferiority trial. Patients were randomized to 238g PEG + 1.9L Gatorade or 4L of PEG-ELS containing 236g PEG. Split dosing was not performed. On procedure day blood was drawn for basic chemistries. The primary outcome was preparation quality from procedure photos using the Boston Bowel Preparation Scale. Results We randomized 136 patients (66 PEG + Gatorade, 70 PEG-ELS). There were no differences in preparation scores between the two agents in the ITT analysis (7.2 ± 1.9 for PEG-ELS and 7.0 ± 2.1 for PEG + Gatorade; p = 0.45). BBPS scores were identical for those who completed the preparation and dietary instructions as directed (7.4 ± 1.7 for PEG-ELS, and 7.4 ± 1.8 for PEG + Gatorade; p = 0.98). There were no statistical differences in serum electrolytes between the two preparations. Patients who received PEG + Gatorade gave higher overall satisfaction scores for the preparation experience (p = 0.001), and had fewer adverse effects. Conclusions Use of 238g PEG + 1.9L Gatorade appears to be safe, better tolerated, and non-inferior to 4L PEG-ELS. This preparation may be especially useful for patients who previously tolerated PEG-ELS poorly. PMID:22711499
Spin dynamics in bulk CdTe at room temperature
International Nuclear Information System (INIS)
Nahalkova, P.; Nemec, P.; Sprinzl, D.; Belas, E.; Horodysky, P.; Franc, J.; Hlidek, P.; Maly, P.
2006-01-01
In this paper, we report on the room temperature dynamics of spin-polarized carriers in undoped bulk CdTe. Platelets of CdTe with different concentration of preparation-induced dislocations were prepared by combining the mechanical polishing and chemical etching. Using the polarization-resolved pump-probe experiment in transmission geometry, we have observed a systematic decrease of both the signal polarization and the electron spin dephasing time (from 52 to 36 ps) with the increased concentration of defects. We have suggested that the Elliot-Yafet mechanism might be the dominant spin dephasing mechanism in platelets of CdTe at room temperature
Quantum feedback for rapid state preparation in the presence of control imperfections
International Nuclear Information System (INIS)
Combes, Joshua; Wiseman, Howard M
2011-01-01
Quantum feedback control protocols can improve the operation of quantum devices. Here we examine the performance of a purification protocol when there are imperfections in the controls. The ideal feedback protocol produces an x-eigenstate from a mixed state in the minimum time, and is known as rapid state preparation. The imperfections we examine include time delays in the feedback loop, finite strength feedback, calibration errors and inefficient detection. We analyse these imperfections using the Wiseman-Milburn feedback master equation and related formalism. We find that the protocol is most sensitive to time delays in the feedback loop. For systems with slow dynamics, however, our analysis suggests that inefficient detection would be the bigger problem. We also show how system imperfections, such as dephasing and damping, can be included in a model via the feedback master equation.
Chen, Su; Palmer, James F; Zhang, Wei; Shao, Jing; Li, Si; Fan, Liu-Yin; Sun, Ren; Dong, Yu-Chao; Cao, Cheng-Xi
2009-06-01
This paper describes a novel free-flow electrophoresis (FFE), which is joined with gratis gravity, gas cushion injector (GCI) and self-balance collector instead of multiple channel pump, for the purpose of preparative purification. The FFE was evaluated by systemic experiments. The results manifest that (i) even though one-channel peristaltic pump is used for the driving of background buffer, there is still stable flow in the FFE chamber; (ii) the stable flow is induced by the gravity-induced pressure due to the difference of buffer surfaces in the GCI and self-balance collector; (iii) the pulse flow of background buffer induced by the peristaltic pump is greatly reduced by the GCI with good compressibility of included air; (iv) the FFE can be well used for zone electrophoretic separation of amino acids; (v) up to 20 inlets simultaneous sample injection and up to five to tenfold condensation of amino acid can be achieved by combining the FFE device with the method of moving reaction boundary. To the best of authors' knowledge, FFE has not been used for such separation and condensation of amino acids. The relevant results achieved in the paper have evident significance for the development of preparative FFE.
Guide Manual for Preparation of Water Balances
1980-11-01
boundaries for the AGUA study (39). This figure was developed from a LANDSAT photograph of the Albuquerque, New Mexico area. It clearly shows the boundaries of...Guide to Water-Management Alternatives. USGS Professional Paper 627-F. 12. Gilbert, J. B. and Associates, 1977. Report on Water Conservation Reuse and...Report on Water Conservation Reuse and Supply, San Francisco Bay Region, prepared by J. B. Gilbert and Associates, 1978. (12) Purposes of this study
Mazaro-Costa, Renata; Andersen, Monica L; Hachul, Helena; Tufik, Sergio
2010-11-01
Female sexual dysfunction (FSD) is a complex and multifactorial condition. An increased incidence of FSD is especially associated with the decline of estrogen. Thus, menopause is a critical phase for FSD complaints. In this context, medicinal plants may be a therapeutic option. To identify and describe the popular and clinical uses of medicinal plants for FSD treatment in climacteric women. We highlighted the majority of the plants commonly involved with the female reproductive system including: Angelica sinensis, Cimicifuga racemosa, Ferula hermonis, Ginkgo biloba, Humulus lupulus, Lepidium meyenii, Tribulus terrestris, Trifolium pratense, and Vitex agnus-castus. This study is a narrative review of studies of plants that are possible alternative treatments for FSD. The species described have clinical and popular uses in different cultures as well as medical indications for female reproductive disturbances, mainly in climacteric women. We have also analyzed the evidence level of clinical studies. The main outcome assessed is the efficacy of plants in improving the symptoms of FSD. There is little evidence from the literature to recommend the use of medicinal plants when treating FSD. The majority of studies with a strong level of evidence are associated with the treatment of the vasomotor symptoms of menopause. Ferula hermonis, Angelica sinensis, and Gingko biloba may be suggested for arousal disorder studies. Cimicifuga racemosa, Trifolium pratense, and Vitex agnus-castus may be recommended for several FSD. Humulus lupulus and Tribulus terrestris may help with desire disorder studies. Lepidium meyenii should be studied further. Studies of these plants indicate that they may be useful as a possible alternative and/or complementary approach for studies aimed at the treatment of FSD. At this time, however, this review cannot recommend a plant that has a strong enough level of evidence for treatment of FSD. Thus, there is a need for clinical (double-blinded and
2015-09-30
ITD theory of Thorndike et al. (1975) in order to explicitly simulate the evolution of FSD and ITD jointly. The FSD theory includes a FSD function and...et al., 2015). 4 RESULTS Modeling: A FSD theory is developed and coupled to the ITD theory of Thorndike et al. (1975) in order to... Thorndike , A.S., D.A. Rothrock, G.A. Maykut, and R. Colony (1975), The thickness distribution of sea ice. J. Geophys. Res., 80, 4501–4513. Zhang
Equivalence principle for quantum systems: dephasing and phase shift of free-falling particles
Anastopoulos, C.; Hu, B. L.
2018-02-01
We ask the question of how the (weak) equivalence principle established in classical gravitational physics should be reformulated and interpreted for massive quantum objects that may also have internal degrees of freedom (dof). This inquiry is necessary because even elementary concepts like a classical trajectory are not well defined in quantum physics—trajectories originating from quantum histories become viable entities only under stringent decoherence conditions. From this investigation we posit two logically and operationally distinct statements of the equivalence principle for quantum systems. Version A: the probability distribution of position for a free-falling particle is the same as the probability distribution of a free particle, modulo a mass-independent shift of its mean. Version B: any two particles with the same velocity wave-function behave identically in free fall, irrespective of their masses. Both statements apply to all quantum states, including those without a classical correspondence, and also for composite particles with quantum internal dof. We also investigate the consequences of the interaction between internal and external dof induced by free fall. For a class of initial states, we find dephasing occurs for the translational dof, namely, the suppression of the off-diagonal terms of the density matrix, in the position basis. We also find a gravitational phase shift in the reduced density matrix of the internal dof that does not depend on the particle’s mass. For classical states, the phase shift has a natural classical interpretation in terms of gravitational red-shift and special relativistic time-dilation.
Zhang, Huiping; Fan, Susan; Yip, Paul S F
2015-03-01
Although female sexual dysfunction (FSD) is a serious public health issue endangering women's well-being, systematic research on FSD among reproductive-aged Chinese women in Hong Kong is quite scarce. This study aims to estimate the prevalence, risk factors, and associated consequences of FSD among reproductive-aged Chinese married women in Hong Kong. This study was based on a community-based survey across Hong Kong conducted by the Family Planning Association of Hong Kong in 2012 with 1,518 married women aged 21-49 years. The Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition classification was adopted to assess FSD. It was found that 25.6% of the married women surveyed reported at least one form of sexual dysfunction and that the prevalence of six domains of sexual dysfunction was as follows: 10.6% for lack of interest in sex, 10.5% for not finding sex pleasurable, 9.3% for lubrication difficulties, 8.8% for inability to achieve orgasm, 8.8% for orgasm delay, and 8.4% for physical pain during sex. Multivariate analyses showed that low education and income, average or poor health, lower frequency of sex, abortion history, traditional attitudes toward sex, and marital dissatisfaction are all significant risk factors for different components of FSD. It was also been found that four domains of FSD (the exceptions being orgasm delay and physical pain during sex) have severe consequences for married women's life satisfaction and sexual satisfaction. The prevalence of FSD is lower among reproductive-aged Chinese married women in Hong Kong than among women in the United States and some Asian countries. The risk factors associated with FSD include sociodemographic factors, physical health, sexual experience and attitudes, and relationship factors. FSD has significant consequences for married women's life quality. These findings have great implications for FSD prevention and relevant service delivery. © 2014 International Society for Sexual
Ranking criteria for assessment of municipal solid waste dumping sites
Directory of Open Access Journals (Sweden)
Mahmood Khalid
2017-03-01
Full Text Available Priority wise channelization of resources is the key to successful environmental management, especially when funds are limited. The study in hand has successfully developed an algorithmic criterion to compare hazardous effects of Municipal Solid Waste (MSW dumping sites quantitatively. It is a Multi Criteria Analysis (MCA that has made use of the scaling function to normalize the data values, Analytical Hierarchy Process (AHP for assigning weights to input parameters showing their relevant importance, and Weighted Linear Combination (WLC for aggregating the normalized scores. Input parameters have been divided into three classes namely Resident’s Concerns, Groundwater Vulnerability and Surface Facilities. Remote Sensing data and GIS analysis were used to prepare most of the input data. To elaborate the idea, four dumpsites have been chosen as case study, namely Old-FSD, New-FSD, Saggian and Mahmood Booti. The comparison has been made first at class levels and then class scores have been aggregated into environmental normalized index for environmental impact ranking. The hierarchy of goodness found for the selected sites is New-FSD > Old-FSD > Mahmood Booti > Saggian with comparative scores of goodness to environment as 36.67, 28.43, 21.26 and 13.63 respectively. Flexibility of proposed model to adjust any number of classes and parameters in one class will be very helpful for developing world where availability of data is the biggest hurdle in research based environmental sustainability planning. The model can be run even without purchasing satellite data and GIS software, with little inaccuracy, using imagery and measurement tools provided by Google Earth.
Can quantum coherent solar cells break detailed balance?
International Nuclear Information System (INIS)
Kirk, Alexander P.
2015-01-01
Carefully engineered coherent quantum states have been proposed as a design attribute that is hypothesized to enable solar photovoltaic cells to break the detailed balance (or radiative) limit of power conversion efficiency by possibly causing radiative recombination to be suppressed. However, in full compliance with the principles of statistical mechanics and the laws of thermodynamics, specially prepared coherent quantum states do not allow a solar photovoltaic cell—a quantum threshold energy conversion device—to exceed the detailed balance limit of power conversion efficiency. At the condition given by steady-state open circuit operation with zero nonradiative recombination, the photon absorption rate (or carrier photogeneration rate) must balance the photon emission rate (or carrier radiative recombination rate) thus ensuring that detailed balance prevails. Quantum state transitions, entropy-generating hot carrier relaxation, and photon absorption and emission rate balancing are employed holistically and self-consistently along with calculations of current density, voltage, and power conversion efficiency to explain why detailed balance may not be violated in solar photovoltaic cells
Computer Applications in Balancing Chemical Equations.
Kumar, David D.
2001-01-01
Discusses computer-based approaches to balancing chemical equations. Surveys 13 methods, 6 based on matrix, 2 interactive programs, 1 stand-alone system, 1 developed in algorithm in Basic, 1 based on design engineering, 1 written in HyperCard, and 1 prepared for the World Wide Web. (Contains 17 references.) (Author/YDS)
Palko, Barbara Jayne; And Others
This document consists of two separate papers. The first paper, "A Balanced Marine Aquarium" (Barbara Jayne Palko), discusses various aspects of a balanced marine aquarium. Information provided includes the basic and optional equipment needed to construct a balanced aquarium, preparations for setting up the aquarium, preparing the…
Work/Life Balance Issues for Female Physicians and Implications for Medical Education
Corder, Paige Frances
2016-01-01
Work/life balance issues exist for all people who navigate both professional and personal responsibilities, regardless of profession, gender, marital status, or number of children. This research sought to better understand the specific work/life balance challenges faced by female physicians and how medical education can better prepare future…
Sulc, Miroslav; Hernandez, Henar; Martinez, Todd J.; Vanicek, Jiri
2014-03-01
We recently showed that the Dephasing Representation (DR) provides an efficient tool for computing ultrafast electronic spectra and that cellularization yields further acceleration [M. Šulc and J. Vaníček, Mol. Phys. 110, 945 (2012)]. Here we focus on increasing its accuracy by first implementing an exact Gaussian basis method (GBM) combining the accuracy of quantum dynamics and efficiency of classical dynamics. The DR is then derived together with ten other methods for computing time-resolved spectra with intermediate accuracy and efficiency. These include the Gaussian DR (GDR), an exact generalization of the DR, in which trajectories are replaced by communicating frozen Gaussians evolving classically with an average Hamiltonian. The methods are tested numerically on time correlation functions and time-resolved stimulated emission spectra in the harmonic potential, pyrazine S0 /S1 model, and quartic oscillator. Both the GBM and the GDR are shown to increase the accuracy of the DR. Surprisingly, in chaotic systems the GDR can outperform the presumably more accurate GBM, in which the two bases evolve separately. This research was supported by the Swiss NSF Grant No. 200021_124936/1 and NCCR Molecular Ultrafast Science & Technology (MUST), and by the EPFL.
Perceptions of female sexual health and sexual dysfunction in a ...
African Journals Online (AJOL)
These respondents further defined FSD as either the inability of a female to respond to sex, a lack of urge to engage in sexual activities, or inability to attain orgasm. About half of the respondents (n=21) did not know that FSD could be managed; however, 70% of them felt comfortable with discussing FSD symptoms with a ...
选煤厂数质量平衡管理的应用研究%Study on quantity and quality balance control in coal preparation plant
Institute of Scientific and Technical Information of China (English)
杜欣莉
2011-01-01
According to analyzing the technical process in Jinyang coal preparation plant, the best control points in the whole process were defined based on the quantity and quailty balance control principle of coal preparation products. All those improving methods can increase the total yield of coal preparation product, which means there will be a better economic benefits. It can get more accurate variable data and the management level is improved.%通过分析晋阳选煤厂工艺流程,根据洗选产品的数质量平衡原则确定了工序质量点,提出了强化生产过程数质量管理的思路,以保证洗选产品的综合产率,分析各计量数据的可靠性,提高企业的经营管理水平和经济效益.
Quantum coherence in photo-ionisation with tailored XUV pulses
Carlström, Stefanos; Mauritsson, Johan; Schafer, Kenneth J.; L'Huillier, Anne; Gisselbrecht, Mathieu
2018-01-01
Ionisation with ultrashort pulses in the extreme ultraviolet (XUV) regime can be used to prepare an ion in a superposition of spin-orbit substates. In this work, we study the coherence properties of such a superposition, created by ionising xenon atoms using two phase-locked XUV pulses at different frequencies. In general, if the duration of the driving pulse exceeds the quantum beat period, dephasing will occur. If however, the frequency difference of the two pulses matches the spin-orbit splitting, the coherence can be efficiently increased and dephasing does not occur.
Kavitha, S; Rajesh Banu, J; IvinShaju, C D; Kaliappan, S; Yeom, Ick Tae
2016-12-01
Mechanical disintegration of sludge through ultrasonication demands high energy and cost. Therefore, in the present study, a comprehensive investigation was performed to analyze the potential of a novel method, fenton mediated sonic disintegration (FSD). In FSD process, extracellular polymeric substance (EPS) of sludge was first removed via fenton treatment. It was subsequently disintegrated via ultrasonication. Energetic assessment and economic analysis were then performed using net energy and cost gain (spent) as key factor to evaluate the practical viability of the FSD process. FSD was found to be superior over sonic disintegration based on its higher sludge solubilization (34.4% vs. 23.2%) and methane production potential (0.3gCOD/gCOD vs. 0.2gCOD/gCOD). Both energy analysis and cost assessment of the present study revealed that FSD could reduce the energy demand of ultrasonication considerably with a positive net profit of about 44.93USD/Ton of sludge. Copyright © 2016 Elsevier Ltd. All rights reserved.
The Sea-Ice Floe Size Distribution
Stern, H. L., III; Schweiger, A. J. B.; Zhang, J.; Steele, M.
2017-12-01
The size distribution of ice floes in the polar seas affects the dynamics and thermodynamics of the ice cover and its interaction with the ocean and atmosphere. Ice-ocean models are now beginning to include the floe size distribution (FSD) in their simulations. In order to characterize seasonal changes of the FSD and provide validation data for our ice-ocean model, we calculated the FSD in the Beaufort and Chukchi seas over two spring-summer-fall seasons (2013 and 2014) using more than 250 cloud-free visible-band scenes from the MODIS sensors on NASA's Terra and Aqua satellites, identifying nearly 250,000 ice floes between 2 and 30 km in diameter. We found that the FSD follows a power-law distribution at all locations, with a seasonally varying exponent that reflects floe break-up in spring, loss of smaller floes in summer, and the return of larger floes after fall freeze-up. We extended the results to floe sizes from 10 m to 2 km at selected time/space locations using more than 50 high-resolution radar and visible-band satellite images. Our analysis used more data and applied greater statistical rigor than any previous study of the FSD. The incorporation of the FSD into our ice-ocean model resulted in reduced sea-ice thickness, mainly in the marginal ice zone, which improved the simulation of sea-ice extent and yielded an earlier ice retreat. We also examined results from 17 previous studies of the FSD, most of which report power-law FSDs but with widely varying exponents. It is difficult to reconcile the range of results due to different study areas, seasons, and methods of analysis. We review the power-law representation of the FSD in these studies and discuss some mathematical details that are important to consider in any future analysis.
Roszak, Katarzyna; Cywiński, Łukasz
2018-01-01
We find that when a qubit initialized in a pure state experiences pure dephasing due to interaction with an environment, separable qubit-environment states generated during the evolution also have zero quantum discord with respect to the environment. What follows is that the set of separable states which can be reached during the evolution has zero volume, and hence, such effects as sudden death of qubit-environment entanglement are very unlikely. In the case of the discord with respect to the qubit, a vast majority of qubit-environment separable states is discordant, but in specific situations zero-discord states are possible. This is conceptually important since there is a connection between the discordance with respect to a given subsystem and the possibility of describing the evolution of this subsystem using completely positive maps. Finally, we use the formalism to find an exemplary evolution of an entangled state of two qubits that is completely positive, and occurs solely due to interaction of only one of the qubits with its environment (so one could guess that it corresponds to a local operation, since it is local in a physical sense), but which nevertheless causes the enhancement of entanglement between the qubits. While this simply means that the considered evolution is completely positive, but does not belong to local operations and classical communication, it shows how much caution has to be exercised when identifying evolution channels that belong to that class.
TMI-2 reactor vessel and balance of plant status
International Nuclear Information System (INIS)
Kuehn, G.A.
1990-01-01
In the fall of 1988 a corporate decision was made which concentrated effort on support of reactor vessel defueling and minimized activity in balance-of-plant areas. The auxiliary and fuel handling building are in a safe/stable state but final preparations for monitored storage won't be pursued until defueling and fuel shipping are complete. In addition to dispositioning fuel, the project is actively preparing for disposal of the Accident Generated Water (2.3 million gallons) by evaporation
Wafer scale lead zirconate titanate film preparation by sol-gel method using stress balance layer
International Nuclear Information System (INIS)
Lu Jian; Kobayashi, Takeshi; Yi Zhang; Maeda, Ryutaro; Mihara, Takashi
2006-01-01
In this paper, platinum/titanium (Pt/Ti) film was introduced as a residual stress balance layer into wafer scale thick lead zirconate titanate (PZT) film fabrication by sol-gel method. The stress developing in PZT film's bottom electrode as well as in PZT film itself during deposition were analyzed; the wafer curvatures, PZT crystallizations and PZT electric properties before and after using Pt/Ti stress balance layer were studied and compared. It was found that this layer is effective to balance the residual stress in PZT film's bottom electrode induced by thermal expansion coefficient mismatch and Ti diffusion, thus can notably reduce the curvature of 4-in. wafer from - 40.5 μm to - 12.9 μm after PZT film deposition. This stress balance layer was also found effective to avoid the PZT film cracking even when annealed by rapid thermal annealing with heating-rate up to 10.5 deg. C/s. According to X-ray diffraction analysis and electric properties characterization, crack-free uniform 1-μm-thick PZT film with preferred pervoskite (001) orientation, excellent dielectric constant, as high as 1310, and excellent remanent polarization, as high as 39.8 μC/cm 2 , can be obtained on 4-in. wafer
Preparation of standards of triiodothyronine, thyroxine and thyrotropin
International Nuclear Information System (INIS)
Lavalley E, C.; Delgado S, B.; Ruiz J, A.; Zambrano A, F.
1991-10-01
The standards preparation requires of certain basic principles, some of which are described in this work, which was made with the purpose of establishing the most appropriate conditions for the preparation of standards of triiodothyronine, thyroxine and thyrotropin to be used in radioimmunoanalysis essays. The diverse standards show a balanced displacement, that which is observed in the graphs presented in this work. (Author)
Am/Cm Vitrification Process: Pretreatment Material Balance Calculations
International Nuclear Information System (INIS)
Smith, F.G.
2001-01-01
This report documents material balance calculations for the pretreatment steps required to prepare the Americium/Curium solution currently stored in Tank 17.1 in the F-Canyon for vitrification. The material balance uses the latest analysis of the tank contents to provide a best estimate calculation of the expected plant operations during the pretreatment process. The material balance calculations primarily follow the material that directly leads to melter feed. Except for vapor products of the denitration reactions and treatment of supernate from precipitation and precipitate washing, the flowsheet does not include side streams such as acid washes of the empty tanks that would go directly to waste. The calculation also neglects tank heels. This report consolidates previously reported results, corrects some errors found in the spreadsheet and provides a more detailed discussion of the calculation basis
Somatoform and psychoform dissociation among women with orgasmic and sexual pain disorders.
Farina, Benedetto; Mazzotti, Eva; Pasquini, Paolo; Mantione, Maria Giuseppina
2011-01-01
Since the 20th century, psychogenic female sexual dysfunctions (FSD), like some somatoform and conversion disorders, have been considered an expression of somatoform dissociation. Several studies have reported dissociative symptoms in different somatoform and conversion disorders, but limited data are available on dissociation among patients with FSD. The aim of this study was to assess somatoform and psychoform dissociation among patients with women's orgasmic disorder, dyspareunia, and vaginismus. A battery of self-administered questionnaires (Somatoform Dissociation Questionnaire, Dissociative Experiences Scale, Hospital Anxiety and Depression Scale, Impact of Event Scale-Revised) was given to 200 gynecological outpatients to assess psychoform and somatoform dissociation and their association with FSD. A strong association between somatoform dissociation and FSD was observed (adjusted odds ratio [OR] = 5.39, 95% confidence interval [CI] = 1.15-25.32), the association between somatoform and psychoform dissociation being estimated by an adjusted OR of 4.83 (95% CI = 1.17-19.91). Our results are compatible with the idea that some forms of FSD could be regarded as somatoform dissociative disorders.
First Significant Digits and the Credit Derivative Market During the Financial Crisis
Directory of Open Access Journals (Sweden)
Paul Hofmarcher
2013-06-01
Full Text Available The Credit Default Swap (CDS market has both been lauded for its ability to stabilize the financial system through credit risk transfers and been the source of regulatory concern due to its size and lack of transparency. As a decentralized over-the-counter market, detailed information about pricing mechanisms is rather scarce. To investigate reported CDS prices (spreads more closely, we make use of empirical First Significant Digit (FSD distributions and analyze daily CDS prices for European and US entities during the financial crisis starting in 2007. We find that on a time-aggregated level, the European and US markets obey empirical FSD distributions similar to the theoretical ones. Surprising differences are observed in the development of the FSD distributions between the US and European markets. Whereas the FSD distribution of the US derivative market behaves nearly constantly during the last financial crisis, we find huge fluctuations in the FSD distribution of the European market. One reason for these differences might be the possibility of strategic default for US companies due to Chapter 11 and avoided contagion effects.
Sadat Hashemi, Somayeh; Ghavami Sabouri, Saeed; Khorsandi, Alireza
2018-04-01
We present a theoretical model in order to study the effect of a thermally loaded crystal on the quality of a second-harmonic (SH) beam generated in a high-power pumping regime. The model is provided based on using a particular structure of oven considered for MgO:PPsLT nonlinear crystal to compensate for the thermal de-phasing effect that as the pumping power reaches up to 50 W degrades the conversion efficiency and beam quality of the interacting beams. Hereupon, the quality of fundamental beam is involved in the modeling to investigate the final effect on the beam quality of generated SH beam. Beam quality evaluation is subsequently simulated using Hermite-Gaussian modal decomposition approach for a range of fundamental beam qualities varied from 1 to 3 and for different levels of input powers. To provide a meaningful comparison numerical simulation is correlated with real data deduced from a high-power SH generation (SHG) experimental device. It is found that when using the open-top oven scheme and fixing the fundamental M 2-factor at nearly 1, for a range of input powers changing from 15 to 30 W, the M 2-factor of SHG beam is degraded from 9% to 24%, respectively, confirming very good consistency with the reported experimental results.
Views and Experiences of Malaysian Family Medicine Trainees of Female Sexual Dysfunction.
Lai, Pauline Siew Mei; Tan, Sing Yee; Liew, Su May
2016-11-01
Sociocultural factors have been shown to be important influencers of sexual health and sexuality. Hence, the aim of our study was to explore the views and experiences of family medicine trainees regarding female sexual dysfunction (FSD) with a focus on the barriers and facilitators towards the initiation of conversation on this topic. A qualitative study design involving semi-structured focus group discussions (FGDs) was conducted with 19 family medicine trainees in Malaysia. The conceptual framework used was based on the Theory of Planned Behavior. Thematic approach was used to analyze the data. Participants perceived FSD as being uncommon and unimportant. According to our participants, patients often presented with indirect complaints, and doctors were not proactive in asking about FSD. Three main barriers were identified: doctor factors, perceived patient factors, and system factors. Lack of confidence, knowledge, experience, time, and embarrassment were the key barriers identified at the doctors' level. Lack of awareness, among patients regarding FSD, and local cultural and religious norms were the perceived patient barriers. System barriers were lack of time and privacy. Various facilitators, such as continuous medical education and public forums, were suggested as means to encourage family medicine trainees to initiate discussion on sexual matters during consultations. In conclusion, family medicine trainees found it difficult to initiate conversation on FSD with patients. Interventions to encourage conversation on FSD should target this and other identified barriers.
Directory of Open Access Journals (Sweden)
Singh J
2009-01-01
Full Text Available Background: Reports from India on the prevalence and determinants of female sexual dysfunction (FSD are scant. Aims: To determine the prevalence and risk factors for FSD. Settings and Design: A cross-sectional survey in a medical outpatient clinic of a tertiary care hospital. Materials and Methods: We administered a Tamil version of the Female Sexual Function Index (FSFI to 149 married women. We evaluated putative risk factors for FSD. We elicited participant′s attributions for their sexual difficulties. Statistical Analysis: We estimated the prevalence of possible FSD and sexual difficulties from published FSFI total and domain cut-off scores. We used logistic regression to identify risk factors for possible FSD. Results: FSFI total scores suggested FSD in two-thirds of the 149 women (73.2%; 95% confidence intervals [CI] 65.5% to 79.6%. FSFI domain scores suggested difficulties with desire in 77.2%; arousal in 91.3%; lubrication in 96.6%; orgasm in 86.6%, satisfaction in 81.2%, and pain in 64.4%. Age above 40 years (odds ratios [OR] 11.7; 95% CI 3.4 to 40.1 and fewer years of education (OR 1.2; 95% CI 1.0 to 1.3 were identified by logistic regression as contributory. Women attributed FSD to physical illness in participant or partner, relationship problems, and cultural taboos but none had sought professional help. Conclusions: Sexual problems suggestive of dysfunction, as suggested by FSFI total and domain scores, are highly prevalent in the clinic setting, particularly among women above 40 and those less educated, but confirmation using locally validated cut-off scores of the FSFI is needed.
International Nuclear Information System (INIS)
KLEM, M.J.
2000-01-01
The purpose of these calculations is to develop the material balances for documentation of the Canister Storage Building (CSB) Process Flow Diagram (PFD) and future reference. The attached mass balances were prepared to support revision two of the PFD for the CSB. The calculations refer to diagram H-2-825869
Tips for School Districts: GASB's New Fund Balance Standards
Mead, Dean Michael
2010-01-01
In March 2009, the Governmental Accounting Standards Board (GASB) issued Statement No. 54, "Fund Balance Reporting and Governmental Fund Type Definitions." School districts that prepare financial reports based on generally accepted accounting principles are required to implement this standard no later than the first fiscal year that starts after…
Sexual dysfunction and relationship stress: how does this association vary for men and women?
McCabe, Marita P; Connaughton, Catherine
2017-02-01
This paper examines the association between relationship stress and sexual dysfunction. The results demonstrated a strong association between female sexual dysfunction (FSD) and relationship stress, and between male sexual dysfunction (MSD) and relationship stress among their female partners. No studies examined the association between FSD and relationship stress of male partners. Treatment for MSD was associated with improved relationship stress for female partners, but no studies were located that examined this association for treatment of FSD. These findings suggest that FSD and relationship stress are strongly related, but the association does not seem to be so strong for men. The review highlights the need for further research in this field to inform therapy for both sexual dysfunction and relationship problems. Copyright © 2016 Elsevier Ltd. All rights reserved.
... all contribute to FSD. Causes of FSD General Physical Health problems: diabetes, heart disease, cancer, arthritis, multiple sclerosis, or alcohol abuse Medicines to treat high blood pressure, depression, pain; oral contraceptives Gynecological Medical conditions such as ...
Carmichael, H.
1953-01-01
A torsional-type analytical balance designed to arrive at its equilibrium point more quickly than previous balances is described. In order to prevent external heat sources creating air currents inside the balance casing that would reiard the attainment of equilibrium conditions, a relatively thick casing shaped as an inverted U is placed over the load support arms and the balance beam. This casing is of a metal of good thernnal conductivity characteristics, such as copper or aluminum, in order that heat applied to one portion of the balance is quickly conducted to all other sensitive areas, thus effectively preventing the fornnation of air currents caused by unequal heating of the balance.
Bond, Dale S; Pavlović, Jelena M; Lipton, Richard B; Graham Thomas, J; Digre, Kathleen B; Roth, Julie; Rathier, Lucille; O'Leary, Kevin C; Evans, E Whitney; Wing, Rena R
2017-03-01
Previous studies suggest that migraine might be associated with female sexual dysfunction (FSD), although this association may be complicated by overweight/obesity. To disentangle relationships of migraine and obesity with FSD, we examined: (1) FSD rates in women who had migraine and obesity with a matched sample of women with obesity who were free of migraine and (2) associations between indices of migraine severity and FSD in a larger sample of participants with migraine and overweight/obesity, controlling for important confounders. Women with migraine and obesity seeking behavioral weight loss treatment to decrease headaches (n = 37) and nonmigraine controls (n = 37) with obesity seeking weight loss via bariatric surgery were matched on age (±5 years), body mass index (BMI; ±3 kg/m 2 ), and reported sexual activity during the past month. Both groups completed the Female Sexual Function Index (FSFI), with a validated FSFI-total cutoff score used to define FSD. In participants with migraine and overweight/obesity (n = 105), separate logistic regression models evaluated associations of migraine attack frequency, intensity, and duration with odds of having FSD, controlling for age, BMI, depression, and anxiety. On average, participants and matched controls had severe obesity (BMI = 42.4 ± 3.8 kg/m 2 ; range = 35-49.9) and were 37.3 ± 7.2 years of age (range = 22-50). FSD rate did not differ between migraine participants and controls (56.8% vs. 54.1%, P = .82). In the larger sample of participants with migraine and overweight/obesity (38.2 ± 7.8 years of age; BMI = 34.8 ± 6.4 [range = 25-50 kg/m 2 ]; 8.0 ± 4.3 migraine days/month, maximum pain intensity = 5.9 ± 1.4 on 0-10 scale; average attack duration = 18.3 ± 9.7 hours), FSD was not associated with attack frequency (P = .31), pain intensity (P = .92), or attack duration (P = .35) but was associated with more severe anxiety
Automatic fission source convergence criteria for Monte Carlo criticality calculations
International Nuclear Information System (INIS)
Shim, Hyung Jin; Kim, Chang Hyo
2005-01-01
The Monte Carlo criticality calculations for the multiplication factor and the power distribution in a nuclear system require knowledge of stationary or fundamental-mode fission source distribution (FSD) in the system. Because it is a priori unknown, so-called inactive cycle Monte Carlo (MC) runs are performed to determine it. The inactive cycle MC runs should be continued until the FSD converges to the stationary FSD. Obviously, if one stops them prematurely, the MC calculation results may have biases because the followup active cycles may be run with the non-stationary FSD. Conversely, if one performs the inactive cycle MC runs more than necessary, one is apt to waste computing time because inactive cycle MC runs are used to elicit the fundamental-mode FSD only. In the absence of suitable criteria for terminating the inactive cycle MC runs, one cannot but rely on empiricism in deciding how many inactive cycles one should conduct for a given problem. Depending on the problem, this may introduce biases into Monte Carlo estimates of the parameters one tries to calculate. The purpose of this paper is to present new fission source convergence criteria designed for the automatic termination of inactive cycle MC runs
International Nuclear Information System (INIS)
Yin Jun; Yu Ling-Yao; Liu Xing; Wan Hui; Lin Zi-Yang; Niu Han-Ben
2011-01-01
In broadband coherent anti-Stokes Raman scattering (CARS) spectroscopy with supercontinuum (SC), the simultaneously detectable spectral coverage is limited by the spectral continuity and the simultaneity of various spectral components of SC in an enough bandwidth. By numerical simulations, the optimal experimental conditions for improving the SC are obtained. The broadband time-resolved CARS spectrography based on the SC with required temporal and spectral distributions is realised. The global molecular vibrational spectrum with well suppressed nonresonant background noise can be obtained in a single measurement. At the same time, the measurements of dephasing times of various molecular vibrational modes can be conveniently achieved from intensities of a sequence of time-resolved CARS signals. It will be more helpful to provide a complete picture of molecular vibrations, and to exhibit a potential to understand not only both the solvent dynamics and the solute-solvent interactions, but also the mechanisms of chemical reactions in the fields of biology, chemistry and material science. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Development of a sexual function questionnaire for clinical trials of female sexual dysfunction
Quirk, Frances H.; Heiman, Julia R.; Rosen, Raymond C.; Laan, Ellen; Smith, Michael D.; Boolell, Mitra
2002-01-01
OBJECTIVE: To better evaluate efficacy in clinical trials of drugs as potential treatments for female sexual dysfunctions (FSD), a brief, multidimensional measure of female sexual function was developed. METHODS: Data from semistructured interviews with 82 women with or without FSD, aged 19-65
DEFF Research Database (Denmark)
Giraldi, Annamaria; Wåhlin-Jacobsen, Sarah
2016-01-01
Female sexual dysfunction (FSD) is a controversial condition, which has prompted much debate regarding its aetiology, components, and even its existence. Our inability to work together as clinicians, psychologists, patients, and advocates hinders our understanding of FSD, and we will only improve...
Du, Juan; Ruan, Xiangyan; Gu, Muqing; Bitzer, Johannes; Mueck, Alfred O
2016-06-01
Female sexual dysfunction (FSD) is a very common sexual health problem worldwide. The prevalence of FSD in Chinese women is, however, unknown. This is the first study to investigate a large number of young women throughout China via the internet, to determine the prevalence and types of FSD and to identify the risk factors for FSD. The primary endpoint was the Female Sexual Function Index (FSFI) score, with additional questions on contraception, sexual activity, relationship stability, pregnancy and other factors which may influence sexual function. The online questionnaire was completed by women from 31 of the 34 Chinese provinces. A total of 1618 completed questionnaires were received, and 1010 were included in the analyses after screening (62.4%). The mean age of the respondents was 25.1 ± 4.5 years. The mean total FSFI score was 24.99 ± 4.60. According to FSFI definitions (cut-off score 26.55), 60.2% of women were at risk of FSD. Based on domain scores, 52 were considered at high risk of dysfunction for pain (5.1%), 35 for orgasm (3.5%), 33 for desire (3.3%), 20 for arousal (2.0%), 6 for satisfaction (0.6%) and 2 for lubrication (0.2%). The prevalence of FSFI scores indicating risk of sexual dysfunction was about 60% in Chinese women. An unstable relationship, pressure to become pregnant, non-use of contraception, negative self-evaluation of appearance and increasing age were significantly associated with FSD in young Chinese women.
LACTULOSE IN PREOPERATIVE PREPARATION OF CHILDREN WITH DECOMPENSATED TYPE OF CHRONIC COLON STASIS
Directory of Open Access Journals (Sweden)
I.V. Kirgizov
2009-01-01
Full Text Available This article describes the results of estimation of effectiveness of lactulose (Dupfalac in preoperative preparation of children with decompensated type of chronic colon stasis. Proved, that administration of this medication normalizes such indices of homeostasis as acid-base balance of blood and microbiocenose of colon by 7days. Use of lactulose decreases patient complaints on nausea, vomiting, abdominal pain, weakness in 1.6 times rarely then in group of children using other laxative medications in preoperative preparation.Key words: megacolon syndrome, lactulose, dysbacteriosis, blood acid-base balance.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2009;8(1:68-71
Recombinant VSV G proteins reveal a novel raft-dependent endocytic pathway in resorbing osteoclasts
International Nuclear Information System (INIS)
Mulari, Mika T.K.; Nars, Martin; Laitala-Leinonen, Tiina; Kaisto, Tuula; Metsikkoe, Kalervo; Sun Yi; Vaeaenaenen, H. Kalervo
2008-01-01
Transcytotic membrane flow delivers degraded bone fragments from the ruffled border to the functional secretory domain, FSD, in bone resorbing osteoclasts. Here we show that there is also a FSD-to-ruffled border trafficking pathway that compensates for the membrane loss during the matrix uptake process and that rafts are essential for this ruffled border-targeted endosomal pathway. Replacing the cytoplasmic tail of the vesicular stomatitis virus G protein with that of CD4 resulted in partial insolubility in Triton X-100 and retargeting from the peripheral non-bone facing plasma membrane to the FSD. Recombinant G proteins were subsequently endosytosed and delivered from the FSD to the peripheral fusion zone of the ruffled border, which were both rich in lipid rafts as suggested by viral protein transport analysis and visualizing the rafts with fluorescent recombinant cholera toxin. Cholesterol depletion by methyl-β-cyclodextrin impaired the ruffled border-targeted vesicle trafficking pathway and inhibited bone resorption dose-dependently as quantified by measuring the CTX and TRACP 5b secreted to the culture medium and by measuring the resorbed area visualized with a bi-phasic labeling method using sulpho-NHS-biotin and WGA-lectin. Thus, rafts are vital for membrane recycling from the FSD to the late endosomal/lysosomal ruffled border and bone resorption
Typical balance exercises or exergames for balance improvement?
Gioftsidou, Asimenia; Vernadakis, Nikolaos; Malliou, Paraskevi; Batzios, Stavros; Sofokleous, Polina; Antoniou, Panagiotis; Kouli, Olga; Tsapralis, Kyriakos; Godolias, George
2013-01-01
Balance training is an effective intervention to improve static postural sway and balance. The purpose of the present study was to investigate the effectiveness of the Nintendo Wii Fit Plus exercises for improving balance ability in healthy collegiate students in comparison with a typical balance training program. Forty students were randomly divided into two groups, a traditional (T group) and a Nintendo Wii group (W group) performed an 8 week balance program. The "W group" used the interactive games as a training method, while the "T group" used an exercise program with mini trampoline and inflatable discs (BOSU). Pre and Post-training participants completed balance assessments. Two-way repeated measures analyses of variance (ANOVAs) were conducted to determine the effect of training program. Analysis of the data illustrated that both training program groups demonstrated an improvement in Total, Anterior-posterior and Medial Lateral Stability Index scores for both limbs. Only at the test performed in the balance board with anterior-posterior motion, the improvement in balance ability was greater in the "T group" than the "W group", when the assessment was performed post-training (p=0.023). Findings support the effectiveness of using the Nintendo Wii gaming console as a balance training intervention tool.
Sea-ice floe-size distribution in the context of spontaneous scaling emergence in stochastic systems
Herman, Agnieszka
2010-06-01
Sea-ice floe-size distribution (FSD) in ice-pack covered seas influences many aspects of ocean-atmosphere interactions. However, data concerning FSD in the polar oceans are still sparse and processes shaping the observed FSD properties are poorly understood. Typically, power-law FSDs are assumed although no feasible explanation has been provided neither for this one nor for other properties of the observed distributions. Consequently, no model exists capable of predicting FSD parameters in any particular situation. Here I show that the observed FSDs can be well represented by a truncated Pareto distribution P(x)=x-1-αexp[(1-α)/x] , which is an emergent property of a certain group of multiplicative stochastic systems, described by the generalized Lotka-Volterra (GLV) equation. Building upon this recognition, a possibility of developing a simple agent-based GLV-type sea-ice model is considered. Contrary to simple power-law FSDs, GLV gives consistent estimates of the total floe perimeter, as well as floe-area distribution in agreement with observations.
... fully trust your sense of balance. Loss of balance also raises the risk of falls. This is a serious and even life-threatening ... 65. Balance disorders are serious because of the risk of falls. But occasionally balance problems may warn of another health condition, such ...
International Nuclear Information System (INIS)
Saddiqi, F.A.; Masood, T.
2017-01-01
To determine the effects of dynamic posturographic balance training versus conventional balance training in improving mobility and balance in elderly. Methodology: Forty subjects between 50 to 80 years of age were selected via non-probability convenience sampling technique, for this randomized controlled trial. Both females and males with no major co-morbid conditions and cognitive impairments were recruited and randomized via coin toss method into two equal groups: Dynamic Posturographic balance training (DPG) group and Conventional balance training (CBT) group. The DPG training was provided via Biodex Balance System (Static and Dynamic). Both groups received interventions 3 times (35 to 45min each day) a week for 8 weeks, after which terminal assessment was done. Data were collected on demographic profile, balance via berg balance score and mobility by using Timed Up and Go Test. Independent samples t test was used to check difference between CBT group and DPG Group and repeated measures Analysis of Variance (ANOVA) was used for within-group analysis. Results: Baseline analysis of Berg balance scale and timed up and go test between two groups showed no significant difference with (p 0.805 and 0.251, respectively). After 8 weeks of intervention, there was significant difference between the groups in both variables (p 0.019 and 0.001, respectively). Conclusion: Dynamic posturographic balance training was more effective in improving dynamic balance and mobility in elderly population in comparison to conventional balance training. (author)
Cullen, SarahJane; Dolan, Eimear; O Brien, Kate; McGoldrick, Adrian; Warrington, Giles
2015-11-01
Balance and anaerobic performance are key attributes related to horse-racing performance, but research on the impact of making weight for racing on these parameters remains unknown. The purpose of this study was to investigate the effects of rapid weight loss in preparation for racing on balance and anaerobic performance in a group of jockeys. Twelve apprentice male jockeys and 12 age- and gender-matched controls completed 2 trials separated by 48 h. In both trials, body mass, hydration status, balance, and anaerobic performance were assessed. Between the trials, the jockeys reduced body mass by 4% using weight-loss methods typically adopted in preparation for racing, while controls maintained body mass through typical daily dietary and physical activity habits. Apprentice jockeys decreased mean body mass by 4.2% ± 0.3% (P balance, on the left or right side, or in peak power, mean power, or fatigue index were reported between the trials in either group. Results from this study indicate that a 4% reduction in body mass in 48 h through the typical methods employed for racing, in association with an increase in dehydration, resulted in no impairments in balance or anaerobic performance. Further research is required to evaluate performance in a sport-specific setting and to investigate the specific physiological mechanisms involved.
Interchangeability of the Wii Balance Board for Bipedal Balance Assessment.
Bonnechère, Bruno; Jansen, Bart; Omelina, Lubos; Rooze, Marcel; Van Sint Jan, Serge
2015-08-27
Since 2010, an increasing interest in more portable and flexible hardware for balance and posture assessment led to previously published studies determining whether or not the Wii Balance Board could be used to assess balance and posture, both scientifically and clinically. However, no previous studies aimed at comparing results from different Wii Balance Boards for clinical balance evaluation exist. The objective of this crossover study is to assess the interchangeability of the Wii Balance Board. A total of 6 subjects participated in the study and their balance was assessed using 4 different Wii Balance Boards. Trials were recorded simultaneously with Wii Balance Boards and with a laboratory force plate. Nine relevant clinical parameters were derived from center of pressure displacement data obtained from Wii Balance Board and force plate systems. Intraclass correlation coefficients (ICC), F tests, and Friedman tests were computed to assess the agreement between trials and to compare the Wii Balance Board and force plate results. Excellent correlations were found between the Wii Balance Board and force plate (mean ρ =.83). With the exception of 2 parameters, strong to excellent agreements were found for the 7 remaining parameters (ICC=.96). No significant differences were found between trials recorded with different Wii Balance Boards. Our results indicate that for most of the parameters analyzed, balance and posture assessed with one Wii Balance Board were statistically similar to results obtained from another. Furthermore, the good correlation between the Wii Balance Board and force plate results shows that Wii Balance Boards can be reliably used for scientific assessment using most of the parameters analyzed in this study. These results also suggest that the Wii Balance Board could be used in multicenter studies and therefore, would allow for the creation of larger populations for clinical studies. Ethical Committee of the Erasme Hospital (CCB B406201215142
Chance for balance: Chance for balance
Sævild, Katariina; Skov Sørensen, Katrine; Kildahl Lauritsen, Louise; Fuglsang, Sofie Olivia; Arnbjerg, Stine Høegh
2015-01-01
This project investigates how (im) balance between family and career influences Danish women's desire to have children. In order to answer this question, we have chosen to use qualitative method and our analysis is based on two semi-structured research interviews with two chosen women. Thus these women’s definition of balance and their view on children define the project. We have chosen to use of work-life balance theories, Thomas Hoejrup’s lifeform-analysis and Anthony Giddens’ theories of s...
Contested psychiatric ontology and feminist critique
Angel, Katherine
2012-01-01
In this article I discuss the emergence of Female Sexual Dysfunction (FSD) within American psychiatry and beyond in the postwar period, setting out what I believe to be important and suggestive questions neglected in existing scholarship. Tracing the nomenclature within successive editions of the American Psychiatric Association’s Diagnostic and Statistical Manual (DSM), I consider the reification of the term ‘FSD’, and the activism and scholarship that the rise of the category has occasioned. I suggest that analysis of FSD benefits from scrutiny of a wider range of sources (especially since the popular and scientific cross-pollinate). I explore the multiplicity of FSD that emerges when one examines this wider range, but I also underscore a reinscribing of anxieties about psychogenic aetiologies. I then argue that what makes the FSD case additionally interesting, over and above other conditions with a contested status, is the historically complex relationship between psychiatry and feminism that is at work in contemporary debates. I suggest that existing literature on FSD has not yet posed some of the most important and salient questions at stake in writing about women’s sexual problems in this period, and can only do this when the relationship between ‘second-wave’ feminism, ‘post-feminism’, psychiatry and psychoanalysis becomes part of the terrain to be analysed, rather than the medium through which analysis is conducted. PMID:23355764
Preparing Students for After-College Life: The Context
Smith, Kelli K.
2012-01-01
Historical context informs the work of student affairs professionals and others in higher education in striking the right balance in helping prepare students for life after college, but significant new pressures face students, their mentors, and educational institutions today. This chapter discusses the contexts that shape the work of student…
Lubker Cornish, Disa; Askelson, Natoshia M.; Golembiewski, Elizabeth H.
2015-01-01
Purpose/Objectives: This study was designed to explore the professional networks of rural school food service directors (FSD), the resources they use for implementing the Healthy, Hunger-free Kids Act of 2010 (HHFKA), and their needs for information and support to continue to implement successfully. Methods: Rural FSD participated in an in-depth…
The relevance of clinical balance assessment tools to differentiate balance deficits
Mancini, Martina; Horak, Fay B
2010-01-01
Control of balance is complex and involves maintaining postures, facilitating movement, and recovering equilibrium. Balance control consists of controlling the body center of mass over its limits of stability. Clinical balance assessment can help assess fall risk and/or determine the underlying reasons for balance disorders. Most functional balance assessment scales assess fall risk and the need for balance rehabilitation but do not differentiate types of balance deficits. A system approach t...
DWPF coupled feed flowsheet material balance with batch one sludge and copper nitrate catalyst
Energy Technology Data Exchange (ETDEWEB)
Choi, A.S.
1993-09-28
The SRTC has formally transmitted a recommendation to DWPF to replace copper formate with copper nitrate as the catalyst form during precipitate hydrolysis [1]. The SRTC was subsequently requested to formally document the technical bases for the recommendation. A memorandum was issued on August 23, 1993 detailing the activities (and responsible individuals) necessary to address the impact of this change in catalyst form on process compatibility, safety, processibility environmental impact and product glass quality [2]. One of the activities identified was the preparation of a material balance in which copper nitrate is substituted for copper formate and the identification of key comparisons between this material balance and the current Batch 1 sludge -- Late Wash material balance [3].
... often, it could be a sign of a balance problem. Balance problems can make you feel unsteady. You may ... related injuries, such as a hip fracture. Some balance problems are due to problems in the inner ...
Effect of diet on maintenance of acid-basal balance in blood of dairy cows
Directory of Open Access Journals (Sweden)
Gaál T.
2003-01-01
Full Text Available High-performance breeds of ruminants often exhibit production disorders which can be accompanied by a disturbed acid-basal balance. Most of the disorders in the acid-basal balance are closely related to digressions in the diet norms of these animals. A deficiency or surplus of energy equally cause disorders in the acid-basal status of the organism. Metabolic acidosis is the most frequent of the four types of basic disorders in the acid-basal balance in ruminants. It appears as a consequence of rumen acidosis, ketosis, or diarrhea. Acute disorders in the acid-basal balance are far more dangerous than chronic ones. Therapy of the basic diseases is generally sufficient compensation for the effects of the acid-basal disorders, but in certain cases it is necessary to perform alkalization, that is, acidification of the rumen content using the necessary preparations.
Directory of Open Access Journals (Sweden)
Reza Jafarzadeh Esfehani
2016-01-01
Full Text Available Background & aim: Female sexual function (FSD is a multifactorial phenomenon. Sexual function is influenced by different personal and environmental factors. This study aimed to evaluate FSD and its contributing factors using female sexual function index (FSFI. Methods:This descriptive cross-sectional study was conducted on 264 women referring to 11 health centers of Sabzevar, Iran during October 2012 to January 2013 using a convenience sampling. Data were collected using a validated Persian version of FSFI containing six domains of sexual desire, lubrication, sexual arousal, sexual satisfaction, orgasm and sexual pain as well as demographic questionnaire. A total score of Results: The mean age of women enrolled in this study was 32.2±10.27 years . Considering the cut-off point of sexual dysfunction at 28, 62.1% of the study population had FSD. Highest rate of FSD was estimated at 49.2%, Age was associated with a significant decline in total scores of FSFI (P=0.042. Moreover, a significant correlation was observed between duration of marriage and total scores of FSFI (P
Herman, Agnieszka
2010-06-01
Sea-ice floe-size distribution (FSD) in ice-pack covered seas influences many aspects of ocean-atmosphere interactions. However, data concerning FSD in the polar oceans are still sparse and processes shaping the observed FSD properties are poorly understood. Typically, power-law FSDs are assumed although no feasible explanation has been provided neither for this one nor for other properties of the observed distributions. Consequently, no model exists capable of predicting FSD parameters in any particular situation. Here I show that the observed FSDs can be well represented by a truncated Pareto distribution P(x)=x(-1-α) exp[(1-α)/x] , which is an emergent property of a certain group of multiplicative stochastic systems, described by the generalized Lotka-Volterra (GLV) equation. Building upon this recognition, a possibility of developing a simple agent-based GLV-type sea-ice model is considered. Contrary to simple power-law FSDs, GLV gives consistent estimates of the total floe perimeter, as well as floe-area distribution in agreement with observations.
Muela, E; Monge, P; Sañudo, C; Campo, M M; Beltrán, J A
2015-04-01
The study analysed the effect of frozen storage duration (FSD: 0, 1, 9, 15 or 21 months) and display duration (DD: 0-24 h post-slaughter-, 3 and 6 days) in modified atmosphere packaging (MAP) on lamb quality. pH, colour, lipid oxidation, water holding capacity and instrumental texture were performed on Longissimus muscle in displayed fresh and thawed meat. FSD affected all the variables showing lower differences between fresh and 1 month storage than among them and longer FSD. Only cooking losses were not affected by DD in thawed meats. It was observed a general decrease in quality (lower redness and water holding capacity; higher yellowness and lipid oxidation) as FSD or DD increased and only texture was improved over DD being thawed meat more tender. In conclusion, lamb storage at -18°C should not exceed 1 month if thawed meat would be later displayed in MAP while meat would have an acceptable quality up to 21 months without subsequent display. Copyright © 2015 Elsevier Ltd. All rights reserved.
Interchangeability of the Wii Balance Board for Bipedal Balance Assessment
Bonnech?re, Bruno; Jansen, Bart; Omelina, Lubos; Rooze, Marcel; Van Sint Jan, Serge
2015-01-01
Background Since 2010, an increasing interest in more portable and flexible hardware for balance and posture assessment led to previously published studies determining whether or not the Wii Balance Board could be used to assess balance and posture, both scientifically and clinically. However, no previous studies aimed at comparing results from different Wii Balance Boards for clinical balance evaluation exist. Objective The objective of this crossover study is to assess the interchangeabilit...
Perceptions of female sexual health and sexual dysfunction in a ...
African Journals Online (AJOL)
Questions asked ranged from sexual activity in the preceding 6 months, menopausal status, if they thought they had sexual dysfunction to their willingness to discuss an FSD with a sexual health physician if they had access to one. Results: Over 50% (n=28) of the respondents had an idea about what FSD was before the ...
To Teach Standard English or World Englishes? A Balanced Approach to Instruction
Farrell, Thomas S. C.; Martin, Sonia
2009-01-01
This article suggests that English language teachers should consider all varieties of English, not just British Standard English or American Standard English. In order to better prepare students for the global world, and to show them that their own English is valued, teachers can implement a balanced approach that incorporates the teaching and…
Do budget balance rules anchor budget balance expectations? -- Some international evidence
Rülke, Jan-Christoph; Frenkel, Michael; Lis, Eliza
2013-01-01
This is the first study that analyzes whether budget balance expectations are anchored and whether budget balance rules effectively anchor expectations. To this end, we use a unique data set which covers budget balance expectations in 17 countries that implemented a budget balance rules. While our results are mixed concerning the general impact of budget balance rules on anchoring expectations, we do find that specific features of budget balance rules are important to successfully anchor budg...
Mercury material-balance in industrial electrolytic cells, by using radioactive mercury (203Hg)
International Nuclear Information System (INIS)
Caras, I.; Pasi, M.
1976-01-01
A material-balance test for industrial mercury electrolytic cells is described. The test uses the radioactive dilution technique with 203 Hg. The preparation of the 203 Hg from irradiated mercuric oxide is also described. The accuracy of the test is shown to be +-1% for each cell. (author)
Double light-cone dynamics establish thermal states in integrable 1D Bose gases
Langen, T.; Schweigler, T.; Demler, E.; Schmiedmayer, J.
2018-02-01
We theoretically investigate the non-equilibrium dynamics in a quenched pair of one-dimensional Bose gases with density imbalance. We describe the system using its low-energy effective theory, the Luttinger liquid model. In this framework the system shows strictly integrable relaxation dynamics via dephasing of its approximate many-body eigenstates. In the balanced case, this leads to the well-known light-cone-like establishment of a prethermalized state, which can be described by a generalized Gibbs ensemble. In the imbalanced case the integrable dephasing leads to a state that, counter-intuitively, closely resembles a thermal equilibrium state. The approach to this state is characterized by two separate light-cone dynamics with distinct characteristic velocities. This behavior is a result of the fact that in the imbalanced case observables are not aligned with the conserved quantities of the integrable system. We discuss a concrete experimental realization to study this effect using matterwave interferometry and many-body revivals on an atom chip.
DEFF Research Database (Denmark)
through control or trust. Human resource specialists need to make balanced decisions about how to design tasks and jobs in order to make them attractive as well as motivating. Marketers need to make balanced decisions about how to market products in the light of what is now important in consumers...... in their environments. Communication specialists need to make balanced decisions which take the different value systems and assumptions of stakeholders into consideration. Change specialists need to balance the need for continuity and change. Managers need to make balanced decisions about whether to achieve goals...... the creation and recreation of balanced relationships. Chapters in The Balanced Company ask and provide answers to questions about corporately responsible and ethically driven balanced decision making, such as: • How can a company and its stakeholders identify what should be taken into consideration - What...
International Nuclear Information System (INIS)
Duchateau, J.L.; Gravil, B.; Tena, E.; Henry, D.; Journeaux, J.Y.; Libeyre, P.
2004-01-01
The toroidal field (TF) system of Tore Supra (TS) is superconducting. After 16 years of operation it is possible to give an overview of the experience gained on a large superconducting system integrated in a large Tokamak. Quantitative data will be given, about the TF system for the cryogenic system and for the magnet system as well, concerning the number of plasmas shots and the availability of the machine. The origin and the number of breakdowns or incidents will be described, with emphasis on cryogenics, to document repairs and changes on the system components. Concerning the behaviour during operation, the Fast Safety Discharges (FSD) in operation are of particular interest for the Tokamak operation, as they interrupt it on a significant time of the order of one hour. This aspect is particularly documented. The approach followed to decrease the number of these FSD will be reported and explained. The Tore Supra Tokamak was the first important meeting between Superconductivity and Plasma Physics on a large scale. Overall, despite the differences in design and size, the accumulated experience over 16 years of operation is a useful tool to prepare the manufacturing and the operation of the ITER magnets. (authors)
Biomechanical assessment of dynamic balance: Specificity of different balance tests.
Ringhof, Steffen; Stein, Thorsten
2018-04-01
Dynamic balance is vitally important for most sports and activities of daily living, so the assessment of dynamic stability has become an important issue. In consequence, a large number of balance tests have been developed. However, it is not yet known whether these tests (i) measure the same construct and (ii) can differentiate between athletes with different balance expertise. We therefore studied three common dynamic balance tests: one-leg jump landings, Posturomed perturbations and simulated forward falls. Participants were 24 healthy young females in regular training in either gymnastics (n = 12) or swimming (n = 12). In each of the tests, the participants were instructed to recover balance as quickly as possible. Dynamic stability was computed by time to stabilization and margin of stability, deduced from force plates and motion capture respectively. Pearson's correlations between the dynamic balance tests found no significant associations between the respective dynamic stability measures. Furthermore, independent t-tests indicated that only jump landings could properly distinguish between both groups of athletes. In essence, the different dynamic balance tests applied did not measure the same construct but rather task-specific skills, each of which depends on multifactorial internal and external constraints. Our study therefore contradicts the traditional view of considering balance as a general ability, and reinforces that dynamic balance measures are not interchangeable. This highlights the importance of selecting appropriate balance tests. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Xiang Shaohua; Deng Xiaopeng; Song Kehui; Wen Wei; Shi Zhengang
2011-01-01
We investigate the entanglement dynamics of two electron-spin qubits in the quantum-dot (QD)-microcavity system in the large-detuning limit and subjected to two different noise sources: electron-spin dephasing and relaxation. We show that when one of the two dots is prepared initially in the excited state, the created entanglement exhibits oscillatory behavior at the beginning of evolution and then completely disappears over time. For two QDs that are initially in either the Einstein-Podolsky-Rosen-Bell states or the Werner states, their entanglement evolution exhibits the same behavior in the presence of pure dephasing, but is completely different under the relaxation process. We also show that the interdot interaction induced by a single-mode cavity field does not contribute to the dynamics of entanglement for these Bell states and Werner states.
Evaluating a nurse mentor preparation programme.
Gray, Olivia; Brown, Donna
Following the introduction of a regional nurse mentor preparation programme, research was undertaken within a health and social care trust to explore both the trainee mentors' and their supervisors' perception of this new programme. A qualitative study involving focus groups was undertaken. The focus groups comprised a total of twelve participants including five trainee mentors and seven supervisors (experienced mentors) who had recently completed a mentor preparation programme. Data were analysed using Braun and Clarke's thematic analysis. Three themes were identified from the data: personal investment (including the emotional impact of mentoring) contextual perceptions (environmental factors such as time) and intellectual facets (related to personal and professional growth). Comprehensive preparation for mentors appears to be effective in developing mentors with the ability to support nursing students in practice. However, further study is required to explore how to support mentors to balance the demands of the mentoring role with the delivery of patient care.
[Balance trainability using the Nintendo Wii balance board in sportive people].
Paukowits, S; Stöggl, T
2014-03-01
A multivariable training has a positive impact on balance skills and risk of injury. To date the effect of this training using the Nintendo Wii balance board in sportive people has not yet been investigated. The aim of this study was to investigate whether training with the Nintendo Wii balance board can improve balance skills. 20 people were randomized into a control and an intervention group each with 10 people who performed a unilateral stance test with eyes open and closed as well as the star excursion balance test before and after the intervention. The control group completed their usual sports and the intervention group an adjunct training with the Nintendo Wii balance board for 4 weeks. Adjunct Training using the Nintendo Wii Balance Board did not improve sportive people's balance skills significantly. The intervention group, however, attained better results in the star excursion balance test, whereas the control group did not show any changes. The unilateral stance tests did not provide significant differences before and after training within both groups. The use of the Nintendo Wii balance board should be further investigated by employing individual difficulty levels. © Georg Thieme Verlag KG Stuttgart · New York.
Balancing a Mixed-Model Assembly System in the Footwear Industry
Sadeghi , Parisa; Rebelo , Rui ,; Soeiro Ferreira , José
2017-01-01
Part 7: Operations Planning, Scheduling and Control; International audience; Portuguese footwear industry has improved dramatically to become one of the main world players. This work is part of a project in cooperation with a large footwear company, operating a new automated assembly equipment, integrating various lines. Balancing such lines implies going from an almost manual preparation executed by experienced operators, to a planning supported by optimisation systems. These complex mixed-m...
DEFF Research Database (Denmark)
Walther-Hansen, Mads
2016-01-01
is not thoroughly understood. In this paper I treat balance as a metaphor that we use to reason about several different actions in music production, such as adjusting levels, editing the frequency spectrum or the spatiality of the recording. This study is based on an exploration of a linguistic corpus of sound......This paper explores the concept of balance in music production and examines the role of conceptual metaphors in reasoning about audio editing. Balance may be the most central concept in record production, however, the way we cognitively understand and respond meaningfully to a mix requiring balance...
Information Technology Investment Strategy Planning: Balance Scorecard Approach
Directory of Open Access Journals (Sweden)
Henny Hendarti
2011-05-01
Full Text Available Purpose of this research are to prepare the IT investment strategy using Balanced Scorecard approach in the company where the appropriate planning of this IT investment strategy can maximize the competitive benefit in the company, and it also to recommended a strategy of IT investment that can be implemented and measure the rate of return from the IT investment in the company. Research Method used book studies, field studies, and analysis system. Book studies from the books and journal. Field studies done by observation, interview, and questioner, and analysis system done by analyzed the ongoing system in the company. The result from this analysis is a recommendation in investment IT such as sales module, payment module, and report module. Then for the conclusion, this information technology investment planning can be develop to another investment implementation such authorized website of the company and using PDA (Personal Digital AssistantIndex Terms - Planning, Information Technology, Investment, Balance Scorecard
FINANCIAL BALANCE AND LOANS OF THE SHAREHOLDERS TO THE COMPANY
Directory of Open Access Journals (Sweden)
Rus Luminita
2012-07-01
Full Text Available The present analyses, based on a case study show the influence on the financial balance of the loans from shareholders , taking into account the accounting treatment of loans. We do not know that the Romanian economic literature to be treated that aspect. That is why we consider the study as being useful to managers, members, shareholders, and all business partners to form the economic decisions. The purpose of this financial analysis is to examine critically the accounting and financial information ofered by the companies to assess their performance and their financial position (Laurence Le Gallo. The financial position of firms is assessed based on the financial structure and financial balance. In a same time the financial balance is approached from a static perspective based on the: net situation, working capital, necessary of working capital, net treasury. The present analyses deals with financial balance in a static manner based on these four indicators listed. The sources of data for the analysis of financial balance are offered mainly in the financial statement. This document has been used data from a company that is engaged in the carriage of goods. Analysis was made over a period of five years. The present analysis showed that financial balance is influenced by the way that the shareholders loans to the company are treated by including them in long-term debt or short-term. Reprocessing of loans and their inclusion in long-term debt, changes the perspective on financial balance showing that on the long-term company has a stable balance. These aspects require preparation of loan agreements with associates as loans work in reality. The contracts must to highlight the progress of the loan on the long term and not to be extended or remodeled the short-term contracts. Of course, there are always solutions to improve the financial balance and in this way the financial position and the performance of the company. However, the proposed solutions
Energy balance at a crossroads: translating the science into action.
Manore, Melinda M; Brown, Katie; Houtkooper, Linda; Jakicic, John; Peters, John C; Smith Edge, Marianne; Steiber, Alison; Going, Scott; Gable, Lisa Guillermin; Krautheim, Ann Marie
2014-07-01
One of the major challenges facing the United States is the high number of overweight and obese adults and the growing number of overweight and unfit children and youth. To improve the nation's health, young people must move into adulthood without the burden of obesity and its associated chronic diseases. To address these issues, the American College of Sports Medicine, the Academy of Nutrition and Dietetics, and the US Department of Agriculture/Agriculture Research Service convened an expert panel meeting in October 2012 titled "Energy Balance at a Crossroads: Translating the Science into Action." Experts in the fields of nutrition and exercise science came together to identify the biological, lifestyle, and environmental changes that will most successfully help children and families attain and manage energy balance and tip the scale toward healthier weights. Two goals were addressed: 1) professional training and 2) consumer/community education. The training goal focused on developing a comprehensive strategy to facilitate the integration of nutrition and physical activity (PA) using a dynamic energy balance approach for regulating weight into the training of undergraduate and graduate students in dietetics/nutrition science, exercise science/PA, and pre-K-12 teacher preparation programs and in training existing cooperative extension faculty. The education goal focused on developing strategies for integrating dynamic energy balance into nutrition and PA educational programs for the public, especially programs funded by federal/state agencies. The meeting expert presenters and participants addressed three key areas: 1) biological and lifestyle factors that affect energy balance, 2) undergraduate/graduate educational and training issues, and 3) best practices associated with educating the public about dynamic energy balance. Specific consensus recommendations were developed for each goal.
Variance reduction techniques for 14 MeV neutron streaming problem in rectangular annular bent duct
Energy Technology Data Exchange (ETDEWEB)
Ueki, Kotaro [Ship Research Inst., Mitaka, Tokyo (Japan)
1998-03-01
Monte Carlo method is the powerful technique for solving wide range of radiation transport problems. Its features are that it can solve the Boltzmann`s transport equation almost without approximation, and that the complexity of the systems to be treated rarely becomes a problem. However, the Monte Carlo calculation is always accompanied by statistical errors called variance. In shielding calculation, standard deviation or fractional standard deviation (FSD) is used frequently. The expression of the FSD is shown. Radiation shielding problems are roughly divided into transmission through deep layer and streaming problem. In the streaming problem, the large difference in the weight depending on the history of particles makes the FSD of Monte Carlo calculation worse. The streaming experiment in the 14 MeV neutron rectangular annular bent duct, which is the typical streaming bench mark experiment carried out of the OKTAVIAN of Osaka University, was analyzed by MCNP 4B, and the reduction of variance or FSD was attempted. The experimental system is shown. The analysis model by MCNP 4B, the input data and the results of analysis are reported, and the comparison with the experimental results was examined. (K.I.)
Advances in pharmacotherapy for treating female sexual dysfunction.
Nappi, Rossella E; Cucinella, Laura
2015-04-01
'Female sexual dysfunction' (FSD) is an umbrella term comprising a range of common disorders, including hypoactive sexual desire, reduced subjective and/or physical genital arousal (poor sensation, vasocongestion, lubrication), sexual pain and inability to achieve orgasm/satisfaction, which are multidimensional by nature and often coexisting. Psychological and contextual factors have a significant influence on organic components of sexual response and behavior and a tailored medical approach to sexual symptoms is inevitably limited. The paper reports the most recent advances in pharmacotherapy for women taking into account the biopsychosocial model. Hormone therapy, including estrogens, testosterone, tibolone and dehydroepiandrosterone, are discussed in term of efficacy and safety in postmenopausal women both for female sexual interest/arousal disorder (FSIAD) and genito-pelvic pain/penetration disorder. Ospemifene, a selective estrogen receptor modulator, approved to treat dyspareunia at menopause, is also discussed. Data on psychoactive agents for treatment of FSIAD in premenopausal women are discussed, including the potential use of on-demand combined hormonal (testosterone) and non-hormonal (buspirone or sildenafil) treatments to address possible neurophysiological profiles of women. We are still waiting for an approved pharmacotherapy for FSD. This is not the result of gender inequality in sexual medicine, but it reflects the need of balancing benefits and risks in order to provide effective and safe treatments to women of any age.
Tax balance in agribusiness as a type of special balance
Directory of Open Access Journals (Sweden)
Milojević Ivan
2015-01-01
Full Text Available The tendency of continuous compounding of business processes inevitably leads to application of increasingly complex instruments for the purposes of financial reporting in agribusiness. In this system the existential place and role of individual elements that alter the existing and acquire new functions comes into question. Balancing implies a regulated and consistent system in which every change leads to the creation of new relations and changing already established relationships. In this regard, in this paper we will focus on the place and role of tax balance in the group of special balances in agribusiness, as a very significant group of accounting instruments. Displaying information for users and situations in which they are used, balances gain their place in this classification. For the purposes of applying financial instruments, referring primarily to balances in agribusiness, it is necessary to know the way of their classification according to their functions. From this aspect, tax balance in agribusiness is a specific report, both in terms of its formal and material structure, which gives it the basis to belong to ordinary as well as special types of balances in agribusiness.
A question of balance: Kinetic balance for electrons and positrons
International Nuclear Information System (INIS)
Dyall, Kenneth G.
2012-01-01
Graphical abstract: Kinetic balance for both electrons and positrons is achieved by applying the correct relation for positive and negative energy states separately and then using the electron and positron eigensolutions from the separate diagonalizations of the Hamiltonian as a dual basis. Highlights: ► Kinetic balance for electrons and positrons is achieved in a dual atomic basis. ► Dual atomic balance alleviates, but does not eliminate, energy prolapse. ► Positron affinities converge quicker with basis set size with dual atomic balance. - Abstract: The kinetic balance criterion used in current relativistic basis set codes is satisfied by the electron solutions of the Dirac equation, but not the positron solutions. A proposal for applying kinetic balance to both sets of solutions is presented. The method is applied along with “normal” kinetic balance to one-electron systems, to investigate its possible relation to prolapse, and to the positron affinity of F − , to investigate the kinetic energy deficiency for positron solutions. The new method reduces but does not eliminate prolapse for energy-optimized basis sets, and provides faster and smoother convergence with basis set size for the positron affinity.
Wåhlin-Jacobsen, Sarah; Kristensen, Ellids; Pedersen, Anette Tønnes; Laessøe, Nanna Cassandra; Cohen, Arieh S; Hougaard, David M; Lundqvist, Marika; Giraldi, Annamaria
2017-03-01
The female sexual response is complex and influenced by several biological, psychological, and social factors. Testosterone is believed to modulate a woman's sexual response and desire, because low levels are considered a risk factor for impaired sexual function, but previous studies have been inconclusive. To investigate how androgen levels and psychosocial factors are associated with female sexual dysfunction (FSD), including hypoactive sexual desire disorder (HSDD). The cross-sectional study included 428 premenopausal women 19 to 58 years old who completed a questionnaire on psychosocial factors and had blood sampled at days 6 to 10 in their menstrual cycle. Logistic regression models were built to test the association among hormone levels, psychosocial factors, and sexual end points. Five different sexual end points were measured using the Female Sexual Function Index and the Female Sexual Distress Scale: impaired sexual function, sexual distress, FSD, low sexual desire, and HSDD. Serum levels of total and free testosterone, androstenedione, dehydroepiandrosterone sulfate, and androsterone glucuronide were analyzed using mass spectrometry. After adjusting for psychosocial factors, women with low sexual desire had significantly lower mean levels of free testosterone and androstenedione compared with women without low sexual desire. None of the androgens were associated with FSD in general or with HSDD in particular. Relationship duration longer than 2 years and mild depressive symptoms increased the risk of having all the sexual end points, including FSD in general and HSDD in particular in multivariate analyses. In this large cross-sectional study, low sexual desire was significantly associated with levels of free testosterone and androstenedione, but FSD in general and HSDD in particular were not associated with androgen levels. Length of relationship and depression were associated with FSD including HSDD. Wåhlin-Jacobsen S, Kristensen E, Tønnes Pedersen A
Hong, Jiasheng; Medina, Francisco; Martiacuten, Ferran
2018-01-01
This book presents and discusses strategies for the design and implementation of common-mode suppressed balanced microwave filters, including, narrowband, wideband, and ultra-wideband filters This book examines differential-mode, or balanced, microwave filters by discussing several implementations of practical realizations of these passive components. Topics covered include selective mode suppression, designs based on distributed and semi-lumped approaches, multilayer technologies, defect ground structures, coupled resonators, metamaterials, interference techniques, and substrate integrated waveguides, among others. Divided into five parts, Balanced Microwave Filters begins with an introduction that presents the fundamentals of balanced lines, circuits, and networks. Part 2 covers balanced transmission lines with common-mode noise suppression, including several types of common-mode filters and the application of such filters to enhance common-mode suppression in balanced bandpass filters. Next, Part 3 exa...
Recent advances in female sexual dysfunction.
Davis, A R
2000-06-01
Female sexuality has received little scientific study. Recently, increased interest in this field has generated new research in the epidemiology, pathophysiology, and pharmacotherapy of female sexual dysfunction (FSD). A new FSD classification system has been proposed. Although sexual difficulties are highly prevalent among women, the degree of associated distress is unknown. Risk factors for FSD are probably both psychologic and physiologic. Aging or menopause is associated with lubrication difficulties, which can be treated with hormone replacement. Hysterectomy seems more likely to result in improvement rather then deterioration of sexual functioning. Depression may be a predictor of sexual dysfunction after hysterectomy. Vasoactive agents are currently being evaluated as treatment for female sexual arousal disorder. The most important advance in the study of female sexual function is the recent surge of interest in this relatively unexplored field.
Wii Fit Balance Board Playing Improves Balance and Gait in Parkinson Disease
Mhatre, Priya V.; Vilares, Iris; Stibb, Stacy M.; Albert, Mark V.; Pickering, Laura; Marciniak, Christina M.; Kording, Konrad; Toledo, Santiago
2014-01-01
Objective To assess the effect of exercise training by using the Nintendo Wii Fit video game and balance board system on balance and gait in adults with Parkinson disease (PD). Design A prospective interventional cohort study. Setting An outpatient group exercise class. Participants Ten subjects with PD, Hoehn and Yahr stages 2.5 or 3, with a mean age of 67.1 years; 4 men, 6 women. Interventions The subjects participated in supervised group exercise sessions 3 times per week for 8 weeks by practicing 3 different Wii balance board games (marble tracking, skiing, and bubble rafting) adjusted for their individualized function level. The subjects trained for 10 minutes per game, a total of 30 minutes training per session. Main Outcome Measurements Pre-and postexercise training, a physical therapist evaluated subjects’ function by using the Berg Balance Scale, Dynamic Gait Index, and Sharpened Romberg with eyes open and closed. Postural sway was assessed at rest and with tracking tasks by using the Wii balance board. The subjects rated their confidence in balance by using the Activities-specific Balance Confidence scale and depression on the Geriatric Depression Scale. Results Balance as measured by the Berg Balance Scale improved significantly, with an increase of 3.3 points (P = .016). The Dynamic Gait Index improved as well (mean increase, 2.8; P = .004), as did postural sway measured with the balance board (decreased variance in stance with eyes open by 31%; P = .049). Although the Sharpened Romberg with eyes closed increased by 6.85 points and with eyes opened by 3.3 points, improvements neared significance only for eyes closed (P = .07 versus P = .188). There were no significant changes on patient ratings for the Activities-specific Balance Confidence (mean decrease, −1%; P = .922) or the Geriatric Depression Scale (mean increase, 2.2; P = .188). Conclusions An 8-week exercise training class by using the Wii Fit balance board improved selective measures of
International Nuclear Information System (INIS)
Jiang Shuo; Luo Xiaoming; Chen Liqing; Ning Bo; Chen Shuai; Wang Jingyang; Zhong Zhiping; Pan Jianwei
2009-01-01
We report a prolonged coherence time of the collective spin wave of a thermal 87 Rb atomic ensemble in a paraffin-coated cell. The spin wave is prepared through a stimulated Raman process. The long coherence time is achieved by prolonging the lifetime of the spins with paraffin coating and minimize dephasing with optimal experimental configuration. The observation of the long-time-delayed-stimulated Stokes signal in the writing process suggests the prolonged lifetime of the prepared spins; a direct measurement of the decay of anti-Stokes signal in the reading process shows the coherence time is up to 300 μs after minimizing dephasing. This is 100 times longer than the reported coherence time in the similar experiments in thermal atomic ensembles based on the Duan-Lukin-Cirac-Zoller and its improved protocols. This prolonged coherence time sets the upper limit of the memory time in quantum repeaters based on such protocols, which is crucial for the realization of long-distance quantum communication. The previous reported fluorescence background in the writing process due to collision in a sample cell with buffer gas is also reduced in a cell without buffer gas.
Work-life balance: history, costs, and budgeting for balance.
Raja, Siva; Stein, Sharon L
2014-06-01
The concept and difficulties of work-life balance are not unique to surgeons, but professional responsibilities make maintaining a work-life balance difficult. Consequences of being exclusively career focused include burn out, physical, and mental ailments. In addition, physician burn out may hinder optimal patient care and incur significant costs on health care in general. Assessing current uses of time, allocating goals catered to an individual surgeon, and continual self-assessment may help balance time, and ideally will help prevent burn out.
Wii Fit balance board playing improves balance and gait in Parkinson disease.
Mhatre, Priya V; Vilares, Iris; Stibb, Stacy M; Albert, Mark V; Pickering, Laura; Marciniak, Christina M; Kording, Konrad; Toledo, Santiago
2013-09-01
To assess the effect of exercise training by using the Nintendo Wii Fit video game and balance board system on balance and gait in adults with Parkinson disease (PD). A prospective interventional cohort study. An outpatient group exercise class. Ten subjects with PD, Hoehn and Yahr stages 2.5 or 3, with a mean age of 67.1 years; 4 men, 6 women. The subjects participated in supervised group exercise sessions 3 times per week for 8 weeks by practicing 3 different Wii balance board games (marble tracking, skiing, and bubble rafting) adjusted for their individualized function level. The subjects trained for 10 minutes per game, a total of 30 minutes training per session. Pre-and postexercise training, a physical therapist evaluated subjects' function by using the Berg Balance Scale, Dynamic Gait Index, and Sharpened Romberg with eyes open and closed. Postural sway was assessed at rest and with tracking tasks by using the Wii balance board. The subjects rated their confidence in balance by using the Activities-specific Balance Confidence scale and depression on the Geriatric Depression Scale. Balance as measured by the Berg Balance Scale improved significantly, with an increase of 3.3 points (P = .016). The Dynamic Gait Index improved as well (mean increase, 2.8; P = .004), as did postural sway measured with the balance board (decreased variance in stance with eyes open by 31%; P = .049). Although the Sharpened Romberg with eyes closed increased by 6.85 points and with eyes opened by 3.3 points, improvements neared significance only for eyes closed (P = .07 versus P = .188). There were no significant changes on patient ratings for the Activities-specific Balance Confidence (mean decrease, -1%; P = .922) or the Geriatric Depression Scale (mean increase, 2.2; P = .188). An 8-week exercise training class by using the Wii Fit balance board improved selective measures of balance and gait in adults with PD. However, no significant changes were seen in mood or
Modified Unzipping Technique to Prepare Graphene Nano-Sheets
Al-Tamimi, B. H.; Farid, S. B. H.; Chyad, F. A.
2018-05-01
Graphene nano-sheets have been prepared via unzipping approach of multiwall carbon nanotubes (MWCNTs). The method includes two chemical-steps, in which a multi-parameter oxidation step is performed to achieve unzipping the carbon nanotubes. Then, a reduction step is carried out to achieve the final graphene nano-sheets. In the oxidation step, the oxidant material was minimized and balanced with longer curing time. This modification is made in order to reduce the oxygen-functional groups at the ends of graphene basal planes, which reduce its electrical conductivity. In addition, a similar adjustment is achieved in the reduction step, i.e. the consumed chemicals is reduced which make the overall process more economic and eco-friendly. The prepared nano-sheets were characterized by atomic force microscopy, scanning electron microscopy, and Raman spectroscopy. The average thickness of the prepared graphene was about 5.23 nm.
Goble, Daniel J; Manyak, Kristin A; Abdenour, Thomas E; Rauh, Mitchell J; Baweja, Harsimran S
2016-04-01
As recently dictated by the American Medical Society, balance testing is an important component in the clinical evaluation of concussion. Despite this, previous research on the efficacy of balance testing for concussion diagnosis suggests low sensitivity (∼30%), based primarily on the popular Balance Error Scoring System (BESS). The Balance Tracking System (BTrackS, Balance Tracking Systems Inc., San Diego, CA, USA) consists of a force plate (BTrackS Balance Plate) and software (BTrackS Sport Balance) which can quickly (balance testing with gold standard accuracy. The present study aimed to determine the sensitivity of the BTrackS Balance Plate and Sports Balance Software for concussion diagnosis. Cross-Sectional Study. Preseason baseline balance testing of 519 healthy Division I college athletes playing sports with a relatively high risk for concussions was performed with the BTrackS Balance Test. Testing was administered by certified athletic training staff using the BTrackS Balance Plate and Sport Balance software. Of the baselined athletes, 25 later experienced a concussion during the ensuing sport season. Post-injury balance testing was performed on these concussed athletes within 48 of injury and the sensitivity of the BTrackS Balance Plate and Sport Balance software was estimated based on the number of athletes showing a balance decline according to the criteria specified in the Sport Balance software. This criteria is based on the minimal detectable change statistic with a 90% confidence level (i.e. 90% specificity). Of 25 athletes who experienced concussions, 16 had balance declines relative to baseline testing results according to the BTrackS Sport Balance software criteria. This corresponds to an estimated concussion sensitivity of 64%, which is twice as great as that reported previously for the BESS. The BTrackS Balance Plate and Sport Balance software has the greatest concussion sensitivity of any balance testing instrument reported to date. Level 2
Female sexual dysfunction in patients with endometriosis: Indian scenario
Directory of Open Access Journals (Sweden)
Vineet V Mishra
2016-01-01
Full Text Available Background: Female sexual dysfunction (FSD in Indian women is often overlooked due to cultural beliefs and considered as social taboos. Sexuality is an important and integral part of life. There are many causes of sexual dysfunction, but the prevalence of FSD in endometriotic patients is still underdiagnosed. Materials and Methods: Study design - Cross-sectional observational study conducted at tertiary care center, from June 2015 to March 2016. Sample size - Fifty-one patients in reproductive age group (18-47 years who were diagnosed with endometriosis on diagnostic laparoscopy were included. Methods - FSD was assessed with a detailed 19-item female sexual function index questionnaire. All six domains of sexual dysfunction, i.e., desire, arousal, lubrication, orgasm, satisfaction, and pain were studied. Exclusion - Patients with other gynecological, medical or surgical history were excluded. Results: Out of 51 patients with endometriosis, 47.06% of patients had sexual dysfunction. With the increase in staging of endometriosis, sexual dysfunction prevalence is also rising. FSD was 100% in patients with severe endometriosis as compared to 33.33% in minimal endometriosis. Conclusion: Every individual deserves good sexual life. The sexual dysfunction associated with endometriosis should also be taken into consideration while managing these patients.
International Nuclear Information System (INIS)
Balagurov, A.M.; Bokuchava, G.D.; Papushkin, I.V.; Sumin, V.V.; Venter, A.M.
2010-01-01
Neutron diffraction is widely used for investigations of residual and applied stresses in bulk materials and components. The most important factor in these investigations is the high penetration depth of neutrons (up to 2 cm for steel). At the IBR-2 pulsed reactor in Dubna the Fourier stress diffractometer (FSD) has been constructed to optimize the internal stress measurements. The FSD design satisfies the requirements of high luminosity, high resolution and specific sample environment. The collimator system guarantees a minimum gauge volume of 2x2x2 mm. A mechanical testing machine allows in-situ tension or compression measurements up to a load of 20 kN and sample temperatures up to 800 deg C. In the paper the current status of FSD is reported and potentialities are demonstrated with several examples of investigations performed
Energy Technology Data Exchange (ETDEWEB)
Lavalley E, C.; Delgado S, B.; Ruiz J, A.; Zambrano A, F
1991-10-15
The standards preparation requires of certain basic principles, some of which are described in this work, which was made with the purpose of establishing the most appropriate conditions for the preparation of standards of triiodothyronine, thyroxine and thyrotropin to be used in radioimmunoanalysis essays. The diverse standards show a balanced displacement, that which is observed in the graphs presented in this work. (Author)
International Nuclear Information System (INIS)
Libeyre, P.; Duchateau, J.L.; Gravil, B.; Tena, E.; Henry, D.; Journeaux, J.Y.
2005-01-01
The toroidal field (TF) system of TORE SUPRA (TS) is superconducting. After 16 years of operation it is possible to give an overview of the experience gained on a large superconducting system integrated in a large Tokamak. Quantitative data will be given, about the TF system for the cryogenic system and for the magnet system as well, concerning the number of plasmas shots and the availability of the machine. The origin and the number of breakdowns or incidents will be described, with emphasis on cryogenics and associated repairs and changes on the system components along the time. As concerns the behaviour during operation, the fast safety discharges (FSD) in operation are of particular interest for the Tokamak operation, as they interrupt it for a significant time of the order of 1 h. This aspect is particularly documented. The approach followed to decrease the number of these FSD will be reported and explained. The TORE SUPRA Tokamak was the first important application of superconductivity in plasma physics on a large scale. Overall, despite the differences in design and size, the accumulated experience over 16 years of operation is a useful tool to prepare the manufacture and the operation of the ITER magnets
Part of being an Active, More Powerful You means finding balance in your daily life: taking on the Must-dos and finding time for some Should Dos and Want-to-Dos. Sometimes, emotions and commitments can come into play and upset the balance.
Wouters, Cas
2007-01-01
The concept of the lust-balance refers to the social organization and accompanying social codes (ideals and practices) regarding the relationship between the longing for sexual gratification and the longing for enduring relational intimacy. It thus draws attention to the balance between emotive
Creation of virtual reality stimulus for a psychophysiological body balance measurement
Directory of Open Access Journals (Sweden)
Tero Alatalo
2008-11-01
Full Text Available Tero Alatalo1, Martti Juhola1, Veikko Surakka1,2, Timo Tossavainen11Department of Computer Sciences, University of Tampere, Tampere, Finland; 2Department of Clinical Neurophysiology, Tampere University Hospital, Tampere, FinlandAbstract: Virtual reality methods and equipment can be used to create stimulations for several psychophysiological measurements. Such stimulations can be flexibly modified and their versatility is wide; in principle even such could be prepared that are not possible in the real physical world like virtual flying in the space. For the generation of virtual reality stimulations we constructed a three-dimensional (3D graphics engine to measure body balance variations in response to emotional stimulation. The stimulation was implemented as a virtual reality scene, where the subject watched a street view with a human figure approaching the subject at a constant speed. The functioning of the system was tested by measuring body balance variations while the approaching figure’s facial expression was angry, neutral, or happy. The results showed that our young, healthy subjects were slightly, but still statistically significantly affected by the stimulation of the approaching figure. Thus, the whole system offers a tool for controlled experimental studies for analyzing body balance, for example, during stimulating approach-withdrawal behavior. There are several opportunities to further develop new visual psychophysiological stimulations and test forms.Keywords: virtual reality stimulations, signal analysis, body balance measurements, approachwithdrawal behavior, emotions
Balance and Self-Efficacy of Balance in Children with CHARGE Syndrome
Haibach, Pamela S.; Lieberman, Lauren J.
2013-01-01
Introduction: Balance is a critical component of daily living, because it affects all movements and the ability to function independently. Children with CHARGE syndrome have sensory and motor impairments that could negatively affect their balance and postural control. The purpose of the study presented in this article was to assess the balance and…
Brus, D.J.
2015-01-01
In balanced sampling a linear relation between the soil property of interest and one or more covariates with known means is exploited in selecting the sampling locations. Recent developments make this sampling design attractive for statistical soil surveys. This paper introduces balanced sampling
The Narrow Ridge Balance Test : A measure for one-leg lateral balance control
Curtze, Carolin; Postema, Klaas; Akkermans, Hilda W.; Otten, Bert; Hof, At L.
2010-01-01
The assessment of balance capacity for people with widely different balance abilities is an important issue in clinical practice We propose the narrow ridge balance test as a sensitive tool to assess one-leg balance capacity In this test participants are asked to perform single-leg stance on ridges
Sibley, Kathryn M.; Straus, Sharon E.; Inness, Elizabeth L.; Salbach, Nancy M.
2011-01-01
Background Balance impairment is a significant problem for older adults, as it can influence daily functioning. Treating balance impairment in this population is a major focus of physical therapist practice. Objective The purpose of this study was to document current practices in clinical balance assessment and compare components of balance assessed and measures used across practice areas among physical therapists. Design This was a cross-sectional study. Methods A survey questionnaire was mailed to 1,000 practicing physical therapists in Ontario, Canada. Results Three hundred sixty-nine individuals completed the survey questionnaire. More than 80% of respondents reported that they regularly (more than 60% of the time) assessed postural alignment, static and dynamic stability, functional balance, and underlying motor systems. Underlying sensory systems, cognitive contributions to balance, and reactive control were regularly assessed by 59.6%, 55.0%, and 41.2% of the respondents, respectively. The standardized measures regularly used by the most respondents were the single-leg stance test (79.1%), the Berg Balance Scale (45.0%), and the Timed “Up & Go” Test (27.6%). There was considerable variation in the components of balance assessed and measures used by respondents treating individuals in the orthopedic, neurologic, geriatric, and general rehabilitation populations. Limitations The survey provides quantitative data about what is done to assess balance, but does not explain the factors influencing current practice. Conclusions Many important components of balance and standardized measures are regularly used by physical therapists to assess balance. Further research, however, is needed to understand the factors contributing to the relatively lower rates of assessing reactive control, the component of balance most directly responsible for avoiding a fall. PMID:21868613
Balci, Nilay Çömük; Tonga, Eda; Gülşen, Mustafa
2013-09-01
This pilot study aimed to investigate the effect of balance training by Tetraks Interactive Balance System (TIBS) on balance and fall risk in patients with mild to moderate Parkinson's disease. Four patients with Parkinson's disease between the ages of 56 and 70 years (61.25±6.70) were applied balance training for 3 weeks by TIBS. Sociodemographic features and physical properties of the subjects were recorded. Their motor performance was evaluated by the Unified Parkinson's Disease Rating Scale (UPDRS), balance was measured using the Berg Balance Scale (BBS), Functional Reach Test (FRT), Timed Up and Go Test (TUG), and the Standing on One Leg Balance Test (SOL) and, their fall risks were evaluated by TIBS. Evaluations were performed twice, before and after treatment. Following training, Parkinson's patients showed improvements in UPDRS, TUG, BBS, FRT, SOL and fall risk. Balance training by TIBS has positive effects on balance and decreases fall risk in Parkinson's disease patients.
2003-12-01
The 'work-life balance' and flexible working are currently key buzz terms in the NHS. Those looking for more information on these topics should visit Flexibility at www.flexibility.co.uk for a host of resources designed to support new ways of working, including information on flexible workers and flexible rostering, the legal balancing act for work-life balance and home working.
Generation Adequacy Report on the electricity supply-demand balance in France - 2011 Edition
International Nuclear Information System (INIS)
2012-01-01
Working under the aegis of public authorities, RTE periodically prepares and makes public a multi-annual forecast of the electricity supply-demand balance in France, as required by law. The purpose of this report is to evaluate the ability of the French power system, in interaction with neighbouring systems, to properly satisfy demand, based on the likeliest scenarios for trends in demand, demand response and generation
Yang, Chengdong; Fang, Renren; Yang, Xiongfa; Chen, Ru; Gao, Jianhua; Fan, Hanghong; Li, Hongxiang; Hu, Wenping
2018-04-04
It is very important to develop ambipolar field effect transistors to construct complementary circuits. To obtain balanced hole- and electron-transport properties, one of the key issues is to regulate the energy levels of the frontier orbitals of the semiconductor materials by structural tailoring, so that they match well with the electrode Fermi levels. Five conjugated copolymers were synthesized and exhibited low LUMO energy levels and narrow bandgaps on account of the strong electron-withdrawing effect of the carbonyl groups. Polymer thin film transistors were prepared by using a solution method and exhibited high and balanced hole and electron mobility of up to 0.46 cm 2 V -1 s -1 , which suggested that these copolymers are promising ambipolar semiconductor materials. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Generation SMH (shaking my head): Work-Life Balance and Generational Realities
Jones, M. B.
2012-12-01
Many Federal Agencies have 'workforce development' programs that focus on preparing the next generation of scientists and engineers at the graduate and undergraduate level. Several of the science Agencies (e.g., NASA, NOAA, EPA, etc.), have programs that support students in many of the diverse disciplines that are unique to those Agency missions. While financial support certainly is critical to assist students in the STEM and other fields, professional development is just as important to equip students with a balanced arsenal of tactics to be successful professionals in the STEM workforce of today. Finding life balance as one moves through a STEM career path poses unique challenges that require a certain skill set that is not always intuitive. Some of those challenges include: selecting grad or post doc positions (negotiating to a family's advantage); balancing work and family commitments; and dealing with employer/advisor perceptions and expectations. For current and future generations in STEM, many of the above mentioned challenges require additional skill in negotiating interactions with individuals from other generations. Understanding perceptions and managing expectations are learnable skills that do not necessarily come with project funding.
Wong, Alice M K; Lan, Ching
2008-01-01
Balance function begins to decline from middle age on, and poor balance function increases the risk of fall and injury. Suitable exercise training may improve balance function and prevent accidental falls. The coordination of visual, proprioceptive, vestibular and musculoskeletal system is important to maintain balance. Balance function can be evaluated by functional balance testing and sensory organization testing. Tai Chi Chuan (TC) is a popular conditioning exercise in the Chinese community, and recent studies substantiate that TC is effective in balance function enhancement and falls prevention. In studies utilizing functional balance testing, TC may increase the duration of one-leg standing and the distance of functional reach. In studies utilizing sensory organization testing, TC improves static and dynamic balance, especially in more challenging sensory perturbed condition. Therefore, TC may be prescribed as an alternative exercise program for elderly subjects or balance-impaired patients. Participants can choose to perform a complete set of TC or selected movements according to their needs. In conclusion, TC may improve balance function and is appropriate for implementation in the community.
Beyond the "Ivory Tower": Restoring the Balance of Private and Public Purposes of General Education
Cantor, Nancy; Englot, Peter
2013-01-01
We in higher education have allowed the balance of the private and public purposes of liberal education to become skewed in our angst over fully embracing a central role in restoring prosperity and preparing our increasingly diverse population for the evolving responsibility of mending our fraying democracy. As we consider how best to reshape…
Construction of a new watt balance with the goal to realize the kilogram in the US
Schlamminger, Stephan; Haddad, Darine; Seifert, Frank; Chao, Leon; Newell, David; Pratt, Jon
2015-04-01
A watt balance is a mechanical device that compares mechanical power to electrical power. Since electrical power is measured using quantum physics by employing the Josephson effect and the Quantum Hall effect, electrical power can be measured as a product of a known factor, two frequencies, and the Planck constant h. Mechanical power is given by mgv , where m is the mass of a weight, g the local acceleration, and v the velocity. Hence, the watt balance provides a link between mass and Planck's constant. Currently several watt balances worldwide are employed to measure h. A redefinition of the international system of units (SI) is currently in discussion and may become reality as early as 2018. In the new SI, the numerical value of the Planck constant will be fixed and the watt balance is a means to realize the unit of mass. Researchers at NIST are preparing for a new SI and we have started in 2011 with plans to design a new watt balance capable of realizing the kilogram with relative uncertainties of a few parts in 108. Construction of the new watt balance has started in 2014. In my talk, I will show some of the latest results achieved with this apparatus.
Balancing mechanism status: November 2009
International Nuclear Information System (INIS)
2009-01-01
RTE ensures the real-time balance between production and consumption and deals with congestion on the French electricity system. The Balancing Mechanism assists in the accomplishment of this task. As in many countries, and after extensive dialogue with representatives from the market's various players, RTE proposes a Balancing Mechanism in the form of a permanent and transparent system of calls for tender. The system is open to everyone and provides a real-time reserve of power that can be used for balancing either upward or downward. RTE takes advantage of these offers according to economic precedence, taking into account the system's operating conditions. It pays for them at the offer price. There are two types of offer: - Upward offer: increase in production, decrease in consumption, imports, - Downward offer: decrease in production, increase in consumption, exports. For a Balancing Entity, an offer systematically consists of: a balancing direction (upward/downward), a time period, a price that may vary according to six time slots. RTE publishes each month a Balancing Mechanism Report. which includes the following information: - energy volumes activated to ensure the balance of the system and to resolve congestion; - minimum and maximum prices of offers activated to balance the system; - daily trends calculated according to the predominant value of the overall upward or downward trend; - balancing shares by technology (nuclear, thermal, hydraulic); - characteristics of the five most activated balancing entities; - balances/imbalances accounts and production/consumption overcharge; - congestion curbing costs on the French electricity system; - energy volumes activated to ensure the balance of the system according to contracts between RTE and other Balance Responsible entities (UK, Belgium, Italy, Germany, Switzerland); - reliability of the provisional data supplied by RTE about the balancing trend; - availability of RTE's information services (planning, balancing
Balancing mechanism status: May 2009
International Nuclear Information System (INIS)
2009-01-01
RTE ensures the real-time balance between production and consumption and deals with congestion on the French electricity system. The Balancing Mechanism assists in the accomplishment of this task. As in many countries, and after extensive dialogue with representatives from the market's various players, RTE proposes a Balancing Mechanism in the form of a permanent and transparent system of calls for tender. The system is open to everyone and provides a real-time reserve of power that can be used for balancing either upward or downward. RTE takes advantage of these offers according to economic precedence, taking into account the system's operating conditions. It pays for them at the offer price. There are two types of offer: - Upward offer: increase in production, decrease in consumption, imports, - Downward offer: decrease in production, increase in consumption, exports. For a Balancing Entity, an offer systematically consists of: a balancing direction (upward/downward), a time period, a price that may vary according to six time slots. RTE publishes each month a Balancing Mechanism Report. which includes the following information: - energy volumes activated to ensure the balance of the system and to resolve congestion; - minimum and maximum prices of offers activated to balance the system; - daily trends calculated according to the predominant value of the overall upward or downward trend; - balancing shares by technology (nuclear, thermal, hydraulic); - characteristics of the five most activated balancing entities; - balances/imbalances accounts and production/consumption overcharge; - congestion curbing costs on the French electricity system; - energy volumes activated to ensure the balance of the system according to contracts between RTE and other Balance Responsible entities (UK, Belgium, Italy, Germany, Switzerland); - reliability of the provisional data supplied by RTE about the balancing trend; - availability of RTE's information services (planning, balancing
Balance evaluation in haemophilic preadolescent patients using Nintendo Wii Balance Board®.
Pérez-Alenda, S; Carrasco, J J; Aguilar-Rodríguez, M; Martínez-Gómez, L; Querol-Giner, M; Cuesta-Barriuso, R; Torres-Ortuño, A; Querol, F
2017-01-01
Alterations in the musculoskeletal system, especially in the lower limbs, limit physical activity and affect balance and walking. Postural impairments in haemophilic preteens could increase the risk of bleeding events and deteriorate the physical condition, promoting the progression of haemophilic arthropathy. This study aims to evaluate static postural balance in haemophilic children, assessed by means of the Wii Balance Board ® (WBB). Nineteen children with haemophilia and 19 without haemophilia aged 9-10 years, have participated in this study. Postural balance was assessed by performing four tests, each one lasting 15 s: bipodal eyes open (BEO), bipodal eyes closed (BEC), monopodal dominant leg (MD) and monopodal non-dominant leg (MND). Two balance indices, standard deviation of amplitude (SDA) and standard deviation of velocity (SDV) were calculated in the anterior-posterior (AP) and medial-lateral (ML) directions. Index values were higher in haemophilic group and the differences were statistically significant (P balance in the haemophilic cohort compared to the control group. Accordingly, physiotherapy programmes, physical activity and sports should be designed to improve the postural balance with the aim of preventing joint deterioration and improving quality of life. © 2016 John Wiley & Sons Ltd.
Androgens and Psychosocial Factors Related to Sexual Dysfunctions in Premenopausal Women∗
DEFF Research Database (Denmark)
Wåhlin-Jacobsen, Sarah; Kristensen, Ellids; Pedersen, Anette Tønnes
2017-01-01
a questionnaire on psychosocial factors and had blood sampled at days 6 to 10 in their menstrual cycle. Logistic regression models were built to test the association among hormone levels, psychosocial factors, and sexual end points. Main Outcome Measures Five different sexual end points were measured using...... duration longer than 2 years and mild depressive symptoms increased the risk of having all the sexual end points, including FSD in general and HSDD in particular in multivariate analyses. Conclusion In this large cross-sectional study, low sexual desire was significantly associated with levels of free...... testosterone and androstenedione, but FSD in general and HSDD in particular were not associated with androgen levels. Length of relationship and depression were associated with FSD including HSDD. Wåhlin-Jacobsen S, Kristensen E, Tønnes Pedersen A, et al. Androgens and Psychosocial Factors Related to Sexual Dysfunctions...
Structure-activity relationship of surfactant for preparing DMFC anodic catalyst
International Nuclear Information System (INIS)
Su Yi; Xue Xinzhong; Xu Weilin; Liu Changpeng; Xing Wei; Zhou Xiaochun; Tian Tian; Lu Tianhong
2006-01-01
Three kinds of surfactants as stabilizer were applied to the preparation of electrocatalysts for direct methanol fuel cell (DMFC). The catalysts have been characterized by examining their catalytic activities, morphologies and particle sizes by means of cyclic voltammetry, chronoamperometry, X-ray diffraction and transmission electron microscopy (TEM). It is found that the surfactants with different structures have a significantly influence on the catalyst shape and activity. The catalysts prepared with non-ionic surfactants as the stabilizer show higher activity for direct oxidation of methanol. The structure-activity relationship (SAR) analysis has been explored and the effect of hydrophile-lipophile balance (HLB value) has also been discussed
Klaassen, Maaike; Ter Kuile, Moniek M
2009-06-01
Although the relevance of cognitions has been implicated in the etiology, explanatory models, and treatment of female sexual pain disorders, an instrument that assesses vaginal penetration cognitions is nonexistent. The aim of this study was to develop and to investigate the psychometric properties of the Vaginal Penetration Cognition Questionnaire (VPCQ). The VPCQ was explicitly designed to assess cognitions regarding vaginal penetration in women with vaginismus and dyspareunia. A sample of 247 Dutch women with a female sexual dysfunction (FSD; 122 women with lifelong vaginismus and 125 women with dyspareunia) and 117 women without sexual complaints completed the questionnaire. Factor analyses were only conducted in the sample of women with FSD. Validation measures were conducted in both women with and without FSD. All women completed the VPCQ and several additional questions regarding biographic and complaint characteristics. Conduction of factor analyses yielded five subscales regarding cognitions about vaginal penetration: "control cognitions,"catastrophic and pain cognitions,"self-image cognitions,"positive cognitions," and "genital incompatibility cognitions." Reliability of these five VPCQ subscales ranged from 0.70 to 0.83, and the test-retest correlations were satisfactory. The five VPCQ subscales were reasonably stable across demographic variables and demonstrated good discriminant validity. All five subscales were able to detect significant differences between women with and without FSD. Additionally, the four subscales of the VPCQ concerning negative cognitions demonstrated the ability to differentiate between the two samples of women with FSD. Women with lifelong vaginismus reported lower levels of perceived penetration control and higher levels of catastrophic and pain cognitions, negative self-image cognitions, and genital incompatibility cognitions, when compared with women with dyspareunia. The present study indicates that the VPCQ is a valid and
Lee, Chin Yik; Cant, Stewart
2017-07-01
A premixed propane-air flame stabilised on a triangular bluff body in a model jet-engine afterburner configuration is investigated using large-eddy simulation (LES). The reaction rate source term for turbulent premixed combustion is closed using the transported flame surface density (TFSD) model. In this approach, there is no need to assume local equilibrium between the generation and destruction of subgrid FSD, as commonly done in simple algebraic closure models. Instead, the key processes that create and destroy FSD are accounted for explicitly. This allows the model to capture large-scale unsteady flame propagation in the presence of combustion instabilities, or in situations where the flame encounters progressive wrinkling with time. In this study, comprehensive validation of the numerical method is carried out. For the non-reacting flow, good agreement for both the time-averaged and root-mean-square velocity fields are obtained, and the Karman type vortex shedding behaviour seen in the experiment is well represented. For the reacting flow, two mesh configurations are used to investigate the sensitivity of the LES results to the numerical resolution. Profiles for the velocity and temperature fields exhibit good agreement with the experimental data for both the coarse and dense mesh. This demonstrates the capability of LES coupled with the TFSD approach in representing the highly unsteady premixed combustion observed in this configuration. The instantaneous flow pattern and turbulent flame behaviour are discussed, and the differences between the non-reacting and reacting flow are described through visualisation of vortical structures and their interaction with the flame. Lastly, the generation and destruction of FSD are evaluated by examining the individual terms in the FSD transport equation. Localised regions where straining, curvature and propagation are each dominant are observed, highlighting the importance of non-equilibrium effects of FSD generation and
Wei, L; Chen, H; Zhou, Y S; Sun, Y C; Pan, S X
2017-02-18
To compare the technician fabrication time and clinical working time of custom trays fabricated using two different methods, the three-dimensional printing custom trays and the conventional custom trays, and to prove the feasibility of the computer-aided design/computer-aided manufacturing (CAD/CAM) custom trays in clinical use from the perspective of clinical time cost. Twenty edentulous patients were recruited into this study, which was prospective, single blind, randomized self-control clinical trials. Two custom trays were fabricated for each participant. One of the custom trays was fabricated using functional suitable denture (FSD) system through CAD/CAM process, and the other was manually fabricated using conventional methods. Then the final impressions were taken using both the custom trays, followed by utilizing the final impression to fabricate complete dentures respectively. The technician production time of the custom trays and the clinical working time of taking the final impression was recorded. The average time spent on fabricating the three-dimensional printing custom trays using FSD system and fabricating the conventional custom trays manually were (28.6±2.9) min and (31.1±5.7) min, respectively. The average time spent on making the final impression with the three-dimensional printing custom trays using FSD system and the conventional custom trays fabricated manually were (23.4±11.5) min and (25.4±13.0) min, respectively. There was significant difference in the technician fabrication time and the clinical working time between the three-dimensional printing custom trays using FSD system and the conventional custom trays fabricated manually (Pmanufacture custom trays by three-dimensional printing method, there is no need to pour preliminary cast after taking the primary impression, therefore, it can save the impression material and model material. As to completing denture restoration, manufacturing custom trays using FSD system is worth being
Prevalence and Factors Associated with Female Sexual Dysfunction in Beijing, China.
Lou, Wen-Jia; Chen, Bo; Zhu, Lan; Han, Shao-Mei; Xu, Tao; Lang, Jing-He; Zhang, Lei
2017-06-20
Female sexual dysfunction (FSD) is a highly prevalent and often underestimated problem. However, large-scale, population-based epidemiological surveys of FSD are scarce in China. The present study was conducted to evaluate the prevalence and the potential risk factors of FSD across a selection of social groups in Beijing, China, based on the Female Sexual Function Index (FSFI). A cross-sectional study based on the multiple-stage cluster sampling was performed with adult women throughout the Dongcheng and Shunyi districts of Beijing. The Chinese version of FSFI was used, as well as questions on demographic characteristics, the disease-related context, and social relationships. A total of 6000 consecutive women entered this study, with an actual response from 5024 women, corresponding to a response rate of 83.7%. A total of 4697 (78.3%) questionnaires were effective. The prevalence of adult FSD in Beijing was 2973 (63.3%) using a score of 26.55 as the boundary value, whereas the total mean FSFI score was 23.92 ± 6.37. However, 1423 (30.3%) women did not seek help. By multivariate logistic regression analysis, the possible potential risk factors included age (odds ratio [OR] = 1.051), dissatisfaction with the spouse's sexual ability (OR = 3.520), poor marital affection (OR = 2.087), spouse sexual difficulties (OR = 1.720), dissatisfaction with married life (OR = 1.476), living in a rural area (OR = 1.292), chronic pelvic pain (OR = 1.261), chronic disease (OR = 1.534), previous pelvic surgery (OR = 1.605), vaginal delivery (OR = 2.285), lower education (OR = 3.449) and postmenopausal (OR = 3.183). As suggested by the FSFI scores, female sexual problems are highly prevalent in Beijing. Dissatisfaction with the spouse's sexual ability, poor marital affection, sexual difficulties of the spouse, dissatisfaction with the marriage, rural life, CPP, and postmenopausal were conceivable risk factors for FSD in Beijing women.
Maseroli, Elisa; Scavello, Irene; Vignozzi, Linda
2018-05-02
Erectile dysfunction is recognized as an opportunity for preventing cardiovascular (CV) events, and assessing the impairment of penile vascular flow by Doppler ultrasound is an important tool to ascertain CV risk. Conversely, the role of genital vascular impairment in the pathophysiology of female sexual dysfunction (FSD) remains contentious. To focus on the current scientific support for an association between CV risk factors and female sexual health in the 1st part of a 2-part review. A thorough literature search of peer-reviewed publications on the associations between CV risk factors and FSD and their underlying mechanisms was performed using the PubMed database. We present a summary of the evidence from clinical studies and discuss the possible mechanisms providing the pathophysiologic bases of vasculogenic FSD syndromes. The peripheral sexual response in women is a vascular-dependent event, and evidence suggests that cardiometabolic-related perturbations in endothelial function can determine vascular insufficiency in female genital tissues. Although epidemiologic and observational studies demonstrate that the prevalence of FSD is higher in women with diabetes mellitus, a cause-effect relation between these clinical conditions cannot be assumed. Evidence on the effect of obesity, metabolic syndrome, and polycystic ovary syndrome on sexual function in women is controversial. Data on the associations of dyslipidemia and hypertension with FSD are limited. Common cardiometabolic alterations could affect vascular function in the female genital tract. Based on limited data, there is an association between CV risk factors and female sexual health in women; however, this association appears milder than in men. Maseroli E, Scavello I, Vignozzi L. Cardiometabolic Risk and Female Sexuality-Part I. Risk Factors and Potential Pathophysiological Underpinnings for Female Vasculogenic Sexual Dysfunction Syndromes. Sex Med Rev 2018;X:XXX-XXX. Copyright © 2018 International
Energy Technology Data Exchange (ETDEWEB)
Hardiansyah, Deni [Medical Radiation Physics/Radiation Protection, Medical Faculty Mannheim, Universitätsmedizin Mannheim, Heidelberg University, Mannheim 68167, Germany and Department of Radiation Oncology, Medical Faculty Mannheim, Universitätsmedizin Mannheim, Heidelberg University, Mannheim 68167 (Germany); Guo, Wei; Glatting, Gerhard, E-mail: gerhard.glatting@medma.uni-heidelberg.de [Medical Radiation Physics/Radiation Protection, Medical Faculty Mannheim, Universitätsmedizin Mannheim, Heidelberg University, Mannheim 68167 (Germany); Kletting, Peter [Department of Nuclear Medicine, Ulm University, Ulm 89081 (Germany); Mottaghy, Felix M. [Department of Nuclear Medicine, University Hospital, RWTH Aachen University, Aachen 52074, Germany and Department of Nuclear Medicine, Maastricht University Medical Center MUMC+, Maastricht 6229 (Netherlands)
2016-09-15
Purpose: The aim of this study was to investigate the accuracy of PET-based treatment planning for predicting the time-integrated activity coefficients (TIACs). Methods: The parameters of a physiologically based pharmacokinetic (PBPK) model were fitted to the biokinetic data of 15 patients to derive assumed true parameters and were used to construct true mathematical patient phantoms (MPPs). Biokinetics of 150 MBq {sup 68}Ga-DOTATATE-PET was simulated with different noise levels [fractional standard deviation (FSD) 10%, 1%, 0.1%, and 0.01%], and seven combinations of measurements at 30 min, 1 h, and 4 h p.i. PBPK model parameters were fitted to the simulated noisy PET data using population-based Bayesian parameters to construct predicted MPPs. Therapy simulations were performed as 30 min infusion of {sup 90}Y-DOTATATE of 3.3 GBq in both true and predicted MPPs. Prediction accuracy was then calculated as relative variability v{sub organ} between TIACs from both MPPs. Results: Large variability values of one time-point protocols [e.g., FSD = 1%, 240 min p.i., v{sub kidneys} = (9 ± 6)%, and v{sub tumor} = (27 ± 26)%] show inaccurate prediction. Accurate TIAC prediction of the kidneys was obtained for the case of two measurements (1 and 4 h p.i.), e.g., FSD = 1%, v{sub kidneys} = (7 ± 3)%, and v{sub tumor} = (22 ± 10)%, or three measurements, e.g., FSD = 1%, v{sub kidneys} = (7 ± 3)%, and v{sub tumor} = (22 ± 9)%. Conclusions: {sup 68}Ga-DOTATATE-PET measurements could possibly be used to predict the TIACs of {sup 90}Y-DOTATATE when using a PBPK model and population-based Bayesian parameters. The two time-point measurement at 1 and 4 h p.i. with a noise up to FSD = 1% allows an accurate prediction of the TIACs in kidneys.
Well-width dependence of exciton-phonon scattering in InxGa1 - xAs/GaAs single quantum wells
DEFF Research Database (Denmark)
Borri, Paola; Langbein, Wolfgang Werner; Hvam, Jørn Märcher
1999-01-01
The temperature and density dependencies of the exciton dephasing time in In0.18Ga0.82As/GaAs single quantum wells with different thicknesses have been measured by degenerate four-wave mixing; The exciton-phonon scattering contribution to the dephasing is isolated by extrapolating the dephasing r...
Balance confidence is related to features of balance and gait in individuals with chronic stroke
Schinkel-Ivy, Alison; Wong, Jennifer S.; Mansfield, Avril
2016-01-01
Reduced balance confidence is associated with impairments in features of balance and gait in individuals with sub-acute stroke. However, an understanding of these relationships in individuals at the chronic stage of stroke recovery is lacking. This study aimed to quantify relationships between balance confidence and specific features of balance and gait in individuals with chronic stroke. Participants completed a balance confidence questionnaire and clinical balance assessment (quiet standing, walking, and reactive stepping) at 6 months post-discharge from inpatient stroke rehabilitation. Regression analyses were performed using balance confidence as a predictor variable and quiet standing, walking, and reactive stepping outcome measures as the dependent variables. Walking velocity was positively correlated with balance confidence, while medio-lateral centre of pressure excursion (quiet standing) and double support time, step width variability, and step time variability (walking) were negatively correlated with balance confidence. This study provides insight into the relationships between balance confidence and balance and gait measures in individuals with chronic stroke, suggesting that individuals with low balance confidence exhibited impaired control of quiet standing as well as walking characteristics associated with cautious gait strategies. Future work should identify the direction of these relationships to inform community-based stroke rehabilitation programs for individuals with chronic stroke, and determine the potential utility of incorporating interventions to improve balance confidence into these programs. PMID:27955809
Timescales of Coherent Dynamics in the Light Harvesting Complex 2 (LH2) of Rhodobacter sphaeroides.
Fidler, Andrew F; Singh, Ved P; Long, Phillip D; Dahlberg, Peter D; Engel, Gregory S
2013-05-02
The initial dynamics of energy transfer in the light harvesting complex 2 from Rhodobacter sphaeroides were investigated with polarization controlled two-dimensional spectroscopy. This method allows only the coherent electronic motions to be observed revealing the timescale of dephasing among the excited states. We observe persistent coherence among all states and assign ensemble dephasing rates for the various coherences. A simple model is utilized to connect the spectroscopic transitions to the molecular structure, allowing us to distinguish coherences between the two rings of chromophores and coherences within the rings. We also compare dephasing rates between excited states to dephasing rates between the ground and excited states, revealing that the coherences between excited states dephase on a slower timescale than coherences between the ground and excited states.
Comparison of two balance training programs on balance in community dwelling older adults
Directory of Open Access Journals (Sweden)
Shefali Walia
2016-09-01
Full Text Available Impaired balance has been associated with an increased risk for falls and a resulting increase in the mortality rate of elder people. Thus, balance-training interventions have an important place in fall prevention. This study was designed with the purpose of identifying the appropriate balance-training program for community dwelling elderly adults with an active lifestyle. A sample of 70 elderly adults were randomly allocated into two groups: group 1 (n=35 received general balance and mobility exercise; group 2 (n=35 received specific balance strategy training. The intervention consisted of 5 sessions/week for 4 weeks. The outcome measures were Timed up and go test (TUGT and Berg balance scale (BBS. An inter-group (2-way mixed model analysis of co-variance and intra-group (repeated measures analysis was done to find the change in balance scores. After the intervention, the TUGT scores in group 1 were, mean=10.38 s, standard deviation (SD=1.59 s and in group 2 were, mean=9.27 s, SD=1.13 s. Post training, BBS scores for group 1 were, mean=54.69, SD=1.13, and for group 2 were, mean=55.57, SD =0.56. There was a significant group × time effect for TUGT and BBS score. All the subjects showed significant changes in balance scores after balance training interventions. The subjects who participated in the specific balance-strategy training significantly improved their functional mobility, as shown on the TUGT, compared to the general training group.
Balance ability and athletic performance.
Hrysomallis, Con
2011-03-01
The relationship between balance ability and sport injury risk has been established in many cases, but the relationship between balance ability and athletic performance is less clear. This review compares the balance ability of athletes from different sports, determines if there is a difference in balance ability of athletes at different levels of competition within the same sport, determines the relationship of balance ability with performance measures and examines the influence of balance training on sport performance or motor skills. Based on the available data from cross-sectional studies, gymnasts tended to have the best balance ability, followed by soccer players, swimmers, active control subjects and then basketball players. Surprisingly, no studies were found that compared the balance ability of rifle shooters with other athletes. There were some sports, such as rifle shooting, soccer and golf, where elite athletes were found to have superior balance ability compared with their less proficient counterparts, but this was not found to be the case for alpine skiing, surfing and judo. Balance ability was shown to be significantly related to rifle shooting accuracy, archery shooting accuracy, ice hockey maximum skating speed and simulated luge start speed, but not for baseball pitching accuracy or snowboarding ranking points. Prospective studies have shown that the addition of a balance training component to the activities of recreationally active subjects or physical education students has resulted in improvements in vertical jump, agility, shuttle run and downhill slalom skiing. A proposed mechanism for the enhancement in motor skills from balance training is an increase in the rate of force development. There are limited data on the influence of balance training on motor skills of elite athletes. When the effectiveness of balance training was compared with resistance training, it was found that resistance training produced superior performance results for
Relevance of balance measurement tools and balance training for fall prevention in older adults
Majumi M. Noohu, MPTh; Aparajit B. Dey, MD; Mohammed E. Hussain, PhD
2014-01-01
Approximately one in three older people fall each year owing to gait/balance disorder/weakness, the second leading cause of falls in older adults. This review evaluates the capability of different balance measurement tools to predict falls in the elderly, which are used routinely for assessing balance impairment. Balance measurement tools reviewed are the Timed Up and Go test, Berg Balance Scale, Tinetti Performance Oriented Mobility Assessment, Functional Reach Test, Clinical Test of Sensory...
DEFF Research Database (Denmark)
Jagd, Søren
2010-01-01
of balancing trust and control becomes an issue that deserve ongoing attention. This paper adds to the discussion on the relation between trust and control by showing that the process perspective reframes the problem of balancing trust and control. More generally, by demonstrating the importance of the process......The purpose of this paper is to show that conceptualizing trust and control as interactively related processes, as opposed to more static conceptualizations of the two concepts and the relations between them, adds importantly towards understanding the challenges involved in balancing of trust...... on trust and control made the problem of finding a balance between trust and control a once and for all decision the process perspective introduced here implies that balancing trust and control is an ongoing process of balancing and rebalancing. The implication for management is that the problem...
DYMAC digital electronic balance
International Nuclear Information System (INIS)
Stephens, M.M.
1980-06-01
The Dynamic Materials Accountability (DYMAC) System at LASL integrates nondestructive assay (NDA) instruments with interactive data-processing equipment to provide near-real-time accountability of the nuclear material in the LASL Plutonium Processing Facility. The most widely used NDA instrument in the system is the DYMAC digital electronic balance. The DYMAC balance is a commercial instrument that has been modified at LASL for weighing material in gloveboxes and for transmitting the weight data directly to a central computer. This manual describes the balance components, details the LASL modifications, reviews a DYMAC measurement control program that monitors balance performance, and provides instructions for balance operation and maintenance
Sexual dysfunction in premenopausal women could be related to hormonal profile.
Vale, Fabiene Bernardes Castro; Coimbra, Bruna Barbosa; Lopes, Gerson Pereira; Geber, Selmo
2017-02-01
Female sexual dysfunction (FSD) is a public health problem that affects women's quality of life. Although the relationship between some hormones and the FSD has been described, it is not well established for all hormones. Therefore, the aim of our study was to evaluate the association between hormonal dysfunction and sexual dysfunction in premenopausal women. We performed a cross-sectional study with 60 patients with regular menstrual cycles, with age ranging from 18 to 44 years, with previous diagnosis of FSD. All patients were evaluated using the female sexual function index (FSFI) questionnaire and had the levels of total testosterone, prolactin (PRL), thyroid-releasing hormone and free testosterone index measured. Among the 60 patients, 43 (71.7%) were diagnosed with hypoactive sexual desire disorder (HSDD), 9 (15%) had anorgasmy and 8 (3.3%) had sexual pain dysfunction. Hormonal evaluation, demonstrated that 79.1% of patients with HSDD, 78.4% of patients with anorgasmy and 50% of patients with sexual pain dysfunction had female androgen insensitivity. We can conclude that there is an important association between low levels of total and free testosterone and FSD. This finding offers a new alternative for diagnosis and treatment of HSDD. Moreover, given the potential role of androgens in sexual function, randomized controlled trials with adequate long-term follow-up are essential to confirm its possible effect.
Ahmed, Magdy R; Shaaban, Mohamed M; Meky, Heba K
2017-10-01
To assess sexually related personal distress among premenopausal women with female sexual dysfunction (FSD) via a validated Arabic version of the Female Sexual Distress Scale (FSDS). A cross-sectional study was conducted among women attending Suez Canal University Hospital, Egypt, between May 2015 and July 2016. In a pilot study to evaluate test-retest reliability and internal consistency, 42 sexually active premenopausal women (aged ≥20 years) completed the Arabic FSDS at recruitment and 2 weeks later. Subsequently, premenopausal sexually active women (aged 20-45 years) were asked to complete the female sexual function index (FSFI) questionnaire; those with FSD (FSFI score ≤26.55) were invited to return to complete the validated version of the Arabic FSDS. The Arabic FSDS showed good test-retest reliability (Pearson correlation coefficient 0.93-0.98) and internal consistency (Cronbach α 0.83-0.92). Overall, 140 (58.1%) of 241 women who completed the FSFI had sexual dysfunction, of whom 51 (36.4%) had sexually related personal distress. Marriage duration was significantly increased among women with FSD (P<0.001). All FSFI sexual domains except lubrication were negatively correlated with FSDS. FSD and sexually related personal distress were highly interrelated and prevalent. An Arabic version of the FSDS was found to be valid and reliable for evaluation of sexually related personal distress. © 2017 International Federation of Gynecology and Obstetrics.
International Nuclear Information System (INIS)
Davydchuk, V.; Arapis, G.
1995-01-01
This work includes two maps of balance evaluation of 137 Cs horizontal migration in natural landscapes of Chernobyl zone. The first map shows the short-term balance, which reflects the evaluation of 137 Cs migration from present up to 20-30 years in future. the second map refers to the kong-term balance and represents a forecast of the radioecological situation 60-80 years from the accident. On the base of our evaluation the territory of 30-km zone of Chernobyl Nuclear Power Plant can be divided in three parts, approximately equal but slightly differentiated in time. In fact, the landscape of extreme-morainic ridge of Christogalovka presents a clear negative balance of 137 Cs both in short-term and in long-term aspects. Landscapes with negative balance of the 137 Cs occupy for short-term about 37 % and for long-term 41 % of the investigated territory. Neutral balance is expected for short- and long-term to be approximately 39 % and 35 % of the territory respectively. Positive balance is expected for approx. 24 % of the territory in both terms. The proposed evaluations are qualitative and they can be used as background for preparation of any decisions related to the application of decontamination technologies and its ecological consequences
Resin catalysts and method of preparation
Smith, L.A. Jr.
1986-12-16
Heat stabilized catalyst compositions are prepared from nuclear sulfonic acid, for example, macroporous crosslinked polyvinyl aromatic compounds containing sulfonic acid groups are neutralized with a metal of Al, Fe, Zn, Cu, Ni, ions or mixtures and alkali, alkaline earth metals or ammonium ions by contacting the resin containing the sulfonic acid with aqueous solutions of the metals salts and alkali, alkaline earth metal or ammonium salts. The catalysts have at least 50% of the sulfonic acid groups neutralized with metal ions and the balance of the sulfonic acid groups neutralized with alkali, alkaline earth ions or ammonium ions.
Effect of Selected Balance Exercises on the Dynamic Balance of Children with Visual Impairments
Jazi, Shirin Davarpanah; Purrajabi, Fatemeh; Movahedi, Ahmadreza; Jalali, Shahin
2012-01-01
Introduction: Maintaining balance while walking is of utmost importance for individuals with visual impairments because deficits in dynamic balance have been associated with a high risk of falling. Thus, the primary aim of the study presented here was to determine whether balance training effects the dynamic balance of children with visual…
Balancing risks and benefits fairly across generations: cost/benefit considerations
International Nuclear Information System (INIS)
Catron, B.L.
1994-01-01
This paper has been prepared by the OECD Nuclear Energy Agency Workshop on the environmental and ethical aspects of long-lived radioactive waste disposal. The workshop is intended as a step toward preparation of a collective opinion on deep geological storage of nuclear waste. As requested, this paper answers to the following specific questions : 1) Discounting of costs with time is a widely applied technique in the evaluation of the impact of economic and industrial decisions. Could or should discounting of long-term health risks due to radioactive waste disposal be envisaged? 2) Is it possible to assess what is passed on to future generations in terms of health risks, other detriments and possible benefits of all sorts, directly or indirectly? Should such an assessment be applied generically to human activities in a broad sense or should it concern only waste disposal issues? 3) How can the immediate needs of the current generations for example for energy generation or public health protection be balanced with inter generational equity requirements in the very long term? 4) Are resources devoted to assuring safety of radioactive waste disposal appropriately balanced with risks given that these resources could be applied to other societal goals? 5) Is it preferable to take all physical actions today to minimize any bequest of liabilities for waste management actions to future generations. If not how should financial assets be set aside to meet the liabilities? 6) What guidelines and principles should we follow to balance these risks? Does the proposition that we should not expose future generations to a risk that is not acceptable today appropriately address this issue? 7) Should measures of risk acceptability be considered in the context of individual rights or local rights or the collective rights of the population? 8) What measures are necessary in the siting of repositories to assure that disadvantaged populations do not bear disproportionate burdens? 9) Is
Enhanced quantum coherence in graphene caused by Pd cluster deposition
International Nuclear Information System (INIS)
Qin, Yuyuan; Han, Junhao; Du, Yongping; Li, Zhaoguo; Wan, Xiangang; Han, Min; Song, Fengqi; Guo, Guoping; Song, You; Pi, Li; Wang, Xuefeng
2015-01-01
We report on the unexpected increase in the dephasing lengths of a graphene sheet caused by the deposition of Pd nanoclusters, as demonstrated by weak localization measurements. The dephasing lengths reached saturated values at low temperatures. Theoretical calculations indicate the p-type charge transfer from the Pd clusters, which contributes more carriers. The saturated values of dephasing lengths often depend on both the carrier concentration and mean free path. Although some impurities are increased as revealed by decreased mobilities, the intense charge transfer leads to the improved saturated values and subsequent improved dephasing lengths
Kvasničková, Katarína
2011-01-01
The subject of this thesis is Work-Life Balance - the reconciliation of professional and personal lives. The primary objective of this work is to analyze employee satisfaction in achieving a balance between the professional and personal life and to develop recommendations for employer on that basis. The theoretical portion of this work defines the issues surrounding Work-Life Balance and tools that employees can use to harmonize the two with an analysis of applications in the Czech Republic a...
Sipp, Amy R; Gwin, Joseph T; Makeig, Scott; Ferris, Daniel P
2013-11-01
Determining the neural correlates of loss of balance during walking could lead to improved clinical assessment and treatment for individuals predisposed to falls. We used high-density electroencephalography (EEG) combined with independent component analysis (ICA) to study loss of balance during human walking. We examined 26 healthy young subjects performing heel-to-toe walking on a treadmill-mounted balance beam as well as walking on the treadmill belt (both at 0.22 m/s). ICA identified clusters of electrocortical EEG sources located in or near anterior cingulate, anterior parietal, superior dorsolateral-prefrontal, and medial sensorimotor cortex that exhibited significantly larger mean spectral power in the theta band (4-7 Hz) during walking on the balance beam compared with treadmill walking. Left and right sensorimotor cortex clusters produced significantly less power in the beta band (12-30 Hz) during walking on the balance beam compared with treadmill walking. For each source cluster, we also computed a normalized mean time/frequency spectrogram time locked to the gait cycle during loss of balance (i.e., when subjects stepped off the balance beam). All clusters except the medial sensorimotor cluster exhibited a transient increase in theta band power during loss of balance. Cluster spectrograms demonstrated that the first electrocortical indication of impending loss of balance occurred in the left sensorimotor cortex at the transition from single support to double support prior to stepping off the beam. These findings provide new insight into the neural correlates of walking balance control and could aid future studies on elderly individuals and others with balance impairments.
Lucas, James Raymond
2012-01-01
This Paper argues that the efficiency distribution of players in a game determines how aggressively these players interact. We formalize the idea of balance of power: players fight very inefficient players but play softly versus equally (or more) efficient players. This theory of conduct predicts that entry by new firms leads to a less aggressive outcome if it creates a balance of power. A balance of power is created if more players get technologies that are close to the most efficient techno...
Yatar, Gozde Iyigun; Yildirim, Sibel Aksu
2015-01-01
[Purpose] The aim of this study was to compare the effects of Wii Fit balance training (WBT) and progressive balance training (PBT) approaches on balance functions, balance confidence, and activities of daily living in chronic stroke patients. [Subjects] A total of 30 patients were randomized into the WBT (n=15) and PBT (n=15) groups. [Methods] All of the subjects received exercise training based on a neurodevelopemental approach in addition to either Wii Fit or progressive balance training for total of 1 hour a day, 3 days per week for 4 weeks. Primary measurements were static balance function measured with a Wii Balance Board and dynamic balance function assessed with the Berg Balance Scale, Timed Up and Go test, Dynamic Gait Index, and Functional Reach Test. Secondary measures were balance confidence assessed with the Activities-specific Balance Confidence scale and activities of daily living evaluated with the Frenchay Activity Index. [Results] There was not remarkable difference between the two treatments in dynamic balance functions, balance confidence, and activities of daily living. [Conclusion] Although both of the approaches were found to be effective in improving the balance functions, balance confidence, and activities of daily living, neither of them were more preferable than the other for the treatment of balance in patients with chronic stroke. PMID:25995576
Yatar, Gozde Iyigun; Yildirim, Sibel Aksu
2015-04-01
[Purpose] The aim of this study was to compare the effects of Wii Fit balance training (WBT) and progressive balance training (PBT) approaches on balance functions, balance confidence, and activities of daily living in chronic stroke patients. [Subjects] A total of 30 patients were randomized into the WBT (n=15) and PBT (n=15) groups. [Methods] All of the subjects received exercise training based on a neurodevelopemental approach in addition to either Wii Fit or progressive balance training for total of 1 hour a day, 3 days per week for 4 weeks. Primary measurements were static balance function measured with a Wii Balance Board and dynamic balance function assessed with the Berg Balance Scale, Timed Up and Go test, Dynamic Gait Index, and Functional Reach Test. Secondary measures were balance confidence assessed with the Activities-specific Balance Confidence scale and activities of daily living evaluated with the Frenchay Activity Index. [Results] There was not remarkable difference between the two treatments in dynamic balance functions, balance confidence, and activities of daily living. [Conclusion] Although both of the approaches were found to be effective in improving the balance functions, balance confidence, and activities of daily living, neither of them were more preferable than the other for the treatment of balance in patients with chronic stroke.
Teague, Adele; Smith, Gareth Dylan
2015-01-01
Musicians are acknowledged to lead complex working lives, often characterised as portfolio careers. The higher music education research literature has tended to focus on preparing students for rich working lives and multiple identity realisations across potential roles. Extant literature does not address the area of work-life balance, which this…
Balances instruments, manufacturers, history
Robens, Erich; Kiefer, Susanne
2014-01-01
The book deals mainly with direct mass determination by means of a conventional balances. It covers the history of the balance from the beginnings in Egypt earlier than 3000 BC to recent developments. All balance types are described with emphasis on scientific balances. Methods of indirect mass determination, which are applied to very light objects like molecules and the basic particles of matter and celestial bodies, are included. As additional guidance, today’s manufacturers are listed and the profile of important companies is reviewed. Several hundred photographs, reproductions and drawings show instruments and their uses. This book includes commercial weighing instruments for merchandise and raw materials in workshops as well as symbolic weighing in the ancient Egyptian’s ceremony of ‘Weighing of the Heart’, the Greek fate balance, the Roman Justitia, Juno Moneta and Middle Ages scenes of the Last Judgement with Jesus or St. Michael and of modern balances. The photographs are selected from the...
Effects of DanceSport on walking balance and standing balance among the elderly.
Sohn, Jeehoon; Park, Sung-Ha; Kim, Sukwon
2018-05-04
Dancesport is a popular activity among older adults who look for fun and fitness in Korea. Studies reported positive sociological and psychological effects of dancesport. But, little studies were performed to evaluate the effects of dancesport on balance performances. The objective of the present study was to evaluate the effects of dancesport for 15 weeks on walking balance and standing balance of older adults. Older adults regularly participated in the dancesport program 3 times a week for 15 weeks. The program included Rumba, Cha-cha-cha, and Jive. They exercised the prescribed dancesport at intermediate level for 50-60 mins for each time. A total 22 reflective markers were placed on the anatomical landmarks and 8 cameras were used to measure 3-D positions of participants. Also, center of pressure (COP) data were measured to analyze standing balance using a ground reaction board at 1200 Hz for 30 seconds. One-way analysis of variance (ANOVA) was performed to test the effects of 15 weeks of dancesport on walking balance and standing balance. The results suggested that, after 15 weeks of dancesport participation, older adults' walking balance (48.3 ± 20.3 cm2 vs 38.2 ± 18.2 cm2) and standing balance (COP area: 189.4 ± 85.4 mm2 vs 103.5 ± 55.4mm2, COP distance: 84.2 ± 34.4 cm vs 76.5 ± 21.4 cm) were significantly improved. Performing dancesport would require moving center of mass rapidly and frequently while maintaining posture. This may result in improving walking balance and standing balance in the present study. The study concluded that dancesport would be an effective exercise method in enhancing postural stability of older adults.
Directory of Open Access Journals (Sweden)
Courtney Kessel
2013-01-01
Full Text Available 'In Balance With' (2012 is a live performance with Courtney Kessel and her daughter, Chloé, sitting at opposite ends of a seesaw. During the 30-minute performance, Kessel adds items representative of their lives to Chloé's side of the seesaw. After each group of items is added, she returns to her side to check the balance. Toys, violin, research books, food, pots, tools, and laundry are strapped on to the seesaw. The audience witnesses the struggle to create a balance between work, home, research, and play as a single mother and artist. As equilibrium is achieved, Kessel stills labors to maintain the balance until Chloé is ready to get down, thus signaling that her work can only happen when her daughter is cared for and occupied.
Paul Collier : Balancing beams
2009-01-01
As former head of AB Operations, Paul Collier and his group were in the ‘cockpit’ for the LHC’s maiden voyage - piloting the first beam around the ring. But now, as Head of the Beams Department, he will need his feet firmly on the ground in order to balance all the beam activities at CERN. "As Department Head, I’ll have less direct contact with the machines," Collier says with a hint of regret. "I’ll still obviously be very involved, but they won’t actually let me loose in front of the keyboard anymore!" As the new Head of the BE Department, Collier will be in charge of nearly 400 people, and will oversee all the beam activities, including the preparations for the longest period of beam operation in the history of CERN. In the new organization, the BE, TE and EN Departments have been grouped together in the Accelerator and Technology Sector. "‘Partnership’ is a key word for the three departments," says Collier. "The n...
Preparation of Zeolite Molecular Sieve by Using Hydrogel Method
International Nuclear Information System (INIS)
Swe Zin Win; Mu Mu Htay; Mya Mya Oo
2010-12-01
Zeolite A was synthesized from hydrogel solution which prepared from silica and alumina precursors under hydrothermal condition at atmospheric pressure. Before preparing of hydrogel solution, the amount of raw materials which used in resulting hydrogel with appropriate mole ratio was calculated by material balance. In this study,totally ten experiments were carried out for zeolite A formation. The important parameters for these experiments were the kinds of precursors,their concentration (starting material composition), synthesis time and temperature. All product samples from these experiments were characterized by X-ray Diffraction (XRD), Scanning Electron Microscope (SEM) and analyzed by gravimetric method. The results show that the favourable sample for this research work which can be prepared with a molar composition of SiO2: Al2O3: 2Na2O: 70H2O by agitation at room temperature for 30 minutes, ageing at room temperature and crystallization at 95Ccentre dot centre dot for 24hrs. The percent yield of favourable result is 70%.
van der Wijk, V.; Herder, Justus Laurens
2009-01-01
Complete dynamic balancing principles still cannot avoid a substantial increase in mass and inertia. In addition, the conditions for dynamic balance and inertia equations can be complicated to derive. This article shows how a double pendulum, which is fully dynamically balanced using counter-rotary
First-Principle Characterization for Singlet Fission Couplings.
Yang, Chou-Hsun; Hsu, Chao-Ping
2015-05-21
The electronic coupling for singlet fission, an important parameter for determining the rate, has been found to be too small unless charge-transfer (CT) components were introduced in the diabatic states, mostly through perturbation or a model Hamiltonian. In the present work, the fragment spin difference (FSD) scheme was generalized to calculate the singlet fission coupling. The largest coupling strength obtained was 14.8 meV for two pentacenes in a crystal structure, or 33.7 meV for a transition-state structure, which yielded a singlet fission lifetime of 239 or 37 fs, generally consistent with experimental results (80 fs). Test results with other polyacene molecules are similar. We found that the charge on one fragment in the S1 diabatic state correlates well with FSD coupling, indicating the importance of the CT component. The FSD approach is a useful first-principle method for singlet fission coupling, without the need to include the CT component explicitly.
Seasonal evolution of the Arctic marginal ice zone and its power-law obeying floe size distribution
Zhang, J.; Stern, H. L., III; Schweiger, A. J. B.; Steele, M.; Hwang, P. B.
2017-12-01
A thickness, floe size, and enthalpy distribution (TFED) sea ice model, implemented numerically into the Pan-arctic Ice-Ocean Modeling and Assimilation System (PIOMAS), is used to investigate the seasonal evolution of the Arctic marginal ice zone (MIZ) and its floe size distribution. The TFED sea ice model, by coupling the Zhang et al. [2015] sea ice floe size distribution (FSD) theory with the Thorndike et al. [1975] ice thickness distribution (ITD) theory, simulates 12-category FSD and ITD explicitly and jointly. A range of ice thickness and floe size observations were used for model calibration and validation. The model creates FSDs that generally obey a power law or upper truncated power law, as observed by satellites and aerial surveys. In this study, we will examine the role of ice fragmentation and lateral melting in altering FSDs in the Arctic MIZ. We will also investigate how changes in FSD impact the seasonal evolution of the MIZ by modifying the thermodynamic processes.
International Nuclear Information System (INIS)
Anon.
2000-01-01
The energy balances of the Danish Statistical Office are the designation of the goods balances, which are tabulated for each energy article in both physical entities (quantities) and in base rates (values). The balance concept is connected to the definition supply = use, which is the basis for the construction of the system. The supply is determined as the sum of two items: import and production while the total use is the sum of 138 items: export, waste and transmission loss, stock increase, input in lack of the 130 industries, and private consumption divided into 5 consumption groups. The statistical analysis is performed yearly in both quantities and values for 35 energy articles. Values are computed for base rates, profits, taxes, VAT and market prices (buyer's price), respectively. The energy balances from 1975 to 2000 are presented for comparison. (EHS)
A balancing act? Work-life balance, health and well-being in European welfare states.
Lunau, Thorsten; Bambra, Clare; Eikemo, Terje A; van der Wel, Kjetil A; Dragano, Nico
2014-06-01
Recent analyses have shown that adverse psychosocial working conditions, such as job strain and effort-reward imbalance, vary by country and welfare state regimes. Another work-related factor with potential impact on health is a poor work-life balance. The aims of this study are to determine the association between a poor work-life balance and poor health across a variety of European countries and to explore the variation of work-life balance between European countries. Data from the 2010 European Working Conditions Survey were used with 24,096 employees in 27 European countries. Work-life balance is measured with a question on the fit between working hours and family or social commitments. The WHO-5 well-being index and self-rated general health are used as health indicators. Logistic multilevel models were calculated to assess the association between work-life balance and health indicators and to explore the between-country variation of a poor work-life balance. Employees reporting a poor work-life balance reported more health problems (Poor well-being: OR = 2.06, 95% CI = 1.83-2.31; Poor self-rated health: OR = 2.00, 95% CI = 1.84-2.17). The associations were very similar for men and women. A considerable part of the between-country variation of work-life balance is explained by working hours, working time regulations and welfare state regimes. The best overall work-life balance is reported by Scandinavian men and women. This study provides some evidence on the public health impact of a poor work-life balance and that working time regulations and welfare state characteristics can influence the work-life balance of employees. © The Author 2014. Published by Oxford University Press on behalf of the European Public Health Association. All rights reserved.
OXALATE MASS BALANCE DURING CHEMICAL CLEANING IN TANK 6F
Energy Technology Data Exchange (ETDEWEB)
Poirier, M.; Fink, S.
2011-07-22
The Savannah River Remediation (SRR) is preparing Tank 6F for closure. The first step in preparing the tank for closure is mechanical sludge removal. Following mechanical sludge removal, SRS performed chemical cleaning with oxalic acid to remove the sludge heel. Personnel are currently assessing the effectiveness of the chemical cleaning to determine whether the tank is ready for closure. SRR personnel collected liquid samples during chemical cleaning and submitted them to Savannah River National Laboratory (SRNL) for analysis. Following chemical cleaning, they collected a solid sample (also known as 'process sample') and submitted it to SRNL for analysis. The authors analyzed these samples to assess the effectiveness of the chemical cleaning process. Analysis of the anions showed the measured oxalate removed from Tank 6F to be approximately 50% of the amount added in the oxalic acid. To close the oxalate mass balance, the author collected solid samples, leached them with nitric acid, and measured the concentration of cations and anions in the leachate. Some conclusions from this work are: (1) Approximately 65% of the oxalate added as oxalic acid was removed with the decanted liquid. (2) Approximately 1% of the oxalate (added to the tank as oxalic acid) formed precipitates with compounds such as nickel, manganese, sodium, and iron (II), and was dissolved with nitric acid. (3) As much as 30% of the oxalate may have decomposed forming carbon dioxide. The balance does not fully account for all the oxalate added. The offset represents the combined uncertainty in the analyses and sampling.
Effect of Balance, Strength, and Combined Training on the Balance of the Elderly Women
Directory of Open Access Journals (Sweden)
Alireza Farsi
2015-10-01
Full Text Available Objectives: Ageing is associated with a number of physiologic and functional declines that can increase disability, frailty, and falls in the elderly. Therefore, the purpose of the present study was to study and compare the effect of balance, strength, and combined trainings on the balance (overall, anterior-posterior, medial-lateral of the elderly women. Methods & Materials: Twenty-four older female adults (without history of any injuries in their lower limbs were participated voluntarily in this study and randomly assigned into 3 groups: balance (n=8, strength (n=8 and combined (n=8. A 6-week exercise program was performed at Shahid Beheshti University. The program was performed 3 days per week. Before and after implementation of exercise program, the balance status of the subjects was measured by Biodex stability system. The data were analyzed using 2-way analysis of variance (group×time ANOVA with repeated measures on time, paired–sample t-test, 1–way ANOVA, and Bonferroni post–hoc test (P≤0.005. Results: At the end of training programs, significant improvements were observed between the balance and combined groups with regard to the indexes of overall, anterior–posterior, and medial–lateral balance. Also, the strength group showed a significant growth in the indexes of anterior-posterior and medial-lateral compared to the beginning of the study. There was a significant difference between the balance (P=0.0001 and combined groups (P=0.001 with the strength group with regard to the index of overall balance. Also, there was a significant difference between balance group (P=0.0001 and the combined group (P=0.0001 regarding the anterior-posterior balance. But there were no significant differences between groups with regard to the medial-lateral balance. Conclusion: The study showed that perturbation–based balance training and combined training had the better effects compared to the strength training.
DEFF Research Database (Denmark)
Dhurandhar, N V; Schoeller, D; Brown, A W
2015-01-01
Energy intake (EI) and physical activity energy expenditure (PAEE) are key modifiable determinants of energy balance, traditionally assessed by self-report despite its repeated demonstration of considerable inaccuracies. We argue here that it is time to move from the common view that self......-reports of EI and PAEE are imperfect, but nevertheless deserving of use, to a view commensurate with the evidence that self-reports of EI and PAEE are so poor that they are wholly unacceptable for scientific research on EI and PAEE. While new strategies for objectively determining energy balance...... of energy balance....
Haddock, Rebecca Jaurigue
Today work goes on 24 hours a day, 7 days a week, and is about acceleration and access. Workers need balance more than ever. In fact, recent college graduates value work/life balance as their key factor in selecting employers. This paper, written for career counselors, defines balance as encompassing emotional, spiritual, physical, and…
Operational Safety Performance Indicators and Balanced Scorecard in HANARO
International Nuclear Information System (INIS)
Wu, Jong-Sup; Jung, Hoan-Sung; Ahn, Guk-Hoon; Lee, Kye-Hong; Lim, In-Cheol; Kim, Hark-Rho
2007-01-01
Research reactors need an extensive basis for ensuring their safety. The importance of a safety management in nuclear facilities and activities has been emphasized. The safety activities in HANARO have been continuously conducted to enhance its safe operation. Last year, HANARO prepared two indicator sets to measure and assess the safety status of the reactor's operation and utilization. One is Safety Performance Indicators (SPI) and the other is Balanced Scorecard (BSC). Through reviewing these indicators, we can obtain the following information; - Plant safety status - Safety parameter trends - Safety information, for example, reactor operation status and radiation safety HANARO will continuously pursue the trends of SPI and BSC
Hole spin coherence in a Ge/Si heterostructure nanowire
DEFF Research Database (Denmark)
Higginbotham, Andrew P; Larsen, Thorvald Wadum; Yao, Jun
2014-01-01
Relaxation and dephasing of hole spins are measured in a gate-defined Ge/Si nanowire double quantum dot using a fast pulsed-gate method and dispersive readout. An inhomogeneous dephasing time T2(*)≈ 0.18 μs exceeds corresponding measurements in III-V semiconductors by more than an order of magnit......Relaxation and dephasing of hole spins are measured in a gate-defined Ge/Si nanowire double quantum dot using a fast pulsed-gate method and dispersive readout. An inhomogeneous dephasing time T2(*)≈ 0.18 μs exceeds corresponding measurements in III-V semiconductors by more than an order...
Park, Shin-Kyu; Kim, Sung-Jin; Yoon, Tak Yong; Lee, Suk-Min
2018-05-01
[Purpose] This study aimed to investigate the effects of circular gait training on balance and balance confidence in patients with stroke. [Subjects and Methods] Fifteen patients with stroke were randomly divided into either the circular gait training (CGT) group (n=8) or the straight gait training (SGT) group (n=7). Both groups had conventional therapy that adhered to the neurodevelopmental treatment (NDT) approach, for 30 min. In addition, the CGT group performed circular gait training, and the SGT group practiced straight gait training for 30 min. Each intervention was applied for 1 h, 5 days a week, for 2 weeks. Berg Balance Scale (BBS), Timed Up and Go (TUG) test, and Activities-specific Balance Confidence (ABC) scale were used to test balance and balance confidence. [Results] After the intervention, both groups showed significant increases in balance and balance confidence. Significant improvements in the balance of the CGT group compared with the SGT group were observed at post-assessment. [Conclusion] This study showed that circular gait training significantly improves balance in patients with stroke.
Semi-arid vegetation response to antecedent climate and water balance windows
Thoma, David P.; Munson, Seth M.; Irvine, Kathryn M.; Witwicki, Dana L.; Bunting, Erin
2016-01-01
Questions Can we improve understanding of vegetation response to water availability on monthly time scales in semi-arid environments using remote sensing methods? What climatic or water balance variables and antecedent windows of time associated with these variables best relate to the condition of vegetation? Can we develop credible near-term forecasts from climate data that can be used to prepare for future climate change effects on vegetation? Location Semi-arid grasslands in Capitol Reef National Park, Utah, USA. Methods We built vegetation response models by relating the normalized difference vegetation index (NDVI) from MODIS imagery in Mar–Nov 2000–2013 to antecedent climate and water balance variables preceding the monthly NDVI observations. We compared how climate and water balance variables explained vegetation greenness and then used a multi-model ensemble of climate and water balance models to forecast monthly NDVI for three holdout years. Results Water balance variables explained vegetation greenness to a greater degree than climate variables for most growing season months. Seasonally important variables included measures of antecedent water input and storage in spring, switching to indicators of drought, input or use in summer, followed by antecedent moisture availability in autumn. In spite of similar climates, there was evidence the grazed grassland showed a response to drying conditions 1 mo sooner than the ungrazed grassland. Lead times were generally short early in the growing season and antecedent window durations increased from 3 mo early in the growing season to 1 yr or more as the growing season progressed. Forecast accuracy for three holdout years using a multi-model ensemble of climate and water balance variables outperformed forecasts made with a naïve NDVI climatology. Conclusions We determined the influence of climate and water balance on vegetation at a fine temporal scale, which presents an opportunity to forecast vegetation
Oxalate Mass Balance During Chemical Cleaning in Tank 5F
Energy Technology Data Exchange (ETDEWEB)
Poirier, M.; Fink, S.
2011-07-08
The Savannah River Site (SRS) is preparing Tank 5F for closure. The first step in preparing the tank for closure is mechanical sludge removal. Following mechanical sludge removal, SRS performed chemical cleaning with oxalic acid to remove the sludge heel. Personnel are currently assessing the effectiveness of the chemical cleaning to determine whether the tank is ready for closure. SRS personnel collected liquid samples during chemical cleaning and submitted them to Savannah River National Laboratory (SRNL) for analysis. Following chemical cleaning, they collected a solid sample (also known as 'process sample') and submitted it to SRNL for analysis. The authors analyzed these samples to assess the effectiveness of the chemical cleaning process. Analysis of the anions showed the measured oxalate removed from Tank 5F to be approximately 50% of the amount added in the oxalic acid. To close the oxalate mass balance, the author collected solid samples, leached them with nitric acid, and measured the concentration of cations and anions in the leachate.
Calcium Balance in Chronic Kidney Disease.
Hill Gallant, Kathleen M; Spiegel, David M
2017-06-01
The kidneys play a critical role in the balance between the internal milieu and external environment. Kidney failure is known to disrupt a number of homeostatic mechanisms that control serum calcium and normal bone metabolism. However, our understanding of calcium balance throughout the stages of chronic kidney disease is limited and the concept of balance itself, especially with a cation as complex as calcium, is often misunderstood. Both negative and positive calcium balance have important implications in patients with chronic kidney disease, where negative balance may increase risk of osteoporosis and fracture and positive balance may increase risk of vascular calcification and cardiovascular events. Here, we examine the state of current knowledge about calcium balance in adults throughout the stages of chronic kidney disease and discuss recommendations for clinical strategies to maintain balance as well as future research needs in this area. Recent calcium balance studies in adult patients with chronic kidney disease show that neutral calcium balance is achieved with calcium intake near the recommended daily allowance. Increases in calcium through diet or supplements cause high positive calcium balance, which may put patients at risk for vascular calcification. However, heterogeneity in calcium balance exists among these patients. Given the available calcium balance data in this population, it appears clinically prudent to aim for recommended calcium intakes around 1000 mg/day to achieve neutral calcium balance and avoid adverse effects of either negative or positive calcium balance. Assessment of patients' dietary calcium intake could further equip clinicians to make individualized recommendations for meeting recommended intakes.
International Nuclear Information System (INIS)
Hammer, R.
1982-01-01
The energy balance of the outer atmospheres of solarlike stars is discussed. The energy balance of open coronal regions is considered, discussing the construction and characteristics of models of such regions in some detail. In particular, the temperature as a function of height is considered, as are the damping length dependence of the global energy balance in the region between the base of the transition region and the critical point, and the effects of changing the amount of coronal heating, the stellar mass, and the stellar radius. Models of coronal loops are more briefly discussed. The chromosphere is then included in the discussion of the energy balance, and the connection between global energy balance and global thermal stability is addressed. The observed positive correlations between the chromospheric and coronal energy losses and the pressure of the transition region is qualitatively explained
DEFF Research Database (Denmark)
Jagd, Søren
This paper focuses on the leadership challenge of balancing trust and control. The relation between trust and control has for a long time been a puzzling issue for management researchers. In the paper I first show that there has been a dramatic change in the way the relation between trust...... and control has been conceptualized in trust research. While the relation between trust and control earlier was conceptualized as a more or less stable balance between trust and control, more recent research conceptualizes the relation between trust and control more as a dynamical process that involves...... an ongoing process of balancing the relation between trust and control. Second, taking the departure in the recent conceptualization of the balance between trust and control as an interactive process I discuss the challenges for management in handling this more subtle balancing of trust and control...
Zemková, Erika
2014-05-01
This review includes the latest findings based on experimental studies addressing sport-specific balance, an area of research that has grown dramatically in recent years. The main objectives of this work were to investigate the postural sway response to different forms of exercise under laboratory and sport-specific conditions, to examine how this effect can vary with expertise, and to provide examples of the association of impaired balance with sport performance and/or increasing risk of injury. In doing so, sports where body balance is one of the limiting factors of performance were analyzed. While there are no significant differences in postural stability between athletes of different specializations and physically active individuals during standing in a standard upright position (e.g., bipedal stance), they have a better ability to maintain balance in specific conditions (e.g., while standing on a narrow area of support). Differences in magnitude of balance impairment after specific exercises (rebound jumps, repeated rotations, etc.) and mainly in speed of its readjustment to baseline are also observed. Besides some evidence on an association of greater postural sway with the increasing risk of injuries, there are many myths related to the negative influence of impaired balance on sport performance. Though this may be true for shooting or archery, findings have shown that in many other sports, highly skilled athletes are able to perform successfully in spite of increased postural sway. These findings may contribute to better understanding of the postural control system under various performance requirements. It may provide useful knowledge for designing training programs for specific sports.
Load Balancing Scientific Applications
Energy Technology Data Exchange (ETDEWEB)
Pearce, Olga Tkachyshyn [Texas A & M Univ., College Station, TX (United States)
2014-12-01
The largest supercomputers have millions of independent processors, and concurrency levels are rapidly increasing. For ideal efficiency, developers of the simulations that run on these machines must ensure that computational work is evenly balanced among processors. Assigning work evenly is challenging because many large modern parallel codes simulate behavior of physical systems that evolve over time, and their workloads change over time. Furthermore, the cost of imbalanced load increases with scale because most large-scale scientific simulations today use a Single Program Multiple Data (SPMD) parallel programming model, and an increasing number of processors will wait for the slowest one at the synchronization points. To address load imbalance, many large-scale parallel applications use dynamic load balance algorithms to redistribute work evenly. The research objective of this dissertation is to develop methods to decide when and how to load balance the application, and to balance it effectively and affordably. We measure and evaluate the computational load of the application, and develop strategies to decide when and how to correct the imbalance. Depending on the simulation, a fast, local load balance algorithm may be suitable, or a more sophisticated and expensive algorithm may be required. We developed a model for comparison of load balance algorithms for a specific state of the simulation that enables the selection of a balancing algorithm that will minimize overall runtime.
Ivins, E. R.; Wahr, J. M.; Schrama, E. J.; Milne, G. A.; Barletta, V.; Horwath, M.; Whitehouse, P.
2012-12-01
In preparation for the Inter-govermental Panel on Climate Change: Assessment Report 5 (IPCC AR5), ESA and NASA have formed a committee of experts to perform a formal set of comparative experiments concerning space observations of ice sheet mass balance. This project began in August of 2011 and has now concluded with a report submitted for Science (Shepherd et al., 2012). The focus of the work conducted is to re-evaluate scientific reports on the mass balance of Greenland ice sheet (GIS) and Antarctic ice sheet (AIS). The most serious discrepancies have been reported for the AIS, amounting to as much as 0.9 mm/yr in discrepant sea level contribution. A direct method of determining the AIS is by space gravimetry. However, for this method to contribute to our understanding of sea level change, we require knowledge of present-day non-elastic vertical movements of bedrock in Antarctica. Quantifying the uncertainty and bias caused by lack of observational control on models of regional glacial isostatic adjustment (GIA), was a major focus for our experiments. This regional process is the most problematic error source for GRACE-determinations of ice mass balance in Antarctica. While GIA likely dominates some large vertical motions in Antarctica that are now observed with GPS (Thomas et al., 2011, GRL), interpretations still require models. The reported uncertainty for space gravimetric (GRACE) based sea level sourcing is roughly 0.20 to 0.35 mm/yr. The uncertainty is also part of the error budget for mass balances derived from altimetry measurements, though at a much lower level. Analysis of the GRACE time series using CSR RL04 (2003.0-2010.10) for AIS mass balance reveals a small trend of order +1 to -24 Gt/yr without a GIA correction. Three periods were selected over which to perform inter-comparisons (see Table). One class of GIA models, that relies primarily on far field sea level reconstructions (e.g. ICE-5G), provide a GIA correction that places AIS mass imbalance (
Godrich, Stephanie L; Lo, Johnny; Davies, Christina R; Darby, Jill; Devine, Amanda
2017-01-03
Improving the suboptimal vegetable consumption among the majority of Australian children is imperative in reducing chronic disease risk. The objective of this research was to determine whether there was a relationship between food security determinants (FSD) (i.e., food availability, access, and utilisation dimensions) and adequate vegetable consumption among children living in regional and remote Western Australia (WA). Caregiver-child dyads ( n = 256) living in non-metropolitan/rural WA completed cross-sectional surveys that included questions on FSD, demographics and usual vegetable intake. A total of 187 dyads were included in analyses, which included descriptive and logistic regression analyses via IBM SPSS (version 23). A total of 13.4% of children in this sample had adequate vegetable intake. FSD that met inclusion criteria ( p ≤ 0.20) for multivariable regression analyses included price; promotion; quality; location of food outlets; variety of vegetable types; financial resources; and transport to outlets. After adjustment for potential demographic confounders, the FSD that predicted adequate vegetable consumption were, variety of vegetable types consumed ( p = 0.007), promotion ( p = 0.017), location of food outlets ( p = 0.027), and price ( p = 0.043). Food retail outlets should ensure that adequate varieties of vegetable types (i.e., fresh, frozen, tinned) are available, vegetable messages should be promoted through food retail outlets and in community settings, towns should include a range of vegetable purchasing options, increase their reliance on a local food supply and increase transport options to enable affordable vegetable purchasing.
Directory of Open Access Journals (Sweden)
Stephanie L. Godrich
2017-01-01
Full Text Available Improving the suboptimal vegetable consumption among the majority of Australian children is imperative in reducing chronic disease risk. The objective of this research was to determine whether there was a relationship between food security determinants (FSD (i.e., food availability, access, and utilisation dimensions and adequate vegetable consumption among children living in regional and remote Western Australia (WA. Caregiver-child dyads (n = 256 living in non-metropolitan/rural WA completed cross-sectional surveys that included questions on FSD, demographics and usual vegetable intake. A total of 187 dyads were included in analyses, which included descriptive and logistic regression analyses via IBM SPSS (version 23. A total of 13.4% of children in this sample had adequate vegetable intake. FSD that met inclusion criteria (p ≤ 0.20 for multivariable regression analyses included price; promotion; quality; location of food outlets; variety of vegetable types; financial resources; and transport to outlets. After adjustment for potential demographic confounders, the FSD that predicted adequate vegetable consumption were, variety of vegetable types consumed (p = 0.007, promotion (p = 0.017, location of food outlets (p = 0.027, and price (p = 0.043. Food retail outlets should ensure that adequate varieties of vegetable types (i.e., fresh, frozen, tinned are available, vegetable messages should be promoted through food retail outlets and in community settings, towns should include a range of vegetable purchasing options, increase their reliance on a local food supply and increase transport options to enable affordable vegetable purchasing.
Romania's road to Euro zone. From structural balance to structural balance corrected for absorption
Directory of Open Access Journals (Sweden)
Aura-Gabriela SOCOL
2013-02-01
Full Text Available The sovereign-debt crisis in the European Union has determined the necessity to reform the signal indicators for the analysis of the public finances' sustainability. In this context, many of the developing/emerging countries consider that the informational value provided by the structural budget balance indicator is insufficient, especially during the periods characterized by absorption. The present study suggests the transition from classical structural budget balance (CAB in the structural balance corrected for absorption (CAAB and supports the use of an improved indicator of the structural budget balance with a superior informational relevance for the macro-economic policies decision makers. Based on the economic literature we will demonstrate that the structural budget balance indicator should be improved, in order to also take into consideration the deviation of the current account balance from its sustainable level, particularly in the stage of the economic cycle characterized by high absorption.
Robinson, Ian A.
2014-04-01
The time is fast approaching when the SI unit of mass will cease to be based on a single material artefact and will instead be based upon the defined value of a fundamental constant—the Planck constant—h . This change requires that techniques exist both to determine the appropriate value to be assigned to the constant, and to measure mass in terms of the redefined unit. It is important to ensure that these techniques are accurate and reliable to allow full advantage to be taken of the stability and universality provided by the new definition and to guarantee the continuity of the world's mass measurements, which can affect the measurement of many other quantities such as energy and force. Up to now, efforts to provide the basis for such a redefinition of the kilogram were mainly concerned with resolving the discrepancies between individual implementations of the two principal techniques: the x-ray crystal density (XRCD) method [1] and the watt and joule balance methods which are the subject of this special issue. The first three papers report results from the NRC and NIST watt balance groups and the NIM joule balance group. The result from the NRC (formerly the NPL Mk II) watt balance is the first to be reported with a relative standard uncertainty below 2 × 10-8 and the NIST result has a relative standard uncertainty below 5 × 10-8. Both results are shown in figure 1 along with some previous results; the result from the NIM group is not shown on the plot but has a relative uncertainty of 8.9 × 10-6 and is consistent with all the results shown. The Consultative Committee for Mass and Related Quantities (CCM) in its meeting in 2013 produced a resolution [2] which set out the requirements for the number, type and quality of results intended to support the redefinition of the kilogram and required that there should be agreement between them. These results from NRC, NIST and the IAC may be considered to meet these requirements and are likely to be widely debated
Blakley, G. R.
1982-01-01
Reviews mathematical techniques for solving systems of homogeneous linear equations and demonstrates that the algebraic method of balancing chemical equations is a matter of solving a system of homogeneous linear equations. FORTRAN programs using this matrix method to chemical equation balancing are available from the author. (JN)
Frih, Bechir; Mkacher, Wajdi; Jaafar, Hamdi; Frih, Ameur; Ben Salah, Zohra; El May, Mezry; Hammami, Mohamed
2018-04-01
The purpose of this study was to evaluate the effects of 6 months of specific balance training included in endurance-resistance program on postural balance in haemodialysis (HD) patients. Forty-nine male patients undergoing HD were randomly assigned to an intervention group (balance training included in an endurance-resistance training, n = 26) or a control group (resistance-endurance training only, n = 23). Postural control was assessed using six clinical tests; Timed Up and Go test, Tinetti Mobility Test, Berg Balance Scale, Unipodal Stance test, Mini-Balance Evaluation Systems Test and Activities Balance Confidence scale. All balance measures increased significantly after the period of rehabilitation training in the intervention group. Only the Timed Up and Go, Berg Balance Scale, Mini-Balance Evaluation Systems Test and Activities Balance Confidence scores were improved in the control group. The ranges of change in these tests were greater in the balance training group. In HD patients, specific balance training included in a usual endurance-resistance training program improves static and dynamic balance better than endurance-resistance training only. Implications for rehabilitation Rehabilitation using exercise in haemodialysis patients improved global mobility and functional abilities. Specific balance training included in usual endurance resistance training program could lead to improved static and dynamic balance.
Human stick balancing: Tuning Lèvy flights to improve balance control
Cabrera, Juan Luis; Milton, John G.
2004-09-01
State-dependent, or parametric, noise is an essential component of the neural control mechanism for stick balancing at the fingertip. High-speed motion analysis in three dimensions demonstrates that the controlling movements made by the fingertip during stick balancing can be described by a Lévy flight. The Lévy index, α, is approximately 0.9; a value close to optimal for a random search. With increased skill, the index α does not change. However, the tails of the Lévy distribution become broader. These observations suggest a Lévy flight that is truncated by the properties of the nervous and musculoskeletal system; the truncation decreasing as skill level increases. Measurements of the cross-correlation between the position of the tip of the stick and the fingertip demonstrate that the role of closed-loop feedback changes with increased skill. Moreover, estimation of the neural latencies for stick balancing show that for a given stick length, the latency increases with skill level. It is suggested that the neural control for stick balancing involves a mechanism in which brief intervals of consciously generated, corrective movements alternate with longer intervals of prediction-free control. With learning the truncation of the Lévy flight becomes better optimized for balance control and hence the time between successive conscious corrections increases. These observations provide the first evidence that changes in a Lévy flight may have functional significance for the nervous system. This work has implications for the control of balancing problems ranging from falling in the elderly to the design of two-legged robots and earthquake proof buildings.
Greenland Ice Sheet Mass Balance
Reeh, N.
1984-01-01
Mass balance equation for glaciers; areal distribution and ice volumes; estimates of actual mass balance; loss by calving of icebergs; hydrological budget for Greenland; and temporal variations of Greenland mass balance are examined.
Directory of Open Access Journals (Sweden)
Ebrahim Esmaeili
2006-07-01
Full Text Available Objective: Despite tilt-board exercises benefits and its role in ligamentus us injury prevention, little research has been done in this case. The goal of this study is investigation of balance exercises effect for six weeks on balance tests and strength of lower extremity ligaments. Materials & Methods: In present Quasi experimental study, case group was consisted of two 17 subjects groups which did balance exercises for 6 weeks (one group on dominant limb and another on non-dominant limb.Control group did not do any exercise in this period. These groups were evaluated and re-evaluated before and after the exercise period by Biodex Balance System. Results: Statistical analysis revealed significant differences between groups (P<0/05. Conclusion: According to our results it can be concluded that tilt-board exercises can be used as a suitable tool to prevent ligamentus us injuries.
Work–Life Balance: History, Costs, and Budgeting for Balance
Raja, Siva; Stein, Sharon L.
2014-01-01
The concept and difficulties of work–life balance are not unique to surgeons, but professional responsibilities make maintaining a work–life balance difficult. Consequences of being exclusively career focused include burn out, physical, and mental ailments. In addition, physician burn out may hinder optimal patient care and incur significant costs on health care in general. Assessing current uses of time, allocating goals catered to an individual surgeon, and continual self-assessment may hel...
Denk, Aytaç
2008-01-01
Ankara : The Department of International Relations, Bilkent University, 2008. Thesis (Master's) -- Bilkent University, 2008. Includes bibliographical references leaves 196-207. The bulk of studies on the balance of power, which constitutes balance of power theory, suggest that only states are involved in balance of power dynamics. This thesis maintains that exclusion of non-state actors (NSAs) from balance of power dynamics constitutes a significant gap in balance of power t...
Rochefort, Coralie; Walters-Stewart, Coren; Aglipay, Mary; Barrowman, Nick; Zemek, Roger; Sveistrup, Heidi
2017-11-01
To determine if self-reported balance symptoms can be used as a proxy for measures of the center of pressure (COP) to identify balance deficits in a group of concussed adolescents. Case-control. Thirteen adolescents 1-month post-concussion who reported ongoing balance problems (Balance+), 20 adolescent 1-month post-concussion who reported no balance problems (Balance-), and 30 non-injured adolescents (control) completed a series of balance tests. Participants completed two 2-min trials standing on a Nintendo Wii Balance Board™ during which the COP under their feet was recorded: i) double-leg stance, eyes open; ii) double-leg stance, eyes closed. Participants also completed a dual-task condition combining a double-leg stance and a Stroop Colour-word test. Participants in both the Balance+ and Balance- group swayed over a larger ellipse area compared to the control group while completing the Eyes Closed (Balance+, p=0.002; Balance-, p=0.002) and Dual-Task (Balance+, p=0.001; Balance-, p=0.004) conditions and performed the Dual-Task condition with faster medio-lateral velocity (Balance+, p=0.003; Balance-, p=0.009). The participants in the Balance- group also swayed over a larger ellipse area compared to the control group while completing the Eyes Open condition (p=0.005). No significant differences were identified between the Balance+ and Balance- groups. At 1-month post-concussion, adolescents demonstrated balance deficits compared to non-injured adolescents regardless of whether they reported balance problems. These results suggest that self-reported balance status might not be an accurate reflection of balance performance following a concussion in adolescents. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.
Production Balance of Ship Erection
Institute of Scientific and Technical Information of China (English)
JIANG Ru-hong; TAN Jia-hua; LIU Cun-gen
2008-01-01
A network plan model of ship erection was established based on the network planning technologyand the work-package breakdown system. The load-oriented production control method was introduced to buildup a throughput diagram model thus it is possible to describe the ship erection process numerically. Based onthe digitaiized models some cases of production balance of ship erection were studied and three balance indexeswere put forward, they are the load balance rate, the input manpower balance rate and the maximum gantrycrane operating times. Such an analytic method based on the balance evaluation is the important foundationfor digitization and intelligentization of shipyard production management.
The balance principle in scientific research.
Hu, Liang-ping; Bao, Xiao-lei; Wang, Qi
2012-05-01
The principles of balance, randomization, control and repetition, which are closely related, constitute the four principles of scientific research. The balance principle is the kernel of the four principles which runs through the other three. However, in scientific research, the balance principle is always overlooked. If the balance principle is not well performed, the research conclusion is easy to be denied, which may lead to the failure of the whole research. Therefore, it is essential to have a good command of the balance principle in scientific research. This article stresses the definition and function of the balance principle, the strategies and detailed measures to improve balance in scientific research, and the analysis of the common mistakes involving the use of the balance principle in scientific research.
DRAMAtic transforms in magic angle spinning recoupling NMR: The Bessel function pathway.
Goodman, Russell; Hancock, Jason; Siemens, Mark; Jarrell, Harold; Siminovitch, David
2005-07-01
In magic angle spinning (MAS) NMR recoupling experiments, the extraction of multiple couplings or a coupling distribution from the observed dephasing signals remains a challenging problem. At least for REDOR experiments, the REDOR transform solves this problem, enabling the simultaneous measurement of multiple dipolar couplings. Focusing on the quadrupolar dephasing observed in QUADRAMA experiments as a representative example, we demonstrate that the same analytical form used for the mathematical description of REDOR dephasing also describes the dephasing observed in a wide variety of MAS NMR recoupling experiments. This fact immediately extends REDOR transform techniques to a much broader suite of recoupling experiments than had previously been realized, including those of DRAMA, MELODRAMA and QUADRAMA. As an illustration, we use the DRAMAtic transform to provide the first inversion of a QUADRAMA dephasing signal to extract the quadrupole coupling distribution. Using a complete elliptic integral of the first kind, we further develop a novel expression for the Pake-spun powder patterns of the corresponding recoupled lineshapes. Our methods and results reinforce the central role that Bessel functions can play in simplifying the integrals that define both the dephasing signals in the time domain, and their Fourier transforms in the frequency domain.
Siriphorn, Akkradate; Chamonchant, Dannaovarat
2015-01-01
[Purpose] The potential health benefits of the Nintendo Wii balance board exercise have been widely investigated. However, no study has been conducted to examine the benefits of Wii exercise for overweight young adults. The aim of this study was to investigate the effect of exercise performed on a Nintendo Wii balance board on the balance and lower limb muscle strength in overweight young adults. [Subjects and Methods] Within-subject repeated measures analysis was used. Sixteen young adults (aged 21.87±1.13 years, body mass index 24.15 ± 0.50 kg/m(2)) were recruited. All subjects performed an exercise program on a Wii balance board for 8 weeks (30 min/session, twice a week for 8 weeks). A NeuroCom Balance Master and a hand-held dynamometer were used to measure balance performance and lower limb muscle strength. [Results] According to the comparison of pre- and post-intervention measurements, the Wii balance board exercise program significantly improved the limit of stability parameters. There was also a significant increase in strength of four lower-limb muscle groups: the hip flexor, knee flexor, ankle dorsiflexor and ankle plantarflexor. [Conclusion] These findings suggest that a Wii balance board exercise program can be used to improve the balance and lower limb muscle strength of overweight young adults.
Homnick, Douglas N; Henning, Kim M; Swain, Charlene V; Homnick, Tamara D
2013-07-01
Falls are an important cause of morbidity in older adults. Equine-assisted activities including therapeutic riding (TR) benefit balance and neuromuscular control in patients with neurological disabilities but have not been systematically studied in older adults at greater risk for falls due to balance deficits. The effect of an 8-week TR program on measures of balance and quality of life in community-dwelling older adults with established balance deficits was evaluated. This was a pretest-post-test single-group trial of a TR program on measures of balance and quality of life. The study was conducted at a Professional Association of Therapeutic Horsemanship (PATH) International Premier riding center. The subjects comprised 9 adults (5 female, 4 males) with a mean age 76.4 years (range 71-83 years). This included an 8-week observation period followed by an 8-week TR program consisting of 1 hour per week of supervised horseback riding and an 8-week follow-up period. SUBJECTS received balance testing at weeks 0, 8, 16, and 24 using the Fullerton Advanced Balance Scale (FABS), and quality of life was measured at weeks 8 and 16 using the Rand SF (short form) 36 quality-of-life measure. OUTCOME MEASURES were change in the FABS and Rand SF 36. There was no significant difference in balance scores between the start and end of the observation period. There was a significant improvement in the balance score and perception of general health from the start to the end of the intervention period, and no significant difference between the end of the intervention and the end of study, suggesting that improvements may have been sustained. TR is a safe activity for older adults with mild to moderate balance deficits and leads to both improvements in balance and quality of life. Longer and larger studies to assess the benefit of equine-assisted activities on improvements in balance and reduction in fall risk are needed.
Modern rotor balancing - Emerging technologies
Zorzi, E. S.; Von Pragenau, G. L.
1985-01-01
Modern balancing methods for flexible and rigid rotors are explored. Rigid rotor balancing is performed at several hundred rpm, well below the first bending mode of the shaft. High speed balancing is necessary when the nominal rotational speed is higher than the first bending mode. Both methods introduce weights which will produce rotor responses at given speeds that will be exactly out of phase with the responses of an unbalanced rotor. Modal balancing seeks to add weights which will leave other rotor modes unaffected. Also, influence coefficients can be determined by trial and error addition of weights and recording of their effects on vibration at speeds of interest. The latter method is useful for balancing rotors at other than critical speeds and for performing unified balancing beginning with the first critical speed. Finally, low-speed flexible balancing permits low-speed tests and adjustments of rotor assemblies which will not be accessible when operating in their high-speed functional configuration. The method was developed for the high pressure liquid oxygen turbopumps for the Shuttle.
Vardi, Yoram; Sprecher, Elliot; Gruenwald, Ilan; Yarnitsky, David; Gartman, Irena; Granovsky, Yelena
2009-06-01
There is a need for an objective technique to assess the degree of hypoactive sexual desire disorder (HSDD). Recently, we described such a methodology (event-related potential technique [ERP]) based on recording of p300 electroencephalography (EEG) waves elicited by auditory stimuli during synchronous exposure to erotic films. To compare sexual interest of sexually healthy women to females with sexual dysfunction (FSD) using ERP, and to explore whether FSD women with and without HSDD would respond differently to two different types of erotic stimuli-films containing (I) or not containing (NI) sexual intercourse scenes. Twenty-two women with FSD, of which nine had HSDD only, and 30 sexually healthy women were assessed by the Female Sexual Functioning Index. ERP methodology was performed applying erotic NI or I films. Significant differences in percent of auditory p300 amplitude reduction (PR) in response to erotic stimuli within and between all three groups for each film type. PRs to each film type were similar in sexually healthy women (60.6% +/- 40.3 (NI) and 51.7% +/- 32.3 [I]), while in women with FSD, reduction was greater when viewing the NI vs. I erotic films (71.4% +/- 41.0 vs. 37.7% +/- 45.7; P = 0.0099). This difference was mainly due to the greater PR of the subgroup with HSDD in response to NI vs. I films (77.7% +/- 46.7 vs. 17.0% +/- 50.3) than in the FSD women without HSDD group or the sexually healthy women (67.5% +/- 38.7 vs. 50.4% +/- 39.4 respectively), P = 0.0084. For comparisons, we used the mixed-model one-way analysis of variance. Differences in neurophysiological response patterns between sexually healthy vs. sexually dysfunctional females may point to a specific inverse discrimination ability for sexually relevant information in the subgroup of women with HSDD. These findings suggest that the p300 ERP technique could be used as an objective quantitative tool for libido assessment in sexually dysfunctional women.
Application of Chybeshev Polynomials in Factorizations of Balancing and Lucas-Balancing Numbers
Directory of Open Access Journals (Sweden)
Prasanta Kumar Ray
2012-01-01
Full Text Available In this paper, with the help of orthogonal polynomial especially Chybeshev polynomials of first and second kind, number theory and linear algebra intertwined to yield factorization of the balancing and Lucas-balancing numbers.
BALCI, Nilay ??m?k; TONGA, Eda; G?L?EN, Mustafa
2013-01-01
This pilot study aimed to investigate the effect of balance training by Tetraks Interactive Balance System (TIBS) on balance and fall risk in patients with mild to moderate Parkinson?s disease. Four patients with Parkinson?s disease between the ages of 56 and 70 years (61.25?6.70) were applied balance training for 3 weeks by TIBS. Sociodemographic features and physical properties of the subjects were recorded. Their motor performance was evaluated by the Unified Parkinson?s Disease Rating Sca...
Bonnechère, Bruno; Jansen, Bart; Omelina, Lubos; Sholukha, Victor; Van Sint Jan, Serge
2016-09-01
Balance and posture can be affected in various conditions or become decreased with aging. A diminution of balance control induces an increase of fall's risk. The Nintendo Wii Balance Board™ (WBB) is used in rehabilitation to perform balance exercises (using commercial video games). The WBB has also been validated to assess balance and posture in static conditions. However, there is currently no study investigating the use of WBB to assess balance during the realization of balance exercises using this device. The aim of this study was to validate the use of WBB, coupled with specially developed serious games, to assess dynamic balance during rehabilitation exercises. Thirty five subjects participated in this study. Subjects were asked to play two specially developed serious games. Center of pressure (CP) displacements were simultaneously recorded with a WBB and a gold standard force plate (FP). Nine parameters were derived from CP displacement. Bland and Altman plots, paired-sample t tests, intraclass correlation coefficient's, and Pearson's coefficient correlations were computed. Excellent correlation between both devices was found for each parameter for the two games (R = 0.95 and 0.96). Unlike previous work on the WBB, these excellent results were obtained without using any calibration procedure. Despite this, results were highly correlated between the WBB and the FP. The WBB could be used in clinics to assess balance during rehabilitation exercises and, thus, allows a more regular patient follow-up.
Cho, Ki Hun; Lee, Kyoung Jin; Song, Chang Ho
2012-09-01
Stroke is one of the most serious healthcare problems and a major cause of impairment of cognition and physical functions. Virtual rehabilitation approaches to postural control have been used for enhancing functional recovery that may lead to a decrease in the risk of falling. In the present study, we investigated the effects of virtual reality balance training (VRBT) with a balance board game system on balance of chronic stroke patients. Participants were randomly assigned to 2 groups: VRBT group (11 subjects including 3 women, 65.26 years old) and control group (11 subjects including 5 women, 63.13 years old). Both groups participated in a standard rehabilitation program (physical and occupational therapy) for 60 min a day, 5 times a week for 6 weeks. In addition, the VRBT group participated in VRBT for 30 min a day, 3 times a week for 6 weeks. Static balance (postural sway velocity with eyes open or closed) was evaluated with the posturography. Dynamic balance was evaluated with the Berg Balance Scale (BBS) and Timed Up and Go test (TUG) that measures balance and mobility in dynamic balance. There was greater improvement on BBS (4.00 vs. 2.81 scores) and TUG (-1.33 vs. -0.52 sec) in the VRBT group compared with the control group (P < 0.05), but not on static balance in both groups. In conclusion, we demonstrate a significant improvement in dynamic balance in chronic stroke patients with VRBT. VRBT is feasible and suitable for chronic stroke patients with balance deficit in clinical settings.
Russia - Nato. The military balance
Daugaard, Søren Bech; Jacobsen, Karen Vestergård; Aigro, Signe; Skarequist, Anne
2010-01-01
This project aims to explain how the military balancing of Russia against NATO can be explained from a neoclassical realist framework. The project consists in three analytical parts of respectively, 1: The military capabilities balance between NATO and Russia; 2: How the international system puts pressure on Russia; and 3: How the strategic culture of Russia can explain its balancing. This project aims to explain how the military balancing of Russia against NATO can be explained from a neo...
Leadership and Work-Life Balance.
Mattock, Sarah L
2015-01-01
Simply stated, work-life balance is something that is both difficult to define and difficult to achieve. Leaders, throughout the continuum of trauma care, need to have a sound understanding of what work-life balance means and set an example of a healthy work-life balance for those they lead. This article offers strategies for enhancing work-life balance and challenges individuals to use self-reflection as a means to furthering their personal and professional growth.
DEFF Research Database (Denmark)
2011-01-01
Udstilling på Medicinsk Museion. Baseret på bevilling fra Assens Fond. Se mere på http://www.museion.ku.dk/whats-on/exhibitions/balance-and-metabolism/......Udstilling på Medicinsk Museion. Baseret på bevilling fra Assens Fond. Se mere på http://www.museion.ku.dk/whats-on/exhibitions/balance-and-metabolism/...
DEFF Research Database (Denmark)
Jukka, Minna; Blomqvist, Kirsimarja; Li, Peter Ping
2017-01-01
notion of "guanxi" as personal ties. In contrast, the Finnish managers' view of trustworthiness was more associated with depersonalized organizational attributes. They emphasized the dimension of integrity, especially promise-keeping. In addition, tentative signs of trust ambivalence, as a balance...... opposites constitute a duality to be managed from the perspective of yin-yang balancing....
Park, Dae-Sung; Lee, GyuChang
2014-06-10
A balance test provides important information such as the standard to judge an individual's functional recovery or make the prediction of falls. The development of a tool for a balance test that is inexpensive and widely available is needed, especially in clinical settings. The Wii Balance Board (WBB) is designed to test balance, but there is little software used in balance tests, and there are few studies on reliability and validity. Thus, we developed a balance assessment software using the Nintendo Wii Balance Board, investigated its reliability and validity, and compared it with a laboratory-grade force platform. Twenty healthy adults participated in our study. The participants participated in the test for inter-rater reliability, intra-rater reliability, and concurrent validity. The tests were performed with balance assessment software using the Nintendo Wii balance board and a laboratory-grade force platform. Data such as Center of Pressure (COP) path length and COP velocity were acquired from the assessment systems. The inter-rater reliability, the intra-rater reliability, and concurrent validity were analyzed by an intraclass correlation coefficient (ICC) value and a standard error of measurement (SEM). The inter-rater reliability (ICC: 0.89-0.79, SEM in path length: 7.14-1.90, SEM in velocity: 0.74-0.07), intra-rater reliability (ICC: 0.92-0.70, SEM in path length: 7.59-2.04, SEM in velocity: 0.80-0.07), and concurrent validity (ICC: 0.87-0.73, SEM in path length: 5.94-0.32, SEM in velocity: 0.62-0.08) were high in terms of COP path length and COP velocity. The balance assessment software incorporating the Nintendo Wii balance board was used in our study and was found to be a reliable assessment device. In clinical settings, the device can be remarkably inexpensive, portable, and convenient for the balance assessment.
Chang, Jasper O; Levy, Susan S; Seay, Seth W; Goble, Daniel J
2014-05-01
Recent guidelines advocate sports medicine professionals to use balance tests to assess sensorimotor status in the management of concussions. The present study sought to determine whether a low-cost balance board could provide a valid, reliable, and objective means of performing this balance testing. Criterion validity testing relative to a gold standard and 7 day test-retest reliability. University biomechanics laboratory. Thirty healthy young adults. Balance ability was assessed on 2 days separated by 1 week using (1) a gold standard measure (ie, scientific grade force plate), (2) a low-cost Nintendo Wii Balance Board (WBB), and (3) the Balance Error Scoring System (BESS). Validity of the WBB center of pressure path length and BESS scores were determined relative to the force plate data. Test-retest reliability was established based on intraclass correlation coefficients. Composite scores for the WBB had excellent validity (r = 0.99) and test-retest reliability (R = 0.88). Both the validity (r = 0.10-0.52) and test-retest reliability (r = 0.61-0.78) were lower for the BESS. These findings demonstrate that a low-cost balance board can provide improved balance testing accuracy/reliability compared with the BESS. This approach provides a potentially more valid/reliable, yet affordable, means of assessing sports-related concussion compared with current methods.
Balanced Scorecard voor inkoop
van der Honing, R.; Schotanus, Fredo
2003-01-01
Een Balanced Scorecard kan ontwikkeld worden voor de hele organisatie, maar ook voor onderdelen daarvan. In dit artikel wordt ingegaan op de ontwikkeling van een Balanced Scorecard voor de inkoopafdeling
Energy balance in tearing modes
International Nuclear Information System (INIS)
Wesson, J.A.
1993-01-01
The energy balance in tearing modes is described in terms of exact separate energy balance equations. Each of these equations describes identified physical processes, and their sum gives the conservation of total energy. One of the energy balance equations corresponds to Furth's description. (Author)
Work-Life Balance: Strategies for Attaining and Maintaining Work-Life Balance
Winkler, Josette Chinchiolo
2010-01-01
Purpose: It was the purpose of this study (a) to identify and describe the elements of balance that elementary principals perceive as most important to their personal and professional lives; (b) to identify the strategies elementary principals perceive as most important to maintain balance in their personal and professional lives; (c) to determine…
Preparation for Early Termination of Ignalina NPP Operation
International Nuclear Information System (INIS)
Poskas, P.; Poskas, R.
2003-01-01
Seimas (Parliament of Lithuania) approved updated National Energy strategy where it is indicated that first Unit will be shutdown before the year 2005 and second Unit in 2009 if funding for decommissioning is available from EU and other donors. In accordance to Ignalina NPP Unit 1 Closure Law the Government of Lithuania approved the Ignalina NPP Unit 1 Decommissioning Program until year 2005. For enforcement of this program, the plan of measures for implementation of the program was prepared and approved by the Minister of Economy. The plan consists of two parts, namely technical- environmental and social-economic. Technical-environmental measures are mostly oriented to the safe management of spent nuclear fuel and operational radioactive waste stored at the plant and preparation of licensing documents for Unit 1 decommissioning. Social-economic measures are oriented to mitigate negative social and economic impact on Lithuania, inhabitants of the region, and, particularly, o n the staff of Ignalina NPP by means of creating favorable conditions for a balanced social and economic development of the region. In this paper analysis of planned activities, licensing requirements for decommissioning, progress in preparation of the Final Decommissioning Plan is discussed
Prevalence and degree of sexual dysfunction in a sample of women seeking bariatric surgery.
Bond, Dale S; Vithiananthan, Siva; Leahey, Tricia M; Thomas, J Graham; Sax, Harry C; Pohl, Dieter; Ryder, Beth A; Roye, G Dean; Giovanni, Jeannine; Wing, Rena R
2009-01-01
Sexual functioning has been shown to be impaired in women who are obese, particularly those seeking bariatric surgery. However, most previous studies evaluating sexual function in these populations have not used validated measures. We used the validated Female Sexual Function Index (FSFI) to assess the prevalence of female sexual dysfunction (FSD) in a sample of >100 women evaluated for bariatric surgery. The FSFI was administered to reportedly sexually active women during their preoperative evaluation. The scores for the individual FSFI domains (desire, arousal, lubrication, orgasm, satisfaction, and pain) ranging from 0 (or 1.2) to 6 were summed to produce a FSFI total score (range 2-36). A FSFI total cutoff score of sexual arousal disorder and healthy controls. Of the 102 women, 61 (59.8%) had FSFI total scores of sexual arousal disorder group (all P values sexual function impairment, with 60% of participants reporting FSD. These findings highlight the need to initiate routine assessment of sexual functioning in this population and examine whether the weight loss after bariatric surgery contributes to a reversal of FSD.
Understanding decision making about balancing two stocks: the faculty gender balancing task
Bleijenbergh, I.L.; Vennix, J.A.M.; Jacobs, H.A.G.M.; Engen, M.L. van; Engen, M. van
2016-01-01
This paper contributes to the understanding of dynamic decision making. Using the faculty gender balancing task, we experimentally test the extent to which participants correctly estimate the inflow needed to balance two unbalanced stocks and how they substantiate their decision. The results show
International Nuclear Information System (INIS)
Schlamadinger, B.; Jungmeier, G.; Apps, M.; Bohlin, F.; Gustavsson, L.; Marland, G.; Pingoud, K.; Savolainen, I.
1997-01-01
In this paper, which was prepared as part of IEA Bioenergy Task XV (''Greenhouse Gas Balances of Bioenergy Systems''), we outline a standard methodology for comparing the greenhouse gas balances of bioenergy systems with those of fossil energy systems. Emphasis is on a careful definition of system boundaries. The following issues are dealt with in detail: time interval analysed and changes of carbon stocks; reference energy systems; energy inputs required to produce, process and transport fuels; mass and energy losses along the entire fuel chain; energy embodied in facility infrastructure; distribution systems; cogeneration systems; by-products; waste wood and other biomass waste for energy; reference land use; and other environmental issues. For each of these areas recommendations are given on how analyses of greenhouse gas balances should be performed. In some cases we also point out alternative ways of doing the greenhouse gas accounting. Finally, the paper gives some recommendations on how bioenergy systems should be optimized from a greenhouse-gas emissions point of view. (author)
The Impact of Trade Balance in the Current Account of Kosovo’s Balance of Payments
Directory of Open Access Journals (Sweden)
Safet Merovci
2014-02-01
Full Text Available The trade deficit and specifically the current account deficit are the main challenges that Kosovo‘s economy is facing. According to the Balance of Payments Statistics (BOP, the trade balance of goods is the largest component, expressed in absolute and relative terms and consequently it determines the behavior of the current account balance. Trade deficit to GDP ratio is very high - more than 50 percent. Regarding this, financing the constant deficit of the current account is becoming a real problem, because in the long run it is impossible for a country to spend more than its income without becoming a debtor to the rest of the world. Given the unchanged structure of the current account of the Balance of Payments, we conclude that, an improvement of the trade balance is a precondition to the improvement of the current account balance. This can be done through longterm and sustainable substitution of imports with domestic production and also with effective export promotion. Increasing foreign direct investment and export promotion can be considered, in the longer term, the main way to improve Kosovo's Trade Balance.
Esculier, Jean-Francois; Vaudrin, Joanie; Bériault, Patrick; Gagnon, Karine; Tremblay, Louis E
2012-02-01
To evaluate the effects of a home-based balance training programme using visual feedback (Nintendo Wii Fit game with balance board) on balance and functional abilities in subjects with Parkinson's disease, and to compare the effects with a group of paired healthy subjects. Ten subjects with moderate Parkinson's disease and 8 healthy elderly subjects. Subjects participated in a 6-week home-based balance training programme using Nintendo Wii Fit and balance board. Baseline measures were taken before training for the Sit-to-Stand test (STST), Timed-Up-and-Go (TUG), Tinetti Performance Oriented Mobility Assessment (POMA), 10-m walk test, Community Balance and Mobility assessment (CBM), Activities-specific Balance and Confidence scale (ABC), unipodal stance duration, and a force platform. All measurements were taken again after 3 and 6 weeks of training. The Parkinson's disease group significantly improved their results in TUG, STST, unipodal stance, 10-m walk test, CBM, POMA and force platform at the end of the 6-week training programme. The healthy subjects group significantly improved in TUG, STST, unipodal stance and CBM. This pilot study suggests that a home-based balance programme using Wii Fit with balance board could improve static and dynamic balance, mobility and functional abilities of people affected by Parkinson's disease.
Lifescience Database Archive (English)
Full Text Available c*nsxw*npspwkskvvitlxmskpkxktkkvfxqin kvsfsxvnn*xxavlxxittskxnplsx*fsd*kvvckxl*kpxlvxpsxwkxkvxitxk msxpkfxtk...tiffck***liiif*ilyffkhikiffflcilfffpfxhin*lckfllklslvkps hwklkvxttlkmsxlkfktkkvfh
Directory of Open Access Journals (Sweden)
Emilio J. Martínez-López Emilio
2014-06-01
Full Text Available The purpose of the present study was to determine the effects of a proprioceptive training program on older adults, as well as to analyze the association between flexibility, balance and lumbar strength (physical fitness test with balance ability and fall risk (functional balance tests. This study was a controlled, longitudinal trial with a 12-week follow-up period. Subjects from a population of older adults were allocated to the intervention group (n = 28 or to the usual care (control group (n = 26. Subjects performed proprioceptive training twice weekly (6 specific exercises with Swiss ball and BOSU. Each session included 50 minutes (10 minutes of warm-up with slow walk, 10 minutes of mobility and stretching exercises, 30 minutes of proprioceptive exercises. The outcome variables were physical fitness (lower-body flexibility, hip-joint mobility, dynamic balance, static balance, and lumbar strength and functional balance (Berg scale and Tinetti test. The experimental group obtained significantly higher values than the control group in lower-body flexibility, dynamic balance, and lumbar strength (p = 0.019, p < 0.001, and p = 0.034 respectively. Hip-joint mobility, dynamic balance, and lumbar strength were positively associated with balance ability (p < 0.001, p < 0.001, and p = 0.014, respectively and the prevention of falls (p = 0.001, p < 0.001, and p = 0.017 respectively. These findings suggest that a 12-week proprioception program intervention (twice a week significantly improves flexibility, balance, and lumbar strength in older adults. Hip-joint mobility, dynamic balance and lumbar strength are positively associated to balance ability and the risk of falls in older adults. This proprioceptive training does not show a significant improvement in hip-joint mobility or static balance.
Work-life balancing: challenges and strategies.
Chittenden, Eva H; Ritchie, Christine S
2011-07-01
Balancing the personal and the professional is an ongoing struggle for most professionals, and palliative care clinicians are no exception. A sustained lack of balance can lead to feelings of frustration, inadequacy, and guilt. Palliative care physicians may find this balance particularly difficult due to the nature of their work: caring for patients and families who are often suffering and in crisis. In this article, we describe challenges to work-life balancing and strategies that may promote balance, including "timeshifting," goal setting, cognitive reframing, and self-care. We argue that the search for balance is a lifelong endeavor that entails self-reflection and continuing examination of one's values and goals.
Balanced articulated manipulator
International Nuclear Information System (INIS)
Francois, Daniel; Germond, J.-C.; Marchal, Paul; Vertut, Jean.
1976-01-01
The description is given of a manipulator of the type comprising a master arm and a slave arm, capable of working in a containment restricted by a wall fitted with an aperture to introduce the slave arm into the containment. According to the invention this manipulator is permanently balanced irrespective of its distortions when it is secured to the wall of the containment in which it is desired to work. The entire manipulator is also balanced when being set up and when moved outside the containment, in relation to a supporting axle. This result is achieved in a simplified manner by giving homothetic shapes to the various component parts of the slave and master arms, the master arm having at least one balancing weight [fr
Directory of Open Access Journals (Sweden)
Marica Giardini
2018-01-01
Full Text Available We hypothesised that rehabilitation specifically addressing balance in Parkinson’s disease patients might improve not only balance but locomotion as well. Two balance-training protocols (standing on a moving platform and traditional balance exercises were assessed by assigning patients to two groups (Platform, n=15, and Exercises, n=17. The platform moved periodically in the anteroposterior, laterolateral, and oblique direction, with and without vision in different trials. Balance exercises were based on the Otago Exercise Program. Both platform and exercise sessions were administered from easy to difficult. Outcome measures were (a balancing behaviour, assessed by both Index of Stability (IS on platform and Mini-BESTest, and (b gait, assessed by both baropodometry and Timed Up and Go (TUG test. Falls Efficacy Scale-International (FES-I and Parkinson’s Disease Questionnaire (PDQ-8 were administered. Both groups exhibited better balance control, as assessed both by IS and by Mini-BESTest. Gait speed at baropodometry also improved in both groups, while TUG was less sensitive to improvement. Scores of FES-I and PDQ-8 showed a marginal improvement. A four-week treatment featuring no gait training but focused on challenging balance tasks produces considerable gait enhancement in mildly to moderately affected patients. Walking problems in PD depend on postural instability and are successfully relieved by appropriate balance rehabilitation. This trial is registered with ClinicalTrials.gov NCT03314597.
METHODOLOGY OF TECHNIQUE PREPARATION FOR LOW VISION JAVELIN THROWERS
Directory of Open Access Journals (Sweden)
Milan Matić
2013-07-01
Full Text Available Javelin throwing discipline for disabled people has been expanding couple of years back. In addition, world’s records have been improving year after year. The esential part in preparation of low vision javelin throwers is mastering the technique elements, crucial for acquiring better results. Method of theoretical analysis, decriptive and comparative methods of survey were applied. Relevant knowledge in the area of low vision javelin throwers was analyzed and systematized, and then interpretated theoretically and applied on the top javelin thrower, which served as a base for the inovative apporoach in methodology and praxis with disabled people. Due to visual impairment, the coordination and balance are challenged. This limitation practically makes the difference in methodology, explained in this article. Apart from the goals focused on improving the condition and results on competitions, more specialized goals should be considered, e.g. improving of orientation, balance and socialization process for the people who have low vision. Special approach used in the technique preparation brought the significant improvement in techique of our famous Paralympian Grlica Miloš. In addition to the technique improvement he acquired better results on the big competitions and a few worldwide valuable prizes were won. The area of ’sport for disabled people’ is not enough present in the praxis of sport’s workers. More articles and scientific surveys on this topic are needed for further work and results improvement with these kind of sportsmen.
DEFF Research Database (Denmark)
Hariri, Jacob Gerner; Wivel, Anders
2010-01-01
This paper explores the logic of balancing in structural realist theory. Arguably, the durability of the unipolar moment is a challenge to the logic of balancing. The paper uses the tools of microeconomics to build a mathematical model of structural realism. The simple model reiterates...... the structural realist prediction that the weaker states should balance the unipole. Under a slight model extension, it is shown that efforts to balance in separate capabilities always tends to offset each other. Under this extension, the durability of the unipolar moment is in fact consistent...
International Nuclear Information System (INIS)
Forbes, G.B.; Lantigua, R.; Amatruda, J.M.; Lockwood, D.H.
1981-01-01
Six overweight adult subjects given a low calorie diet containing adequate amounts of nitrogen but subnormal amounts of potassium (K) were observed on the Clinical Research Center for periods of 29 to 40 days. Metabolic balance of potassium was measured together with frequent assays of total body K by 40 K counting. Metabolic K balance underestimated body K losses by 11 to 87% (average 43%): the intersubject variability is such as to preclude the use of a single correction value for unmeasured losses in K balance studies
Laganà, A S; Burgio, M A; Ciancimino, L; Sicilia, A; Pizzo, A; Magno, C; Butticè, S; Triolo, O
2015-08-01
Aim of the study was to assess the recovery and quality of sexual activity of women during postpartum, in relation to delivery. We recruited 200 women at 8 weeks after delivery. For each patient we recorded mode of delivery, age, body mass index (BMI), parity and test Female Sexual Function Index (FSFI) score. Sixty-four women (32%) had spontaneous deliveries without episiotomy, 48 (24%) had it with episiotomy, 88 (44%) had caesarean sections. The analysis of variance (ANOVA) test showed no significant differences among the 3 groups for age, BMI, parity. The test FSFI evidenced 68 cases (34%) of Regular Female Sexual Function (RFSF) and 132 (66%) of Female Sexual Dysfunction (FSD). The ANOVA test showed significant differences among the 3 groups in RFSF (F [2, 14]=8.075, P=0.005), but not in FSD (F [2, 30]=2.646, P=0.087). In RFSF, FSFI score was higher in women who had vaginal delivery with episiotomy compared with the other two groups. Conversely, in FSD (both with or without resumed sexual activity at 8 weeks postpartum) we evidenced that patients who had vaginal delivery with episiotomy showed lower FSFI score than the other two groups, with a decrease in lubrication, orgasm and satisfaction scores. Furthermore, we observed that most of the RFSF patients had a job and breastfed. Our results did not evidence a direct and significant correlation between mode of delivery and onset of female postpartum sexual dysfunction, even if FSD patients who underwent episiotomy during delivery markedly showed low FSFI scores.
Rosenfeld, Lindsay E; Cohen, Juliana Fw; Gorski, Mary T; Lessing, Andrés J; Smith, Lauren; Rimm, Eric B; Hoffman, Jessica A
2017-02-01
In autumn 2012, Massachusetts schools implemented comprehensive competitive food and beverage standards similar to the US Department of Agriculture's Smart Snacks in School standards. We explored major themes raised by food-service directors (FSD) regarding their school-district-wide implementation of the standards. For this qualitative study, part of a larger mixed-methods study, compliance was measured via direct observation of foods and beverages during school site visits in spring 2013 and 2014, calculated to ascertain the percentage of compliant products available to students. Semi-structured interviews with school FSD conducted in each year were analysed for major implementation themes; those raised by more than two-thirds of participating school districts were explored in relationship to compliance. Massachusetts school districts (2013: n 26; 2014: n 21). Data collected from FSD. Seven major themes were raised by more than two-thirds of participating school districts (range 69-100 %): taking measures for successful transition; communicating with vendors/manufacturers; using tools to identify compliant foods and beverages; receiving support from leadership; grappling with issues not covered by the law; anticipating changes in sales of competitive foods and beverages; and anticipating changes in sales of school meals. Each theme was mentioned by the majority of more-compliant school districts (65-81 %), with themes being raised more frequently after the second year of implementation (range increase 4-14 %). FSD in more-compliant districts were more likely to talk about themes than those in less-compliant districts. Identified themes suggest best-practice recommendations likely useful for school districts implementing the final Smart Snacks in School standards, effective July 2016.
DEFF Research Database (Denmark)
Mortier, Séverine Thérèse F.C.; Daele, Timothy, Van; Gernaey, Krist V.
2013-01-01
in the reduced model. Simulations of the complex drying model were, in a next phase, used to develop the reduced model, which describes the decrease of the moisture content in function of the gas temperature. The developed reduced model was then included in a Population Balance Equation (PBE) to describe......The development of a Population Balance Model (PBM) for a pharmaceutical granule drying process requires a continuous growth term; the latter actually represents the drying process as the moisture content is the internal coordinate of the PBM. To establish such a PBM, a complex drying model...
26 CFR 1.430(f)-1 - Effect of prefunding balance and funding standard carryover balance.
2010-04-01
... Effect of prefunding balance and funding standard carryover balance. (a) In general—(1) Overview. This... were employed by a single employer. (b) Maintenance of balances—(1) Prefunding balance—(i) In general...) In general. If the plan sponsor of a plan elects to add to the plan's prefunding balance, as of the...
Engineering redox balance through cofactor systems.
Chen, Xiulai; Li, Shubo; Liu, Liming
2014-06-01
Redox balance plays an important role in the production of enzymes, pharmaceuticals, and chemicals. To meet the demands of industrial production, it is desirable that microbes maintain a maximal carbon flux towards target metabolites with no fluctuations in redox. This requires functional cofactor systems that support dynamic homeostasis between different redox states or functional stability in a given redox state. Redox balance can be achieved by improving the self-balance of a cofactor system, regulating the substrate balance of a cofactor system, and engineering the synthetic balance of a cofactor system. This review summarizes how cofactor systems can be manipulated to improve redox balance in microbes. Copyright © 2014 Elsevier Ltd. All rights reserved.
A practical approach to flexible rotor balancing
International Nuclear Information System (INIS)
Khan, M.I.; Chohan, G.Y.; Khan, M.Z.
2001-01-01
There are various conventional methods for flexible rotor balancing. These :methods have been applied successfully for balancing cylindrical rotors since long. One of these mostly used is modal balancing. Besides its usefulness, difficulties are encountered when sufficient number of balancing planes are not available under certain conditions where a rotor is enclosed at its both ends by discs. In this work, a practical technique of counter balancing has been introduced. This technique has proved its importance in balancing the rotors. We would discuss efficiency of this technique over the conventional modal balancing. (author)
Zheng, Wei; Xiong, Xufan; Lin, Richeng; Zhang, Zhaojun; Xu, Cunhua; Huang, Feng
2018-01-17
Here, we reported a low-cost and high-compatibility one-step liquid-phase synthesis method for synthesizing high-purity CsPbBr 3 micro-/nanoflake single crystals. On the basis of the high-purity CsPbBr 3 , we further prepared a low-dimensional photodetector capable of balanced photodetection, involving both high external quantum efficiency and rapid temporal response, which is barely realized in previously reported low-dimensional photodetectors.
46 CFR 232.4 - Balance sheet accounts.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Balance sheet accounts. 232.4 Section 232.4 Shipping... ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Balance Sheet § 232.4 Balance sheet accounts. (a.... (b) Purpose of balance sheet accounts. The balance sheet accounts are intended to disclose the...
Conclusion: The balanced company
DEFF Research Database (Denmark)
Scheuer, John Damm; Jensen, Inger
2013-01-01
This concluding chapter brings together the various research findings of the book "The balanced company - organizing for the 21st Century" and develops a general overview of their implications for our understanding of the balancing processes unfolding in companies and organizations....
Directory of Open Access Journals (Sweden)
Rafael Merino Marban, Daniel Mayorga Vega, Emilio Fernández Rodríguez, Francisco José Santana Pérez, Oscar Romero Ramos
2011-01-01
Full Text Available Based on the body’s energy field, the inventors of Power Balance® have created a hologram that theoretically runs through frequencies that are in our natural environment. Its creators say that people may experience improve balance, strength, flexibility, endurance, concentration, coordination and recovery time, among others. The purpose of this research is to evaluate the effect of Power Balance® hologram on balance, flexibility, strength and speed-coordination in university students. A sample of 105 young volunteers’ physical education students (age 20.91 ± 3.36 years, mass 69.69 ± 11.35 kg, height 171.70 ± 8.07 cm was used. A between-group experimental design with double-blind control group was used to evaluate the possible effects of the Power Balance ® on the dynamic balance, flexibility, abdominal strength, endurance and speed-coordination measured with the Dynamic Balance Test, Sit and Reach, Sit-ups in 30 seconds and Race 10 x 5 m, respectively. A t of Student for independent and dependent samples was used to assess the potential effects between-group and intra-group, respectively. Power Balance®’s hologram produces no significant effects on the balance, flexibility, strength and speed-coordination among university students
Treacy, Daniel; Schurr, Karl; Sherrington, Catherine
2013-07-20
Impaired balance and mobility are common among rehabilitation inpatients. Poor balance and mobility lead to an increased risk of falling. Specific balance exercise has been shown to improve balance and reduce falls within the community setting. However few studies have measured the effects of balance exercises on balance within the inpatient setting. A single centre, randomised controlled trial with concealed allocation, assessor blinding and intention-to-treat analysis. One hundred and sixty two patients admitted to the general rehabilitation ward at Bankstown-Lidcombe Hospital will be recruited. Eligible participants will have no medical contraindications to exercise and will be able to: fully weight bear; stand unaided independently for at least 30 seconds; and participate in group therapy sessions with minimal supervision. Participants will be randomly allocated to an intervention group or usual-care control group. Both groups will receive standard rehabilitation intervention that includes physiotherapy mobility training and exercise for at least two hours on each week day. The intervention group will also receive six 1-hour circuit classes of supervised balance exercises designed to maximise the ability to make postural adjustments in standing, stepping and walking. The primary outcome is balance. Balance will be assessed by measuring the total time the participant can stand unsupported in five different positions; feet apart, feet together, semi-tandem, tandem and single-leg-stance. Secondary outcomes include mobility, self reported physical functioning, falls and hospital readmissions. Performance on the outcome measures will be assessed before randomisation and at two-weeks and three-months after randomisation by physiotherapists unaware of intervention group allocation. This study will determine the impact of additional balance circuit classes on balance among rehabilitation inpatients. The results will provide essential information to guide evidence
Ustun, Yakup; Aslan, Tugrul; Sagsen, Burak; Kesim, Bertan
2015-01-01
The aim of the present study was to investigate the incidence of dentinal microcracks caused by different preparation techniques. 120 extracted human mandibular incisor teeth were divided into five experimental groups and one control group (n = 20): Group 1: Hand preparation with balanced force technique up to #25 K-file. Group 2: Preparation with only ProTaper F2 instrument in a reciprocating movement. Group 3: Preparation with Reciproc R25 instrument in a reciprocating movement. Group 4: Preparation with ProTaper instruments up to F2 instrument. Group 5: Preparation with ProTaper Next instruments up to X2 instrument. No procedure was applied to control group. The roots were sectioned horizontally at 3, 6 and 9 mm from the apex and examined. Absence or presence of dentinal microcracks was noted. The Chi-square test was performed to compare the appearance of cracked roots between all groups. There were no significant differences among the groups (P > 0.05). In conclusion, except the hand file and control group, all experimental groups showed microcrack formations.
How to select BCAA preparations.
Kato, Akinobu; Suzuki, Kazuyuki
2004-12-01
In Japan, oral branched-chain amino acid (BCAA) preparations are used in nutritional therapy for correcting disorders of protein and amino acid metabolism in patients with liver cirrhosis. There are two forms of oral BCAA preparations: enteral nutrition products for liver failure (or elemental nutrition products for liver cirrhosis) and oral BCAA granular products. Granular products are indicated for patients with uncompensated liver cirrhosis who have no dietary restriction and hypoproteinemia. Enteral nutrition products are indicated for patients who have a history of hepatic encephalopathy and exhibit protein intolerance. In clinical practice, the existence of protein intolerance in patients with uncompensated liver cirrhosis should be determined based on a history of hepatic encephalopathy and blood ammonia concentration. When patients exhibit protein intolerance, they are given a low protein diet (approximately 0.5-1.0g/kg/day) with enteral nutrition products for liver failure. However, when patients consume adequate amounts of a well-balanced diet and ammonia concentration does not increase, it is possible to control their condition with granular products. However, when patients cannot achieve an adequate dietary intake, it is recommended that enteral nutrition products should be used in order to improve nutritional status, even if these patients do not have a history of encephalopathy.
Ma, Baoguang; Hansen, Jens Henrik; Hvilsted, Søren; Skov, Anne Ladegaard
2015-01-01
Polydimethylsiloxane (PDMS) microspheres are prepared by mixing homogeneous dispersions of vinyl-functional PDMS and a curing agent using mechanical stirring in a series of aqueous solutions, and curing at 80 8C for 2 h. In order to verify the experimental diameter and size distributions of the PDMS microspheres, the Hinze-Kolmogorov theory is applied to predict the mean diameter, and a population balance model as well as the maximum entropy formalism are used to describe the size distributio...
Lessons learned in streamlining the preparation of SNM standard solutions
International Nuclear Information System (INIS)
Clark, J.P.; Johnson, S.R.
1986-01-01
Improved safeguard measurements have produced a demand for greater quantities of reliable SNM solution standards. At the Savannah River Plant (SRP), the demand for these standards has been met by several innovations to improve the productivity and reliability of standards preparations. With the use of computer controlled balance, large batches of SNM stock solutions are prepared on a gravimetric basis. Accurately dispensed quantities of the stock solution are weighed and stored in bottles. When needed, they are quantitatively transferred to tared containers, matrix adjusted to target concentrations, weighed, and measured for density at 25 0 C. Concentrations of SNM are calculated both gravimetrically and volumetrically. Calculated values are confirmed analytically before the standards are used in measurement control program (MCP) activities. The lessons learned include: MCP goals include error identification and management. Strategy modifications are required to improve error management. Administrative controls can minimize certain types of errors. Automation can eliminate redundancy and streamline preparations. Prudence and simplicity enhance automation success. The effort expended to increase productivity has increased the reliability of standards and provided better documentation for quality assurance
Jeon, Yong-Jin; Kim, Gyoung-Mo
2017-02-01
[Purpose] The purpose of this study was to investigate and compare the predictive properties of Berg Balance Scale and Fullerton Advanced Balance Scales, in a group of independently-functioning community dwelling older adults. [Subjects and Methods] Ninety-seven community-dwelling older adults (male=39, female=58) who were capable of walking independently on assessment were included in this study. A binary logistic regression analysis of the Berg Balance Scale and Fullerton Advanced Balance Scale scores was used to investigate a predictive model for fall risk. A receiver operating characteristic analysis was conducted for each, to determine the cut-off for optimal levels of sensitivity and specificity. [Results] The overall prediction success rate was 89.7%; the total Berg Balance Scale and Fullerton Advanced Balance Scale scores were significant in predicting fall risk. Receiver operating characteristic analysis determined that a cut-off score of 40 out of 56 on the Berg Balance Scale produced the highest sensitivity (0.82) and specificity (0.67), and a cut-off score of 22 out of 40 on the Fullerton Advanced Balance Scale produced the highest sensitivity (0.85) and specificity (0.65) in predicting faller status. [Conclusion] The Berg Balance Scale and Fullerton Advanced Balance Scales can predict fall risk, when used for independently-functioning community-dwelling older adults.
Form 6 - gas balancing agreement
International Nuclear Information System (INIS)
Anon.
1990-01-01
In 1988, a special Committee of the Rocky Mountain Mineral Law Foundation undertook a project to draft a model from gas balancing agreement. This project was initiated at the request of a number of Foundation members who felt that a model form gas balancing agreement would facilitate the negotiation of operating agreement, since gas balancing issues had become sticking points in the process. The Committee was composed of attorneys representing a wide cross-section of the oil and gas industry including both major and independent oil companies, production companies with interstate pipeline affiliates, and private practitioners. The Committee attempted to address the more controversial issues in gas balancing with optional provisions in the Form. To facilitate the negotiation process, the number of optional provisions was minimized. This form may be used as an Appendix to the new A.A.P.L. Form 610-1989 Model Form Operating Agreement. This book includes provision of this Form which are: Ownership of gas production; Balancing of production accounts; Cash balancing upon depletion; Deliverability tests; Nominations; Statements; Payment of taxes; Operating expenses; Overproducing allowable; Payment of leasehold burdens; Operator's liability; Successors and assigns; Audits; Arbitration; and Operator's fees
Institute of Scientific and Technical Information of China (English)
Li Honghong
2017-01-01
With the developing ofeconomy and society in Ordos,the government of DaladBannerrecognize the importance of promoting the balanced development of compulsory education ,which has become the focus of local government and education authorities.In this paper,it will begain with the the definition of concepts of education balance,and it will explain the measures and achievements of realizing compulsory education balance of Dalad Banner government,the standards of measuring compulsory education balance.Last but not least ,the paper makes in-depth analysis of the balance condition of education balance in Dalad Banner from the current situation of the compulsory education balance.
International Nuclear Information System (INIS)
Harmnd, Y.; Nebas-Hamoudia, C.; Larripa, B.; Neupont, B.
2005-01-01
As electricity is a non-storable product in large quantities, generation and consumption have to be balanced at all times. In France, this balancing was historically solely supplied by EDF. Recent legislative changes have opened balancing supplies, thus creating competition. RTE, the electricity transmission system operator, has developed, in consultation with the main market players, the balancing mechanism. This enables available capacities to be merged in order to guarantee this balance. It operates like a permanent bidding system open to producers, industrial consumers and foreign players. Bids submitted by players are selected by RTE depending on the system requirements, taking into account merit order criterion and technical constraints. Prices issued from the balancing mechanism are used to provide a legitimate reference price for the settlement of imbalances between supplies and consumptions of the different electricity market players. Transparency, a crucial element of this mechanism, is ensured by a comprehensive system of open data publication. Since its launch, the balancing mechanism has proven its operational strength. (author)
Psychology of the nuclear balance
Energy Technology Data Exchange (ETDEWEB)
Sonntag, P
1981-10-01
The balance of military forces is meant to prevent war. But it is a very precarious balance, which becomes all the more dubious when the deterrent is no longer psychologically effective: when the country attacked is deterred from striking back with nuclear weapons. A unilateral disarmament above the overkill level would be possible without endangering the balance. It would improve the climate for mutual disarmament.
Radar channel balancing with commutation
Energy Technology Data Exchange (ETDEWEB)
Doerry, Armin Walter
2014-02-01
When multiple channels are employed in a pulse-Doppler radar, achieving and maintaining balance between the channels is problematic. In some circumstances the channels may be commutated to achieve adequate balance. Commutation is the switching, trading, toggling, or multiplexing of the channels between signal paths. Commutation allows modulating the imbalance energy away from the balanced energy in Doppler, where it can be mitigated with filtering.
How body balance influences political party evaluations. A Wii balance board study.
Directory of Open Access Journals (Sweden)
Katinka eDijkstra
2012-12-01
Full Text Available Embodied cognition research has shown how actions or body positions may affect cognitive processes, such as autobiographical memory retrieval or judgments. The present study examined the role of body balance (to the left or the right in participants on their attributions to political parties. Participants thought they stood upright on a Wii™ Balance Board, while they were actually slightly tilted to the left or the right. Participants then ascribed fairly general political statements to one of ten political parties that are represented in the Dutch House of Representatives. Results showed a significant interaction of congruent leaning direction with left- or right wing party attribution. When the same analyses were performed with the political parties being divided into affiliations to the right, center, and left based on participants’ personal opinions rather than a ruling classification, no effects were found. The study provides evidence that conceptual metaphors are activated by manipulating body balance implicitly. Moreover, people’s judgments may be colored by seemingly trivial circumstances such as standing slightly out of balance.
How body balance influences political party evaluations: a wii balance board study.
Dijkstra, Katinka; Eerland, Anita; Zijlmans, Josjan; Post, Lysanne S
2012-01-01
Embodied cognition research has shown how actions or body positions may affect cognitive processes, such as autobiographical memory retrieval or judgments. The present study examined the role of body balance (to the left or the right) in participants on their attributions to political parties. Participants thought they stood upright on a Wii(™) Balance Board, while they were actually slightly tilted to the left or the right. Participants then ascribed fairly general political statements to one of 10 political parties that are represented in the Dutch House of Representatives. Results showed a significant interaction of congruent leaning direction with left- or right-wing party attribution. When the same analyses were performed with the political parties being divided into affiliations to the right, center, and left based on participants' personal opinions rather than a ruling classification, no effects were found. The study provides evidence that conceptual metaphors are activated by manipulating body balance implicitly. Moreover, people's judgments may be colored by seemingly trivial circumstances such as standing slightly out of balance.
Verdan, Princess J R; Marzilli, Thomas S; Barna, Geanina I; Roquemore, Anntionette N; Fenter, Brad A; Blujus, Brittany; Gosselin, Kevin P
2012-08-01
The purpose of this study was to determine the effect of Power Balance® bands on strength, flexibility, and balance. Strength and flexibility were measured using the MicroFit system. Strength was measured via a bicep curl and flexibility via the sit-and-reach method. Balance was measured by the BIODEX System SD. There were 4 different conditions for the balance test: eyes open on a firm surface (EOFS), eyes closed on a firm surface (ECFS), eyes open on a foam surface (EOFoS), and eyes closed on a foam surface (ECFoS). There were 24 subjects in the study (10 men and 14 women). A counterbalance, double-blind, placebo, controlled within-subject design was used. Each of the subjects participated in 3 treatment sessions, consisting of Power Balance®, placebo band, and no band. An alpha level of p ≤ 0.05 was set a priori. There were no significant differences in strength, flexibility, or balance with regard to the treatments used. There was a significant difference between the conditions in the balance test (p = 0.000): EOFS (0.51), ECFS (0.68), EOFoS (0.99), and ECFoS (2.18); however, these were independent of the treatment conditions. The results indicate that the Power Balance® bands did not have an effect on strength, flexibility, or balance.
Loss of balance during balance beam walking elicits a multifocal theta band electrocortical response
Sipp, Amy R.; Gwin, Joseph T.; Makeig, Scott; Ferris, Daniel P.
2013-01-01
Determining the neural correlates of loss of balance during walking could lead to improved clinical assessment and treatment for individuals predisposed to falls. We used high-density electroencephalography (EEG) combined with independent component analysis (ICA) to study loss of balance during human walking. We examined 26 healthy young subjects performing heel-to-toe walking on a treadmill-mounted balance beam as well as walking on the treadmill belt (both at 0.22 m/s). ICA identified clust...
A balancing act? Work-life balance, health and well-being in European welfare states
Lunau, Thorsten; Bambra, Clare; Eikemo, Terje Andreas; van Der Wel, Kjetil A.; Dragano, Nico
2014-01-01
Background: Recent analyses have shown that adverse psychosocial working conditions, such as job strain and effort–reward imbalance, vary by country and welfare state regimes. Another work-related factor with potential impact on health is a poor work–life balance. The aims of this study are to determine the association between a poor work–life balance and poor health across a variety of European countries and to explore the variation of work–life balance between European countries. Methods: D...
Chang, Wen-Dien; Chang, Wan-Yi; Lee, Chia-Lun; Feng, Chi-Yen
2013-10-01
[Purpose] Balance is an integral part of human ability. The smart balance master system (SBM) is a balance test instrument with good reliability and validity, but it is expensive. Therefore, we modified a Wii Fit balance board, which is a convenient balance assessment tool, and analyzed its reliability and validity. [Subjects and Methods] We recruited 20 healthy young adults and 20 elderly people, and administered 3 balance tests. The correlation coefficient and intraclass correlation of both instruments were analyzed. [Results] There were no statistically significant differences in the 3 tests between the Wii Fit balance board and the SBM. The Wii Fit balance board had a good intraclass correlation (0.86-0.99) for the elderly people and positive correlations (r = 0.58-0.86) with the SBM. [Conclusions] The Wii Fit balance board is a balance assessment tool with good reliability and high validity for elderly people, and we recommend it as an alternative tool for assessing balance ability.
Chemical modification of poly(vinyl alcohol): evaluation of hydrophilic/lipophilic balance
International Nuclear Information System (INIS)
Aranha, Isabele B.; Lucas, Elizabete F.
2001-01-01
Poly(vinyl alcohol) terpolymers have been obtained by reaction of partially hydrolized poly(vinyl alcohol) with different acid chlorides. The objective is the preparation of polymers with slight differences in their hydrophilic/lipophilic balance and in the interfacial activities of their solutions. The chemical modifications were characterized by means of 1 H NMR and the polymer properties were evaluated in terms of changes in solubility and surface tension. By chemical modification, polymers with low percentage of hydrophobic group were obtained. The water-soluble polymers obtained did not have the surface tension of their solutions altered. The solubility of the modified polymers decreased markedly, even with low contents of hydrophobic groups. (author)
Improving Balance Function Using Low Levels of Electrical Stimulation of the Balance Organs
Bloomberg, Jacob; Reschke, Millard; Mulavara, Ajitkumar; Wood, Scott; Serrador, Jorge; Fiedler, Matthew; Kofman, Igor; Peters, Brian T.; Cohen, Helen
2012-01-01
Crewmembers returning from long-duration space flight face significant challenges due to the microgravity-induced inappropriate adaptations in balance/ sensorimotor function. The Neuroscience Laboratory at JSC is developing a method based on stochastic resonance to enhance the brain s ability to detect signals from the balance organs of the inner ear and use them for rapid improvement in balance skill, especially when combined with balance training exercises. This method involves a stimulus delivery system that is wearable/portable providing imperceptible electrical stimulation to the balance organs of the human body. Stochastic resonance (SR) is a phenomenon whereby the response of a nonlinear system to a weak periodic input signal is optimized by the presence of a particular non-zero level of noise. This phenomenon of SR is based on the concept of maximizing the flow of information through a system by a non-zero level of noise. Application of imperceptible SR noise coupled with sensory input in humans has been shown to improve motor, cardiovascular, visual, hearing, and balance functions. SR increases contrast sensitivity and luminance detection; lowers the absolute threshold for tone detection in normal hearing individuals; improves homeostatic function in the human blood pressure regulatory system; improves noise-enhanced muscle spindle function; and improves detection of weak tactile stimuli using mechanical or electrical stimulation. SR noise has been shown to improve postural control when applied as mechanical noise to the soles of the feet, or when applied as electrical noise at the knee and to the back muscles.
Systematic tools for chemical equation balancing
International Nuclear Information System (INIS)
Filby, E.E.; Idaho National Engineering Lab., Idaho Falls, ID; Idaho Univ., Idaho Falls, ID
1989-01-01
One of the most important skills that chemists and chemical engineers must develop is the ability to balance chemical equations. The normal first method taught is ''balancing by inspection'', which is sometimes explained as simply ''mental algebra.'' Every textbook surveyed for this paper presents equation balancing first as a matter of trial and error; this includes four very recently published books. Very little further guidance is provided until oxidation-reduction reactions must be balanced. The most commonly taught approaches for balancing, redox equations have been the oxidation state change and ion-electron methods. Unfortunately, redox reactions are usually treated as a new topic, and what the student has teamed about ''ordinary'' equations is of little or no help. All too often, these contradictions simply confuse and frustrate students, and equation balancing is relegated to the status of a black art. This is ironic because such,confusion and frustration is not necessary: Chemical equations can, in fact, be balanced by explicitly definable mathematical methods. The purpose of this paper is to outline the algebraic methods involved
Occupational balance in health professionals in Sweden.
Wagman, Petra; Lindmark, Ulrika; Rolander, Bo; Wåhlin, Charlotte; Håkansson, Carita
2017-01-01
Health care employees are often women, a group that has high degrees of sick leave and perhaps problems attaining occupational balance. However, people think differently about their everyday activities and it is therefore important to take their perceptions into account but occupational balance has not yet been measured in health professionals. The aim was to describe occupational balance in three different samples of health professionals in Sweden. A further aim was to investigate whether occupational therapists (OTs) rate their occupational balance differently from other health professionals. Four hundred and eighty-two health professionals, employees in public dentistry, mental health care and OTs, aged 21-70 years participated. The participants' occupational balance was measured using the occupational balance questionnaire (OBQ). The ratings of occupational balance were similar to earlier studies and did not differ significantly between the samples. The OTs' occupational balance was also similar to that of the other health professionals. The similarities in occupational balance indicate the same difficulties in attaining it. The result highlights the possibility that working people face similar difficulties in achieving occupational balance. Further research is warranted about how to attain it.
Balance Systems and the Variational Bicomplex
Directory of Open Access Journals (Sweden)
Serge Preston
2011-07-01
Full Text Available In this work we show that the systems of balance equations (balance systems of continuum thermodynamics occupy a natural place in the variational bicomplex formalism. We apply the vertical homotopy decomposition to get a local splitting (in a convenient domain of a general balance system as the sum of a Lagrangian part and a complemental ''pure non-Lagrangian'' balance system. In the case when derivatives of the dynamical fields do not enter the constitutive relations of the balance system, the ''pure non-Lagrangian'' systems coincide with the systems introduced by S. Godunov [Soviet Math. Dokl. 2 (1961, 947-948] and, later, asserted as the canonical hyperbolic form of balance systems in [Müller I., Ruggeri T., Rational extended thermodynamics, 2nd ed., Springer Tracts in Natural Philosophy, Vol. 37, Springer-Verlag, New York, 1998].
Balance Disorders (For Parents)
... This nerve sends signals to the brain that control hearing (auditory function) and help with balance (vestibular function). But the ears aren't the ... symptoms aren't necessarily a sign of a balance problem — or any other ... stumble and fall sometimes, especially toddlers just learning to walk and ...
Singh, Varoon; Purohit, Ajay Kumar; Chinthakindi, Sridhar; Goud D, Raghavender; Tak, Vijay; Pardasani, Deepak; Shrivastava, Anchal Roy; Dubey, Devendra Kumar
2016-02-19
Magnetic hydrophilic-lipophilic balance (MHLB) hybrid resin was prepared by precipitation polymerization using N-vinylpyrrolidone (PVP) and divinylbenzene (DVB) as monomers and Fe2O3 nanoparticles as magnetic material. These resins were successfully applied for the extraction of chemical warfare agents (CWAs) and their markers from water samples through magnetic dispersive solid-phase extraction (MDSPE). By varying the ratios of monomers, resin with desired hydrophilic-lipophilic balance was prepared for the extraction of CWAs and related esters of varying polarities. Amongst different composites Fe2O3 nanoparticles coated with 10% PVP+90% DVB exhibited the best recoveries varying between 70.32 and 97.67%. Parameters affecting the extraction efficiencies, such as extraction time, desorption time, nature and volume of desorption solvent, amount of extraction sorbent and the effect of salts on extraction were investigated. Under the optimized conditions, linearity was obtained in the range of 0.5-500 ng mL(-1) with correlation ranging from 0.9911-0.9980. Limits of detection and limits of quantification were 0.5-1.0 and 3.0-5.0 ng mL(-1) respectively with RSDs varying from 4.88-11.32% for markers of CWAs. Finally, the developed MDSPE method was employed for extraction of analytes from water samples of various sources and the OPCW proficiency test samples. Copyright © 2016 Elsevier B.V. All rights reserved.
Brusco, Michael; Steinley, Douglas
2010-01-01
Structural balance theory (SBT) has maintained a venerable status in the psychological literature for more than 5 decades. One important problem pertaining to SBT is the approximation of structural or generalized balance via the partitioning of the vertices of a signed graph into "K" clusters. This "K"-balance partitioning problem also has more…
Recession and Work-Life Balance Initiatives
Pranav Naithani
2010-01-01
Over the last six decades work-life balance emerged as an important human resource management aspect for employers. Globally, a wide gamut of work-life balance facilities is being provided by a large number of organisations. The recent economic downturn has witnessed a sudden interruption in the spread and growth of work-life balance facilities at the organisational level. This paper presents the key recessionary reasons which have negatively influenced employee work-life balance. Further, im...
Involving children in meal preparation. Effects on food intake.
van der Horst, Klazine; Ferrage, Aurore; Rytz, Andreas
2014-08-01
The question of how to promote healthy eating habits in children is relevant because most children do not meet the recommended vegetable intake. Involving children in food preparation could be an opportunity to develop healthy eating behaviors and to increase vegetable consumption. The purpose of this study was to examine the effect of children's involvement in meal preparation on their food and vegetable intake. A between-subject experiment was conducted with 47 children aged 6 to 10 years. In condition 1 (n = 25), children prepared a lunch meal (pasta, breaded chicken, cauliflower, and salad) with the assistance of a parent. In condition 2 (n = 22), the meal was prepared by the parent alone. Independent samples t-tests were conducted to compare intake in the "child cooks" and "parent cooks" conditions. Children in the child cooks condition ate significantly more salad 41.7 g (76.1%), more chicken 21.8 g (27.0%), and more calories 84.6 kcal (24.4%) than children in the parent cooks condition. Between before cooking and directly after cooking the meal, children in the child cooks condition reported significantly increased feelings of valence (feeling positive) and dominance (feeling in control). This study confirms that involving children in meal preparation can increase vegetable intake. Because of the potential effect on energy intake, parents need to be made aware of appropriate portion sizes for their children. Taking this into account, encouraging parents to involve their children in the preparation of healthy and balanced meals could be a valuable intervention strategy to improve the diets and vegetable intake of children. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Liana GĂDĂU
2015-09-01
Full Text Available As the title suggests, through this paper we want to highlight the necessity of treating again the content and the form of the balance sheet in order to adapt it to a more efficient analysis, this way surpassing the informational valences of the classic balance sheet. The functional and the financial balance sheet will be taken into account. These models of balance sheet permit the complex analyses regarding the solvability or the bankruptcy risk of an enterprise to take place, and also other analyses, like the analysis of the structure and the financial/ functional equilibrium, the analysis of the company on operating cycles and their role in the functioning of the company. Through the particularities offered by each of these two models of balance sheet, we want to present the advantages of a superior informing. This content of this material is based on a vast investigation of the specialized literature.
DEFF Research Database (Denmark)
Strøm, Mark; Thorborg, Kristian; Bandholm, Thomas
2016-01-01
BACKGROUND: A lateral ankle sprain is the most prevalent musculoskeletal injury in sports. Exercises that aim to improve balance are a standard part of the ankle rehabilitation process. In an optimal progression model for ankle rehabilitation and prevention of future ankle sprains, it is important...... to characterize different balance exercises based on level of difficulty and sensori-motor training stimulus. PURPOSE: The purpose of this study was to investigate frontal-plane ankle kinematics and associated peroneal muscle activity during single-legged balance on stable surface (floor) and three commonly used...... balance devices (Airex®, BOSU® Ball and wobble board). DESIGN: Descriptive exploratory laboratory study. METHODS: Nineteen healthy subjects performed single-legged balance with eyes open on an Airex® mat, BOSU® Ball, wobble board, and floor (reference condition). Ankle kinematics were measured using...
Monte Carlo methods beyond detailed balance
Schram, Raoul D.; Barkema, Gerard T.|info:eu-repo/dai/nl/101275080
2015-01-01
Monte Carlo algorithms are nearly always based on the concept of detailed balance and ergodicity. In this paper we focus on algorithms that do not satisfy detailed balance. We introduce a general method for designing non-detailed balance algorithms, starting from a conventional algorithm satisfying
Ozaki, Kenichi; Kondo, Izumi; Hirano, Satoshi; Kagaya, Hitoshi; Saitoh, Eiichi; Osawa, Aiko; Fujinori, Yoichi
2017-11-01
To examine the efficacy of postural strategy training using a balance exercise assist robot (BEAR) as compared with conventional balance training for frail older adults. The present study was designed as a cross-over trial without a washout term. A total of 27 community-dwelling frail or prefrail elderly residents (7 men, 20 women; age range 65-85 years) were selected from a volunteer sample. Two exercises were prepared for interventions: robotic exercise moving the center of gravity by the balance exercise assist robot system; and conventional balance training combining muscle-strengthening exercise, postural strategy training and applied motion exercise. Each exercise was carried out twice a week for 6 weeks. Participants were allocated randomly to either the robotic exercise first group or the conventional balance exercise first group. preferred and maximal gait speeds, tandem gait speeds, timed up-and-go test, functional reach test, functional base of support, center of pressure, and muscle strength of the lower extremities were assessed before and after completion of each exercise program. Robotic exercise achieved significant improvements for tandem gait speed (P = 0.012), functional reach test (P = 0.002), timed up-and-go test (P = 0.023) and muscle strength of the lower extremities (P = 0.001-0.030) compared with conventional exercise. In frail or prefrail older adults, robotic exercise was more effective for improving dynamic balance and lower extremity muscle strength than conventional exercise. These findings suggest that postural strategy training with the balance exercise assist robot is effective to improve the gait instability and muscle weakness often seen in frail older adults. Geriatr Gerontol Int 2017; 17: 1982-1990. © 2017 The Authors. Geriatrics & Gerontology International published by John Wiley & Sons Australia, Ltd on behalf of Japan Geriatrics Society.
Barrera-Garrido, Azael
2017-01-01
In order to measure the mass of an object in the absence of gravity, one useful tool for many decades has been the inertial balance. One of the simplest forms of inertial balance is made by two mass holders or pans joined together with two stiff metal plates, which act as springs.
Balancing for nonlinear systems
Scherpen, J.M.A.
1993-01-01
We present a method of balancing for nonlinear systems which is an extension of balancing for linear systems in the sense that it is based on the input and output energy of a system. It is a local result, but gives 'broader' results than we obtain by just linearizing the system. Furthermore, the
Muela, E; Sañudo, C; Campo, M M; Medel, I; Beltrán, J A
2010-04-01
This study evaluated the effect of freezing method (FM) (air blast freezer, freezing tunnel, or nitrogen chamber) and frozen storage duration (FSD) (1, 3, or 6 months) on the instrumental measurements of quality of thawed lamb, aged for a total of 72 h, throughout a 10-d display period, compared to the quality of fresh meat. pH, colour, lipid oxidation, thawing, and cooking losses in Longissimus thoracis and lumborum muscle, were determined following standard methods. FM affected yellowness, FSD redness and thawing losses, and both affected oxidation (increased as freezing rate decreased and/or as storage duration increased). When compared with fresh meat, the main differences appeared on oxidation (where a significant interaction between treatment (3FM x 3FSD + fresh meat) with display duration was detected), and on total losses (thaw + cook losses). Oxidation was lower in fresh meat, but values were not significantly different from those stored frozen for 1 month. Fresh meat had smaller total losses than did thawed meat, but losses were not significantly different from meat frozen in the freezing tunnel and stored frozen for 1 month. Display duration had a greater effect on instrumental quality parameters than did FM or FSD. pH, b*, and oxidation increased, and L* and a* decreased with an increase in the number of days on display. In conclusion, neither freezing method nor frozen storage up to 6 months influenced extensively the properties of lamb when instrumental measurements of quality were measured in meat that had been displayed for 1d after thawing. The small deterioration shown in this study should not give consumers concerns about frozen meat. 2009 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Wang Xiaoting; Schirmer, Sophie G.; Bayat, Abolfazl; Bose, Sougato
2010-01-01
We discuss how to prepare an Ising chain in a GHZ state using a single global control field only. This model does not require the spins to be individually addressable and is applicable to quantum systems such as cold atoms in optical lattices, some liquid- or solid-state NMR experiments, and many nanoscale quantum structures. We show that GHZ states can always be reached asymptotically from certain easy-to-prepare initial states using adiabatic passage, and under certain conditions finite-time reachability can be ensured. To provide a reference useful for future experimental implementations, three different control strategies to achieve the objective--adiabatic passage, Lyapunov control, and optimal control--are compared, and their advantages and disadvantages discussed, in particular in the presence of realistic imperfections such as imperfect initial state preparation, system inhomogeneity, and dephasing.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Mass balance. 23.659 Section 23.659 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS... Surfaces § 23.659 Mass balance. The supporting structure and the attachment of concentrated mass balance...
Formal balancing of chemical reaction networks
van der Schaft, Abraham; Rao, S.; Jayawardhana, B.
2016-01-01
In this paper we recall and extend the main results of Van der Schaft, Rao, Jayawardhana (2015) concerning the use of Kirchhoff’s Matrix Tree theorem in the explicit characterization of complex-balanced reaction networks and the notion of formal balancing. The notion of formal balancing corresponds
Experimental modelling of fragmentation applied to volcanic explosions
Haug, Øystein Thordén; Galland, Olivier; Gisler, Galen R.
2013-12-01
Explosions during volcanic eruptions cause fragmentation of magma and host rock, resulting in fragments with sizes ranging from boulders to fine ash. The products can be described by fragment size distributions (FSD), which commonly follow power laws with exponent D. The processes that lead to power-law distributions and the physical parameters that control D remain unknown. We developed a quantitative experimental procedure to study the physics of the fragmentation process through time. The apparatus consists of a Hele-Shaw cell containing a layer of cohesive silica flour that is fragmented by a rapid injection of pressurized air. The evolving fragmentation of the flour is monitored with a high-speed camera, and the images are analysed to obtain the evolution of the number of fragments (N), their average size (A), and the FSD. Using the results from our image-analysis procedure, we find transient empirical laws for N, A and the exponent D of the power-law FSD as functions of the initial air pressure. We show that our experimental procedure is a promising tool for unravelling the complex physics of fragmentation during phreatomagmatic and phreatic eruptions.
Sandia National Laboratories: Careers: Work-Life Balance
; Culture Work-Life Balance Special Programs Students and Postdocs Benefits and Perks Hiring Process Life at -Life Balance Careers Work-Life Balance People in park Your life is not just work We understand your healthy, multidimensional lifestyle and achieve a personal balance between home, work, and community life
Farhat, S L; Hochard, C; Orens, S; Gautier, C; Lambert, T; Geret, L; Bralet, M C
2016-10-01
Schizophrenia causes psychological difficulties (with positive and/or negative symptoms) as well as cognitive disabilities (attention, memory, executive functions and social cognition). Moreover, 40 to 60% of patients suffer from an excess of weight or obesity (due to bad eating habits, eating disorders or medication). All these difficulties impair their autonomy and their insertion into the society. In this context, setting-up a therapeutic tool, which may have cognitive benefits seems relevant. Thus, MODen is a therapeutic educational tool whose aim is to improve cognitive functions and the symptoms by using "nutritional balance" as an aid. In this treatment program, two therapists lead a group of 5 to 8 patients which group meets once a week during two to four hours for 16 weeks, divided in 4 cycles. The first three weeks of each cycle consists of theoretical instruction: patients talk about their eating habits, information is given about nutritional balance and preparation of meals. In the different cycles, flexibility, planning, memory and attention are trained. For instance, the work on categorisation of foods and nutritional balance allow enhancing flexibility abilities. Writing down the lists of different ingredients needed for one week's meals and preparation of meals train planning abilities. MODen also takes into account ecological issues such as the limited budget of patients to do their shopping (this budget is around 4 euros per meal in France). The budget is also linked to planning abilities and reasoning. Finally, during the last session of each cycle the group prepares a meal (from the shopping to cooking). This last session is all about sharing and social cognition abilities. By the end of the program, patients will have prepared four meals together. Also "homework" has to be done each week in order to facilitate memorisation of what has been learned during the last session and to prepare the beginning of the next session. In a pilot study with 8
Australian Government Balance Sheet Management
Wilson Au-Yeung; Jason McDonald; Amanda Sayegh
2006-01-01
Since almost eliminating net debt, the Australian Government%u2019s attention has turned to the financing of broader balance sheet liabilities, such as public sector superannuation. Australia will be developing a significant financial asset portfolio in the %u2018Future Fund%u2019 to smooth the financing of expenses through time. This raises the significant policy question of how best to manage the government balance sheet to reduce risk. This paper provides a framework for optimal balance sh...
Directory of Open Access Journals (Sweden)
Wen-Chieh Yang
2016-09-01
Conclusion: This study did not find any difference between the effects of the home-based virtual reality balance training and conventional home balance training. The two training options were equally effective in improving balance, walking, and quality of life among community-dwelling patients with PD.
Brazilian energy balance 2008 - year 2007
International Nuclear Information System (INIS)
2008-01-01
The Brazilian energy balance - BEB - is divided into eight chapters and eleven annexes, whose contents are as follow: chapter 1 - energy analysis and aggregated data; chapter 2 - energy supply and demand by source; chapter 3 - energy consumption by sector; chapter 4 - energy imports and exports; chapter 5 - balance of transformation centers; chapter 6 - energy resources and reserves; chapter 7 - energy and socioeconomics; chapter 8 - state energy data; annex I - installed capacity; annex II - self-generation of electricity; annex III - world energy data; annex IV - world energy evolution; annex V - useful energy balance; annex VI - general structure of the BEN; annex VII - treatment of information; annex VIII - units; annex IX - conversion factors; annex X - consolidated energy balances 1970/2007; annex XI - energy balance 2007. (author)
Yasim; Naidu, J M; Mascie-Taylor, C G
1997-04-01
Data on patterns of marriage, differential fertility and mortality were collected from 211 Kotia women residing in Visakhapatnam district of Andhra Pradesh, India. Consanguineous marriages made up just over a quarter of the total, and of these, father's sister's daughter (FSD) were more common than mother's brother's daughter (MBD). The mean inbreeding coefficient for the sample (F) was 0.0172. Women in consanguineous marriages had a lower mean number of total conceptions, live births and living offspring (net fertility) than women in non-consanguineous marriages. Significant heterogeneity was found in the means of living offspring for FSD, MBD and non-consanguineous couples, but not for conceptions and live births.
Energy Technology Data Exchange (ETDEWEB)
Reza-E-Rabby, Md.; Ross, Kenneth; Overman, Nicole R.; Olszta, Matthew J.; McDonnell, Martin; Whalen, Scott A.
2018-04-01
A new solid-phase technique called friction stir dovetailing (FSD) has been developed for joining thick section aluminum to steel. In FSD, mechanical interlocks are formed at the aluminum-steel interface and are reinforced by metallurgical bonds where intermetallic growth has been uniquely suppressed. Lap shear testing shows superior strength and extension at failure compared to popular friction stir approaches where metallurgical bonding is the only joining mechanism. High resolution microscopy revealed the presence of a 40-70 nm interlayer having a composition of 76.4 at% Al, 18.4 at% Fe, and 5.2 at% Si, suggestive of limited FeAl3 intermetallic formation.
40 CFR 1065.290 - PM gravimetric balance.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false PM gravimetric balance. 1065.290... balance. (a) Application. Use a balance to weigh net PM on a sample medium for laboratory testing. (b) Component requirements. We recommend that you use a balance that meets the specifications in Table 1 of...
Balance across contexts: importance of balanced need satisfaction across various life domains.
Milyavskaya, Marina; Gingras, Isabelle; Mageau, Geneviève A; Koestner, Richard; Gagnon, Hugo; Fang, Jianqun; Boiché, Julie
2009-08-01
Self-determination theory posits that satisfaction of three basic psychological needs-autonomy, competence, and relatedness-are required for psychological well-being, and a recent study showed that the balance in the satisfaction of these three needs independently affects well-being. The present investigation builds on these findings by examining the balance of adolescents' need satisfaction across distinct life contexts. The results of three studies show that adolescents who experience a balance of need satisfaction across important life contexts, including at school, at home, with friends, and in part-time jobs, reported higher well-being and better school adjustment. This finding emerged consistently across four countries and across multiple measures of school adjustment, including teacher reports. Together, these results support previous research that highlights the importance of consistency for psychological functioning.
International Nuclear Information System (INIS)
Jorritsma, P.; Derriks, H.; Francke, J.; Gordijn, H.; Groot, W.; Harms, L.; Van der Loop, H.; Peer, S.; Savelberg, F.; Wouters, P.
2009-06-01
The Mobility Balance Sheet provides an overview of the state of the art of mobility in the Netherlands. In addition to describing the development of mobility this report also provides explanations for the growth of passenger and freight transport. Moreover, the Mobility Balance Sheet also focuses on a topical theme: the effects of economic crises on mobility. [nl
DEFF Research Database (Denmark)
Li, Peter Ping
The potential contribution of the Eastern frame of Yin-Yang Balancing lies in the mindset of "either/and", in contrast to Aristotle's either/or logic and Hegel's "both/or". Implications of this either/and thinking for science and management will be explored.......The potential contribution of the Eastern frame of Yin-Yang Balancing lies in the mindset of "either/and", in contrast to Aristotle's either/or logic and Hegel's "both/or". Implications of this either/and thinking for science and management will be explored....
Energy Technology Data Exchange (ETDEWEB)
Guetermann, A.
2002-04-15
This final report for the Swiss Federal Office of Energy (SFOE) deals with an apartment building in Winterthur, Switzerland, built to passive-house standards and equipped with a solar balanced ventilation system. The building and its convective solar facade are described, as are the fan-assisted, balanced ventilation systems used. The operation of the systems in winter, during transitional periods and in summer is discussed. Domestic hot water preparation is looked at. The energy balance of the building is examined, as is the economic viability of the energy systems. The building, its energy installations and the measurement concept used are considered in detail. Finally, the findings of the study are summarised and commented on.
Siriphorn, Akkradate; Chamonchant, Dannaovarat
2015-01-01
[Purpose] The potential health benefits of the Nintendo Wii balance board exercise have been widely investigated. However, no study has been conducted to examine the benefits of Wii exercise for overweight young adults. The aim of this study was to investigate the effect of exercise performed on a Nintendo Wii balance board on the balance and lower limb muscle strength in overweight young adults. [Subjects and Methods] Within-subject repeated measures analysis was used. Sixteen young adults (...
Identifying Balance in a Balanced Scorecard System
Aravamudhan, Suhanya; Kamalanabhan, T. J.
2007-01-01
In recent years, strategic management concepts seem to be gaining greater attention from the academicians and the practitioner's alike. Balanced Scorecard (BSC) concept is one such management concepts that has spread in worldwide business and consulting communities. The BSC translates mission and vision statements into a comprehensive set of…
Energy balance in the transformation centers
International Nuclear Information System (INIS)
Alvim, Carlos Feu; Ferreira, Omar Campos; Eidelman, Frida.
2005-01-01
Carbon balance is an important instrument to identify the emission sources of greenhouse effect gases. Since energy use and transformation are fundamental for increasing these gases in the atmosphere, the carbon balance survey can be used to identify sectors and fuels to which priority should be given regarding emissions mitigation. In the case of transformation centers (installations where primary or secondary sources are converted into sub-products or other energy form) the balance indicated some problems regarding the Brazilian inventory calculation. Problems concerning the National Energy Balance data used here were also identified. (author)
Balance perturbation system to improve balance compensatory responses during walking in old persons
Directory of Open Access Journals (Sweden)
Melzer Itshak
2010-07-01
Full Text Available Abstract Ageing commonly disrupts the balance control and compensatory postural responses that contribute to maintaining balance and preventing falls during perturbation of posture. This can lead to increased risk of falling in old adults (65 years old and over. Therefore, improving compensatory postural responses during walking is one of the goals in fall prevention programs. Training is often used to achieve this goal. Most fall prevention programs are usually directed towards improving voluntary postural control. Since compensatory postural responses triggered by a slip or a trip are not under direct volitional control these exercises are less expected to improve compensatory postural responses due to lack of training specificity. Thus, there is a need to investigate the use balance perturbations during walking to train more effectively compensatory postural reactions during walking. This paper describes the Balance Measure & Perturbation System (BaMPer System a system that provides small, controlled and unpredictable perturbations during treadmill walking providing valuable perturbation, which allows training compensatory postural responses during walking which thus hypothesize to improve compensatory postural responses in older adults.
Recycled Uranium Mass Balance Project Y-12 National Security Complex Site Report
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-12-01
This report has been prepared to summarize the findings of the Y-12 National Security Complex (Y-12 Complex) Mass Balance Project and to support preparation of associated U. S. Department of Energy (DOE) site reports. The project was conducted in support of DOE efforts to assess the potential for health and environmental issues resulting from the presence of transuranic (TRU) elements and fission products in recycled uranium (RU) processed by DOE and its predecessor agencies. The United States government used uranium in fission reactors to produce plutonium and tritium for nuclear weapons production. Because uranium was considered scarce relative to demand when these operations began almost 50 years ago, the spent fuel from U.S. fission reactors was processed to recover uranium for recycling. The estimated mass balance for highly enriched RU, which is of most concern for worker exposure and is the primary focus of this project, is summarized in a table. A discrepancy in the mass balance between receipts and shipments (plus inventory and waste) reflects an inability to precisely distinguish between RU and non-RU shipments and receipts involving the Y-12 Complex and Savannah River. Shipments of fresh fuel (non-RU) and sweetener (also non-RU) were made from the Y-12 Complex to Savannah River along with RU shipments. The only way to distinguish between these RU and non-RU streams using available records is by enrichment level. Shipments of {le}90% enrichment were assumed to be RU. Shipments of >90% enrichment were assumed to be non-RU fresh fuel or sweetener. This methodology using enrichment level to distinguish between RU and non-RU results in good estimates of RU flows that are reasonably consistent with Savannah River estimates. Although this is the best available means of distinguishing RU streams, this method does leave a difference of approximately 17.3 MTU between receipts and shipments. Slightly depleted RU streams received by the Y-12 Complex from ORGDP and
Lifescience Database Archive (English)
Full Text Available LEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGXP Frame B: ---xxxxxxxvxxxxxxxxxx...vxxxxmvglxxixiskxnxlsxwxxd*evvxkxlskh*x vrpsllklrxqiilxmlxqrfkxkkvshqtnkd*fslvnn*kmvv...ittfkrnplsi*fsd*evvckfl*klslvkplhsklkvvttlrm*kqkfktkkvx Frame C: ---xxxxxxrfxxxxxxxixx*xixxwxxxxxxqypkxixxpx
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Mass balance. 27.659 Section 27.659... STANDARDS: NORMAL CATEGORY ROTORCRAFT Design and Construction Rotors § 27.659 Mass balance. (a) The rotors... flutter at any speed up to the maximum forward speed. (b) The structural integrity of the mass balance...
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Mass balance. 29.659 Section 29.659... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Rotors § 29.659 Mass balance. (a) The rotor... flutter at any speed up to the maximum forward speed. (b) The structural integrity of the mass balance...
Balanced Flow Meters without Moving Parts
Kelley, Anthony R.; VanBuskirk, Paul
2008-01-01
Balanced flow meters are recent additions to an established class of simple, rugged flow meters that contain no moving parts in contact with flow and are based on measurement of pressure drops across objects placed in flow paths. These flow meters are highly accurate, minimally intrusive, easily manufacturable, and reliable. A balanced flow meter can be easily mounted in a flow path by bolting it between conventional pipe flanges. A balanced flow meter can be used to measure the flow of any of a variety of liquids or gases, provided that it has been properly calibrated. Relative to the standard orifice-plate flow meter, the balanced flow meter introduces less turbulence and two times less permanent pressure loss and is therefore capable of offering 10 times greater accuracy and repeatability with less dissipation of energy. A secondary benefit of the reduction of turbulence is the reduction of vibration and up to 15 times less acoustic noise generation. Both the balanced flow meter and the standard orifice-plate flow meter are basically disks that contain holes and are instrumented with pressure transducers on their upstream and downstream faces. The most obvious difference between them is that the standard orifice plate contains a single, central hole while the balanced flow meter contains multiple holes. The term 'balanced' signifies that in designing the meter, the sizes and locations of the holes are determined in an optimization procedure that involves balancing of numerous factors, including volumetric flow, mass flow, dynamic pressure, kinetic energy, all in an effort to minimize such undesired effects as turbulence, pressure loss, dissipation of kinetic energy, and non-repeatability and nonlinearity of response over the anticipated range of flow conditions. Due to proper balancing of these factors, recent testing demonstrated that the balanced flow-meter performance was similar to a Venturi tube in both accuracy and pressure recovery, but featured reduced
Sensorimotor control of balance: a Tai Chi solution for balance disorders in older subjects.
Tsang, William W N; Hui-Chan, Christina W Y
2008-01-01
In addition to environmental factors, deteriorating sensorimotor control of balance will predispose older adults to falls. Understanding the aging effects on sensorimotor control of balance performance is important for designing fall prevention programs for older adults. How repeated practice of Tai Chi can improve limb joint proprioception, integration of neural signals in the central nervous system for balance control, and motor output at the level of knee muscles is discussed in this chapter. Our previous studies showed that elderly Tai Chi practitioners performed significantly better than elderly nonpractitioners in (1) knee joint proprioception, (2) reduced or conflicting sensory situations that demand more visual or vestibular contributions, (3) standing balance control after vestibular stimulation without visual input, (4) voluntary weight shifting in different directions within the base of support, (5) single-leg stance during perturbations of the support surface, and (6) knee extensor and flexor muscle strength. In a prospective study, we further showed that 4 weeks of daily Tai Chi practice but not general education produced significant improvement in balance performance. The requirements of Tai Chi for accurate joint positioning and weight transfer involving smooth coordination of neck, trunk, upper and lower limb movements, make it particularly useful for improving the sensorimotor control of balance in the elderly. Because Tai Chi can be practiced any time and anywhere, and is well accepted by older people in both the East and now the West, it is especially suited to be a key component of a low-costing community-based fall prevention program alongside with education about environmental factors.
Energy Technology Data Exchange (ETDEWEB)
Dyer, J. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-11-30
In preparation for the next revision of the E-Area Low-Level Waste Facility (LLWF) Performance Assessment (PA), a mass balance model was developed in Microsoft Excel to confirm correct implementation of intact- and subsided-area infiltration profiles for the proposed closure cap in the PORFLOW vadose-zone model. The infiltration profiles are based on the results of Hydrologic Evaluation of Landfill Performance (HELP) model simulations for both intact and subsided cases.
Balance velocities of the Greenland ice sheet
DEFF Research Database (Denmark)
Joughin, I.; Fahnestock, M.; Ekholm, Simon
1997-01-01
We present a map of balance velocities for the Greenland ice sheet. The resolution of the underlying DEM, which was derived primarily from radar altimetery data, yields far greater detail than earlier balance velocity estimates for Greenland. The velocity contours reveal in striking detail......, the balance map is useful for ice-sheet modelling, mass balance studies, and field planning....
Strategies for achieving healthy energy balance among African Americans in the Mississippi Delta.
Parham, Groesbeck P; Scarinci, Isabel C
2007-10-01
Low-income African Americans who live in rural areas of the Deep South are particularly vulnerable to diseases associated with unhealthy energy imbalance. The Centers for Disease Control and Prevention (CDC) has suggested various physical activity strategies to achieve healthy energy balance. Our objective was to conduct formal, open-ended discussions with low-income African Americans in the Mississippi Delta to determine 1) their dietary habits and physical activity levels, 2) their attitudes toward CDC's suggested physical activity strategies, and 3) their suggestions on how to achieve CDC's strategies within their own environment. A qualitative method (focus groups) was used to conduct the study during 2005. Prestudy meetings were held with African American lay health workers to formulate a focus group topic guide, establish inclusion criteria for focus group participants, select meeting sites and times, and determine group segmentation guidelines. Focus groups were divided into two phases. All discussions and focus group meetings were held in community centers within African American neighborhoods in the Mississippi Delta and were led by trained African American moderators. Phase I focus groups identified the following themes: overeating, low self-esteem, low income, lack of physical exercise, unhealthy methods of food preparation, a poor working definition of healthy energy balance, and superficial knowledge of strategies for achieving healthy energy balance. Phase 2 focus groups identified a preference for social support-based strategies for increasing physical activity levels. Energy balance strategies targeting low-income, rural African Americans in the Deep South may be more effective if they emphasize social interaction at the community and family levels and incorporate the concept of community volunteerism.
Pitfalls in Using the Balanced Scorecard
DEFF Research Database (Denmark)
Nørreklit, Hanne; Jakobsen, Morten; Mitchell, Falconer
2008-01-01
The balanced scorecard has quickly become a leading management tool. But business performance measurement is notoriously difficult, so any system, including the balanced scorecard, is likely to have unanticipated and often dysfunctional consequences. This article briefly reviews the main...... attractions of the balanced scorecard and then shows how these apparent advantages might lead to problems....
The balance-of-payments constraint:from balanced trade to sustainable debt
Directory of Open Access Journals (Sweden)
Nelson H. Barbosa-Filho
2001-12-01
Full Text Available This paper extends the balance-of-payments constraint on growth known as Thirlwall's law to incorporate unbalanced trade and debt accumulation. Assuming that small open economies face a liquidity constraint, the text shows the growth and real-exchange-rate policy rules consistent with a stable ratio of net exports to income. Given such rules, the text shows how the trade balance of a small open economy is residually determined by the ratio of foreign debt to income allowed by international conditions.
Dynamic power balance analysis in JET
International Nuclear Information System (INIS)
Matthews, G F; Silburn, S A; Challis, C D; Iglesias, D; King, D; Eich, T; Sieglin, B; Contributors, JET
2017-01-01
The full scale realisation of nuclear fusion as an energy source requires a detailed understanding of power and energy balance in current experimental devices. In this we explore whether a global power balance model in which some of the calibration factors applied to the source or sink terms are fitted to the data can provide insight into possible causes of any discrepancies in power and energy balance seen in the JET tokamak. We show that the dynamics in the power balance can only be properly reproduced by including the changes in the thermal stored energy which therefore provides an additional opportunity to cross calibrate other terms in the power balance equation. Although the results are inconclusive with respect to the original goal of identifying the source of the discrepancies in the energy balance, we do find that with optimised parameters an extremely good prediction of the total power measured at the outer divertor target can be obtained over a wide range of pulses with time resolution up to ∼25 ms. (paper)
Birman, Joseph L.; Kuklov, A. B.
2001-05-01
The concept of the orthogonality catastrophe (OC), which has been introduced previously for one component condensate ( A.B. Kuklov, J.L. Birman, PRA 63), 013609 (2001), is applied to the two-component condensate. The evolution of the global relative phase, which is created by the rf-pulse, is studied under the condition of no exchange of bosons between the components after the pulse. It is shown that the normal component does not induce the OC. Instead, it produces a reversible thermal dephasing, which competes with the quantum phase diffusion (QPD) effect (E.M.Wright, et al, PRL 77), 2158(1996). The thermal dephasing results from the thermal ensemble averaging, and the corresponding dephasing rate is controlled by the two-body interaction and temperature as well as by the closeness to the intrinsic su(2) symmetry, so that no dephasing exists in the case of the exact symmetry (A.B. Kuklov, J.L. Birman, PRL 85), 5488 (2000). The reversible nature of the thermal dephasing as well as of the QPD can be revealed in the atomic echo effect. The role of external noise in erasing the phase memory is discussed as well.
Directory of Open Access Journals (Sweden)
Demur Chomakhidze
2016-09-01
It is shown that, traditionally, the energy balance of Georgia is in deep deficit. The suggestions for its improvement are provided in the Article. The country imports almost all amount of oil and natural gas. Electricity balance is relatively stable. In the recent years, some amount of electricity is exported to the neighboring countries. Generally, the country satisfies only 30–35% of own energy consumption by local generation, and the rest amount of resources are imported from abroad. The reason of deficit to some extent is irrational and wasteful consumption of energy resources. The article examines the organizational difficulties in drawing up energy balance of Georgia and statistical problems of recording of energy production and consumption at the initial stage of market economy.
NETPATH-WIN: an interactive user version of the mass-balance model, NETPATH
El-Kadi, A. I.; Plummer, Niel; Aggarwal, P.
2011-01-01
NETPATH-WIN is an interactive user version of NETPATH, an inverse geochemical modeling code used to find mass-balance reaction models that are consistent with the observed chemical and isotopic composition of waters from aquatic systems. NETPATH-WIN was constructed to migrate NETPATH applications into the Microsoft WINDOWS® environment. The new version facilitates model utilization by eliminating difficulties in data preparation and results analysis of the DOS version of NETPATH, while preserving all of the capabilities of the original version. Through example applications, the note describes some of the features of NETPATH-WIN as applied to adjustment of radiocarbon data for geochemical reactions in groundwater systems.
A 'Balanced' Life: Work-Life Balance and Sickness Absence in Four Nordic Countries.
Antai, D; Oke, A; Braithwaite, P; Anthony, D S
2015-10-01
Little attention has been given to the relationship between work-life balance and sickness absence. To investigate the association between poor work-life balance and sickness absence in 4 Nordic welfare states. Multivariable logistic regression analysis was performed on pooled cross-sectional data of workers aged 15-65 years from Denmark, Finland, Sweden, and Norway (n=4186) obtained from the 2010 European Working Conditions Survey (EWCS). Poor work-life balance was defined based on the fit between working hours and family or social commitments outside work. Self-reported sickness absence was measured as absence for ≥7 days from work for health reasons. Poor work-life balance was associated with elevated odds (OR 1.38, 95% CI 1.06 to 1.80) of self-reported sickness absence and more health problems in the 4 Nordic countries, even after adjusting for several important confounding factors. Work-related characteristics, ie, no determination over schedule (OR 1.26, 95% CI 1.04 to 1.53), and job insecurity (OR 1.56, 95% CI 1.21 to 2.02) increased the likelihood of sickness absence, and household characteristics, ie, cohabitation status (OR 0.75, 95% CI 0.58 to 0.96) reduced this likelihood. The associations were non-significant when performed separately for women and men. Sickness absence is predicted by poor work-life balance. Findings suggest the need for implementation of measures that prevent employee difficulties in combining work and family life.
Jeon, Yong-Jin; Kim, Gyoung-Mo
2017-01-01
[Purpose] The purpose of this study was to investigate and compare the predictive properties of Berg Balance Scale and Fullerton Advanced Balance Scales, in a group of independently-functioning community dwelling older adults. [Subjects and Methods] Ninety-seven community-dwelling older adults (male=39, female=58) who were capable of walking independently on assessment were included in this study. A binary logistic regression analysis of the Berg Balance Scale and Fullerton Advanced Balance S...
La Porta, Fabio; Franceschini, Marco; Caselli, Serena; Cavallini, Paola; Susassi, Sonia; Tennant, Alan
2011-04-01
To build a new activity-based, "bed to community", aetiology-independent measure of balance within the neurological rehabilitation setting by merging some existing scales. Balance scales were selected using a conceptual framework and subsequently administered to a convenience sample of adult patients with balance problems due to different neurological aetiologies. Data were then processed using classical psychometric analyses and Rasch analysis in order to construct a new balance measurement tool. The Berg Balance Scale, the Tinetti Scales and the Fullerton Advanced Balance Scale were selected and administered to a sample of patients, giving 302 observations. Classical psychometric analyses (item and scale analysis; confirmatory factor analysis) were undertaken on the pooled 40-item set with confirmation of unidimensionality. The subsequent Rasch analysis allowed the identification of a 27-item set satisfying the Rasch Model's requirements for fundamental measurement, with further confirmation of unidimensionality by post-hoc confirmatory factor analysis. The new scale (Unified Balance Scale) holds proven measurement properties and may be a candidate tool for "bed to community" balance measurement for patients with balance problems within the neuro-rehabilitation setting. Future studies are warranted to explore further its external validity and other clinical properties, as well as to improve its usability.
Balanced Hermitian metrics from SU(2)-structures
International Nuclear Information System (INIS)
Fernandez, M.; Tomassini, A.; Ugarte, L.; Villacampa, R.
2009-01-01
We study the intrinsic geometrical structure of hypersurfaces in six-manifolds carrying a balanced Hermitian SU(3)-structure, which we call balanced SU(2)-structure. We provide sufficient conditions, in terms of suitable evolution equations, which imply that a five-manifold with such structure can be isometrically embedded as a hypersurface in a balanced Hermitian SU(3)-manifold. Any five-dimensional compact nilmanifold has an invariant balanced SU(2)-structure, and we show how some of them can be evolved to give new explicit examples of balanced Hermitian SU(3)-structures. Moreover, for n=3,4, we present examples of compact solvmanifolds endowed with a balanced SU(n)-structure such that the corresponding Bismut connection has holonomy equal to SU(n)
[Striking the work-life balance].
Dumas, Marc
2014-11-01
Solutions for finding a satisfactory balance between home life and work lie in the organisation of work and the work environment. Line managers in particular have a key role to play in helping their staff maintain this balance.
Shen, Xia; Mak, Margaret K Y
2014-07-01
Background Fear of falling has been identified as an important and independent fall-risk predictor in patients with Parkinson's disease (PD). However, there are inconsistent findings on the effects of balance and gait training on balance confidence. Objective To explore whether balance and gait training with augmented feedback can enhance balance confidence in PD patients immediately after treatment and at 3- and 12-month follow-ups. Methods A total of 51 PD patients were randomly assigned to a balance and gait training (BAL) group or to an active control (CON) group. The BAL group received balance and gait training with augmented feedback, whereas CON participants received lower-limb strength training for 12 weeks. Outcome measures included Activities-Specific Balance Confidence (ABC) Scale, limits-of-stability test, single-leg-stance test, and spatiotemporal gait characteristics. All tests were administered before intervention (Pre), immediately after training (Post), and at 3 months (Post3m) and 12 months (Post12m) after treatment completion. Results The ABC score improved marginally at Post and significantly at Post3m and Post12m only in the BAL group (P point excursion at Post, but only the BAL group maintained the improvement at Post3m. The BAL group maintained significantly longer time-to-loss-of-balance during the single-leg stance test than the CON group at Post3m and Post12m (P balance confidence and balance and gait performance in patients with PD. © The Author(s) 2014.
Directory of Open Access Journals (Sweden)
Juliana Secchi Batista
Full Text Available Introduction The aging process causes structural and functional changes in the organism. Among these changes, the systems responsible for controlling the balance are also affected, especially in women. This study aims to perform an assessment and physiotherapy intervention in elderly with balance deficits through Berg scale and platform Wii Balance Board. Materials and methods The study was longitudinal quasi-experimental intervention. Held in the city of Passo Fundo, RS - Brazil. Participants were 38 elderly women who had a deficit balance. The instruments used to collect data was a questionnaire to identify, assess balance across the Berg Balance Scale and an intervention program with six games via the Wii Balance Board™ platform. To statistically analyze the effects before and after the intervention were used Wilcoxon and Pearson correlation, with a significance level of p = 0.05. Results In the present study, we observed a statistically significant improvement in the balance of elderly compared before and after intervention, moreover, the six games played also showed statistical significance when comparing the first and twentieth session, highlighting the games Tightrope Walk Table Tilt, Deep Breathing and Soccer Heading. Conclusion The evaluation and balance training with the platform Wii Balance Board were able to provide significant results for the elderly, besides, the game has the potential to treat the health, well-being and functional capacity of older people through the visual representation the game in real time.
Lifescience Database Archive (English)
Full Text Available no Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxkxxxxxxxfxxxxxvxfxxvxixxwxxxxxixixkxnxxxx...kpslvrllhsklkvlitlrmlkpksktkkvfh rinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklkvvt tlrm*kqkfktkkvs Frame B: ---xxxxxxxxx...fxxxxxxxxxxxxxsxxxxxxxfxw*xlxxgxxxxxxqyxkxxxxxxg xxixrwyxn
Lifescience Database Archive (English)
Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x
International Nuclear Information System (INIS)
Anon.
2000-01-01
The energy balances of the Danish Statistical Office are the designation of the goods balances, which are tabulated for each energy article in both physical entities (quantities) and in base rates (values). The balance concept is connected to the definition supply = use, which is the basis for the construction of the system. The supply is determined as the sum of two items: import and production while the total use is the sum of 138 items: export, waste and transmission loss, stock increase, input in lack of the 130 industries, and private consumption divided into 5 consumption groups. The statistical analysis is performed yearly in both quantities and values for 35 energy articles. Values are computed for base rates, profits, taxes, VAT and market prices (buyer's price), respectively. The energy balances from 1975 to 1998 are presented for comparison. (EHS)
Work-life balance and welfare.
Evans, Lois; Young, Greg
2017-04-01
An online survey and focus groups were conducted, providing qualitative information on the work-life balance of psychiatrists and trainees in Australasia. An invitation to participate in an anonymous online welfare survey was emailed to all the Royal Australian and New Zealand College of Psychiatrists trainees, Fellows, and Affiliates. Following this, nine focus groups were held across Australia and New Zealand. Responses received were thematically analysed. The emergent patterns are presented in this report. Our research suggests that work-life balance can be subjectively and objectively measured. There are phases of good and bad work-life balance, depending on stage of career and other commitments. Work-life balance may be an indicator of the health of individuals and organisations. Due to its complexity, with intrinsic and extrinsic factors involved, solutions are unlikely to be simple. Further studies are needed to substantiate our findings.
International Nuclear Information System (INIS)
Anon.
1999-01-01
The energy balances of the Danish Statistical Office are the designation of the goods balances, which are tabulated for each energy article in both physical entities (quantities) and in base rates (values). The balance concept is connected to the definition supply = use, which is the basis for the construction of the system. The supply is determined as the sum of two items: import and production while the total use is the sum of 138 items: export, waste and transmission loss, stock increase, input in lack of the 130 industries, and private consumption divided into 5 consumption groups. The statistical analysis is performed yearly in both quantities and values for 35 energy articles. Values are computed for base rates, profits, taxes, VAT and market prices (buyer's price), respectively. The energy balances from 1975 to 1998 are presented for comparison. (EHS)
The influence of some anticancer preparations on photo induced lipid preoxidation
International Nuclear Information System (INIS)
Sargsyan, N.A.
2004-01-01
In nowadays it is very important in medicine to investigate mechanisms of actions of different pharmacological preparations including anticancer ones. As it is known during cancer there is the disruption of balance between free radical oxidative processes and amount of antioxidants. That is why it was investigated the possibility of cooperation of some anticancer preparations with membrane structures and the influence of these preparations on photo induced free radical oxidative process. For investigations of the influence of some anticancer preparations - sarkolizin and cyclophosphane - on the intensivity of chemiluminescence as a biological target it were taken homogenates of brains of cows in tris-HCL buffer solution (1:10, pH=7.4). Irradiation was done with UV-light for 1 minute. Also it was used the model-system of oleinic acid for investigation of action studied preparations on lipid peroxidation. All experiments were done at 40 degree C. It was found out that anticancer preparations suppressed lipid peroxidation and that it is expressed by decreasing of level of photo chemiluminescence. By the way it was discovered that maximal inhibition of photo chemiluminescence was at the moment of adding preparation to the biological target. And then level of photo chemiluminescence increased till some point, which was lower than normal one. Also it was found that the inhibition degree for these preparations was different. For example, sarkolizin decreased the level of photo chemiluminescence on 58%, and cyclophosphane - on 52%. Because chemiluminescence of oleinic acid very well imitates the chemiluminescence of different lipid structures, so it was used as a model-system for testing investigated preparations. And in this experiment also it was found that sarkolizin and cyclophosphane decreased the level of induced chemiluminescence. And this action depended on the concentration of preparations. In conclusion it can be said that sarkolizin and cyclophosphane inhibited
Validity and reliability of the Nintendo Wii Balance Board for assessment of standing balance.
Clark, Ross A; Bryant, Adam L; Pua, Yonghao; McCrory, Paul; Bennell, Kim; Hunt, Michael
2010-03-01
Impaired standing balance has a detrimental effect on a person's functional ability and increases their risk of falling. There is currently no validated system which can precisely quantify center of pressure (COP), an important component of standing balance, while being inexpensive, portable and widely available. The Wii Balance Board (WBB) fits these criteria, and we examined its validity in comparison with the 'gold standard'-a laboratory-grade force platform (FP). Thirty subjects without lower limb pathology performed a combination of single and double leg standing balance tests with eyes open or closed on two separate occasions. Data from the WBB were acquired using a laptop computer. The test-retest reliability for COP path length for each of the testing devices, including a comparison of the WBB and FP data, was examined using intraclass correlation coefficients (ICC), Bland-Altman plots (BAP) and minimum detectable change (MDC). Both devices exhibited good to excellent COP path length test-retest reliability within-device (ICC=0.66-0.94) and between-device (ICC=0.77-0.89) on all testing protocols. Examination of the BAP revealed no relationship between the difference and the mean in any test, however the MDC values for the WBB did exceed those of the FP in three of the four tests. These findings suggest that the WBB is a valid tool for assessing standing balance. Given that the WBB is portable, widely available and a fraction of the cost of a FP, it could provide the average clinician with a standing balance assessment tool suitable for the clinical setting. Copyright 2009 Elsevier B.V. All rights reserved.
Nnodim, Joseph O; Strasburg, Debra; Nabozny, Martina; Nyquist, Linda; Galecki, Andrzej; Chen, Shu; Alexander, Neil B
2006-12-01
To compare the effect of two 10-week balance training programs, Combined Balance and Step Training (CBST) versus tai chi (TC), on balance and stepping measures. Prospective intervention trial. Local senior centers and congregate housing facilities. Aged 65 and older with at least mild impairment in the ability to perform unipedal stance and tandem walk. Participants were allocated to TC (n = 107, mean age 78) or CBST, an intervention focused on improving dynamic balance and stepping (n = 106, mean age 78). At baseline and 10 weeks, participants were tested in their static balance (Unipedal Stance and Tandem Stance (TS)), stepping (Maximum Step Length, Rapid Step Test), and Timed Up and Go (TUG). Performance improved more with CBST than TC, ranging from 5% to 10% for the stepping tests (Maximum Step Length and Rapid Step Test) and 9% for TUG. The improvement in TUG represented an improvement of more than 1 second. Greater improvements were also seen in static balance ability (in TS) with CBST than TC. Of the two training programs, in which variants of each program have been proven to reduce falls, CBST results in modest improvements in balance, stepping, and functional mobility versus TC over a 10-week period. Future research should include a prospective comparison of fall rates in response to these two balance training programs.
Implementace metody Balanced Scorecard
Neuwirth, Pavel
2014-01-01
Diplomová práce je zaměřena na hodnocení výkonnosti společnosti pomocí metody Balanced Scorecard. Teoretická část práce popisuje východiska měření výkonnosti, metody Balanced Scorecard a postup při její implementaci. Analytická část vychází z teoretických poznatků z první části a hodnotí situaci společnosti finanční analýzou poměrových ukazatelů, strategickou analýzou a následným sestavením návrhu implementace metody Balanced Scorecard v konkrétní společnosti. Thesis is focused on evaluati...
Medical Devices Assess, Treat Balance Disorders
2009-01-01
You may have heard the phrase as difficult as walking and chewing gum as a joking way of referring to something that is not difficult at all. Just walking, however, is not all that simple physiologically speaking. Even standing upright is an undertaking requiring the complex cooperation of multiple motor and sensory systems including vision, the inner ear, somatosensation (sensation from the skin), and proprioception (the sense of the body s parts in relation to each other). The compromised performance of any of these elements can lead to a balance disorder, which in some form affects nearly half of Americans at least once in their lifetimes, from the elderly, to those with neurological or vestibular (inner ear) dysfunction, to athletes with musculoskeletal injuries, to astronauts returning from space. Readjusting to Earth s gravity has a significant impact on an astronaut s ability to balance, a result of the brain switching to a different "model" for interpreting sensory input in normal gravity versus weightlessness. While acclimating, astronauts can experience headaches, motion sickness, and problems with perception. To help ease the transition and study the effects of weightlessness on the body, NASA has conducted many investigations into post-flight balance control, realizing this research can help treat patients with balance disorders on Earth as well. In the 1960s, the NASA-sponsored Man Vehicle Laboratory at the Massachusetts Institute of Technology (MIT) studied the effects of prolonged space flight on astronauts. The lab s work intrigued MIT doctoral candidate Lewis Nashner, who began conducting NASA-funded research on human movement and balance under the supervision of Dr. Larry Young in the MIT Department of Aeronautics and Astronautics. In 1982, Nashner s work resulted in a noninvasive clinical technique for assessing the cooperative systems that allow the body to balance, commonly referred to as computerized dynamic posturography (CDP). CDP employs a
Age effects on mediolateral balance control.
Directory of Open Access Journals (Sweden)
L Eduardo Cofré Lizama
Full Text Available BACKGROUND: Age-related balance impairments, particularly in mediolateral direction (ML may cause falls. Sufficiently sensitive and reliable ML balance tests are, however, lacking. This study is aimed to determine (1 the effect of age on and (2 the reliability of ML balance performance using Center of Mass (CoM tracking. METHODS: Balance performance of 19 young (26±3 years and 19 older (72±5 years adults on ML-CoM tracking tasks was compared. Subjects tracked predictable and unpredictable target displacements at increasing frequencies with their CoM by shifting their weight sideward. Phase-shift (response delay and gain (amplitude difference between the CoM and target in the frequency domain were used to quantify performance. Thirteen older and all young adults were reassessed to determine reliability of balance performance measures. In addition, all older adults performed a series of clinical balance tests and conventional posturography was done in a sub-sample. RESULTS: Phase-shift and gain dropped below pre-determined thresholds (-90 degrees and 0.5 at lower frequencies in the older adults and were even lower below these frequencies than in young adults. Performance measures showed good to excellent reliability in both groups. All clinical scores were close to the maximum and no age effect was found using posturography. ML balance performance measures exhibited small but systematic between-session differences indicative of learning. CONCLUSIONS: The ability to accurately perform ML-CoM tracking deteriorates with age. ML-CoM tracking tasks form a reliable tool to assess ML balance in young and older adults and are more sensitive to age-related impairment than posturography and clinical tests.
Towards exoskeletons with balance capacities
van der Kooij, Herman; van Asseldonk, Edwin H.F.; Vlutters, Mark; González-Vargas, José; Ibáñez, Jaime; Contreras-Vidal, Jose L.; van der Kooij, Herman; Pons, José Luis
2017-01-01
Current exoskeletons replay pre-programmed trajectories at the actuated joints. Towards the employment of exoskeletons with more flexible and adaptive behavior, we investigate human balance control during gait. We study human balance control by applying brief force pulses at the pelvis in different
Design Strategies for Balancing Exertion Games
DEFF Research Database (Denmark)
Jensen, Mads Møller; Grønbæk, Kaj
2016-01-01
In sports, if players' physical and technical abilities are mismatched, the competition is often uninteresting for them. With the emergence of exertion games, this could be changing. Player balancing, known from video games, allows players with different skill levels to compete, however, it is un......In sports, if players' physical and technical abilities are mismatched, the competition is often uninteresting for them. With the emergence of exertion games, this could be changing. Player balancing, known from video games, allows players with different skill levels to compete, however......, it is unclear how balancing mechanisms should be applied in exertion games, where physical and digital elements are fused. In this paper, we present an exertion game and three approaches for balancing it; a physical, an explicit-digital and an implicit-digital balancing approach. A user study that compares...... these three approaches is used to investigate the qualities and challenges within each approach and explore how the player experience is affected by them. Based on these findings, we suggest four design strategies for balancing exertion games, so that players will stay engaged in the game and contain...
Jung, HoHyun; Chun, Keyoung Jin; Hong, Jaesoo; Lim, Dohyung
2015-01-01
Balance is important in daily activities and essential for maintaining an independent lifestyle in the elderly. Recent studies have shown that balance rehabilitation training can improve the balance ability of the elderly, and diverse balance rehabilitation training equipment has been developed. However, there has been little research into optimized strategies for balance rehabilitation training. To provide an optimized strategy, we analyzed the balance characteristics of participants in response to the rotation of a base plate on multiple axes. Seven male adults with no musculoskeletal or nervous system-related diseases (age: 25.5±1.7 years; height: 173.9±6.4 cm; body mass: 71.3±6.5 kg; body mass index: 23.6±2.4 kg/m2) were selected to investigate the balance rehabilitation training using customized rehabilitation equipment. Rotation of the base plate of the equipment was controlled to induce dynamic rotation of participants in the anterior–posterior, right-diagonal, medial–lateral, and left-diagonal directions. We used a three-dimensional motion capture system employing infrared cameras and the Pedar Flexible Insoles System to characterize the major lower-extremity joint angles, center of body mass, and center of pressure. We found statistically significant differences between the changes in joint angles in the lower extremities in response to dynamic rotation of the participants (P0.05). These results indicate that optimizing rotation control of the base plate of balance rehabilitation training equipment to induce anterior–posterior and medial–lateral dynamic rotation preferentially can lead to effective balance training. Additional tests with varied speeds and ranges of angles of base plate rotation are expected to be useful as well as an analysis of the balance characteristics considering a balance index that reflects the muscle activity and cooperative characteristics. PMID:26508847
Neeraj Panwar, MPT (Sports); Gaurav Kadyan, MPT (Sports); Aseem Gupta, MPT (Sports); Ravinder Narwal, MPT (Ortho,Cardiopulmonary)
2014-01-01
Aim & Objective: The aim of the study was to determine the effect of wobble board balance training program on static & dynamic balance & on triple hop distance in male collegiate basketball athletes. Methodology: Fifty healthy basketball players within a age group of 18-22 yrs. were randomly selected with a baseline BESS score between 6 to 14 & modified SEBT score equal to or greater than 94 (till 100) and they randomly divided into control (n-25) & training group (n-25).The training grou...
Strategic management by balanced development: meaning
Directory of Open Access Journals (Sweden)
Yevtushenko Natalya Olexandrivna
2016-02-01
Full Text Available Based on analyzes of references it was found out the meaning of «management», «strategic management», «development of enterprise», «balanced development» and were proved their connections. It was described authorial interpretation of definition “strategic management by balanced development”. The next descriptions were separated: presence of quantitative and quality changes, adaptation to influence of internal and external environment factors. It was set that a human capital is the main source of the balanced development. On the basis of generalization and systematization of existent interpretations was offered authorial determination of essence of concept «strategic management by balanced development of enterprise».
El-Shamy, Shamekh Mohamed; Abd El Kafy, Ehab Mohamed
2014-01-01
The purpose of this study was to evaluate the effects of balance training on postural control and fall risk in children with diplegic cerebral palsy. Thirty spastic diplegic cerebral palsied children (10-12 years) were included in this study. Children were randomly assigned into two equal-sized groups: control and study groups. Participants in both groups received a traditional physical therapy exercise program. The study group additionally received balance training on the Biodex balance system. Treatment was provided 30 min/d, 3 d/week for 3 successive months. To evaluate the limit of stability and fall risk, participated children received baseline and post-treatment assessments using the Biodex balance system. Overall directional control, total time to complete the test, overall stability index of the fall risk test and total score of the pediatric balance scale were measured. Children in both groups showed significant improvements in the mean values of all measured variables post-treatment (p control group (p postural balance control in children with diplegic cerebral palsy.
DEFF Research Database (Denmark)
Kluth, Michael Friederich; Pilegaard, Jess
The present paper seeks to make sense of recent EU naval capability changes by applying neo-realist theory on the EU as an international actor in the global balance of power. The paper compares three different strands of Neo-realist theory by deducting key predictions about the expected defense...... posture of the Union and the expected changes in naval capabilities. The predictions are subsequently held up against recent data on naval military build-up in the EU. The paper argues that the observed patterns are best explained not as bandwagoning with the United States, but as a long-term balancing...
The psychology of the nuclear balance
International Nuclear Information System (INIS)
Sonntag, P.
1981-01-01
The balance of military forces is meant to prevent war. But it is a very precarious balance, which becomes all the more dubious when the deterrent is no longer psychologically effective: when the country attacked is deterred from striking back with nuclear weapons. A unilateral disarmament above the overkill level would be possible without endangering the balance. It would improve the climate for mutual disarmament. (orig.) [de
Balance impairment in individuals with Wolfram syndrome.
Pickett, Kristen A; Duncan, Ryan P; Paciorkowski, Alex R; Permutt, M Alan; Marshall, Bess; Hershey, Tamara; Earhart, Gammon M
2012-07-01
Wolfram syndrome (WFS), a rare neurodegenerative disorder, is characterized by early onset insulin-dependent diabetes mellitus, optic atrophy, deafness, diabetes insipidus, and neurological abnormalities. Although previously unreported, we hypothesized that neurological complications may be detectable in relatively early stages of the disease. As the cerebellum and brainstem seem particularly vulnerable in WFS, we focused on balance functions critically dependent on these regions. The primary goal of this investigation was to compare balance in young individuals with WFS, in relatively early stages of the disease, to an age-matched cohort using a clinically applicable test. Balance was assessed via the mini-BESTest in 13 children, adolescents and young adults with WFS and 30 typically developing age-matched individuals. A significant difference was observed between groups in balance as well as in three of four subcomponents of the mini-BESTest and in two timed tasks related to balance. Mini-BESTest scores were correlated with age among typically developing individuals. In the WFS group, mini-BESTest scores were related to overall motor dysfunction, but not age. Impairments in balance in WFS may occur earlier in the disease process than previously recognized and appear to be related to overall neurological progression rather than chronological age. Recognizing balance impairments and understanding which balance systems contribute to balance deficits in those with WFS may allow for development of effective patient-centered treatment paradigms. Copyright © 2012 Elsevier B.V. All rights reserved.
Balanced identity in the minimal groups paradigm.
Directory of Open Access Journals (Sweden)
Yarrow Dunham
Full Text Available Balanced Identity Theory [1] formalizes a set of relationships between group attitude, group identification, and self-esteem. While these relationships have been demonstrated for familiar and highly salient social categories, questions remain regarding the generality of the balance phenomenon and its causal versus descriptive status. Supporting the generality and rapidity of cognitive balance, four studies demonstrate that the central predictions of balance are supported even for previously unfamiliar "minimal" social groups to which participants have just been randomly assigned. Further, supporting a causal as opposed to merely descriptive interpretation, manipulating any one component of the balance model (group attitude, group identification, or self-esteem affects at least one of the related components. Interestingly, the broader pattern of cognitive balance was preserved across such manipulations only when the manipulation strengthens as opposes to weakens the manipulated construct. Taken together, these findings indicate that Balanced Identity Theory has promise as a general theory of intergroup attitudes, and that it may be able to shed light on prior inconsistencies concerning the relationship between self-esteem and intergroup bias.
Balanced identity in the minimal groups paradigm.
Dunham, Yarrow
2013-01-01
Balanced Identity Theory [1] formalizes a set of relationships between group attitude, group identification, and self-esteem. While these relationships have been demonstrated for familiar and highly salient social categories, questions remain regarding the generality of the balance phenomenon and its causal versus descriptive status. Supporting the generality and rapidity of cognitive balance, four studies demonstrate that the central predictions of balance are supported even for previously unfamiliar "minimal" social groups to which participants have just been randomly assigned. Further, supporting a causal as opposed to merely descriptive interpretation, manipulating any one component of the balance model (group attitude, group identification, or self-esteem) affects at least one of the related components. Interestingly, the broader pattern of cognitive balance was preserved across such manipulations only when the manipulation strengthens as opposes to weakens the manipulated construct. Taken together, these findings indicate that Balanced Identity Theory has promise as a general theory of intergroup attitudes, and that it may be able to shed light on prior inconsistencies concerning the relationship between self-esteem and intergroup bias.
Risk, Balanced Skills and Entrepreneurship
Hsieh, C.; Parker, S.C.; van Praag, C.M.
2016-01-01
This paper proposes that risk aversion encourages individuals to invest in balanced skill profiles, making them more likely to become entrepreneurs. By not taking this possible linkage into account, previous research has underestimated the impacts of both risk aversion and balanced skills on the
Use of the Microsoft Kinect system to characterize balance ability during balance training
Directory of Open Access Journals (Sweden)
Lim DH
2015-06-01
Full Text Available Dohyung Lim,1 ChoongYeon Kim,2 HoHyun Jung,1 Dukyoung Jung,3 Keyoung Jin Chun21Department of Mechanical Engineering, Sejong University, Seoul, Republic of Korea; 2Advanced Biomedical Engineering Lab, Korea Institute of Industrial Technology, Cheonan, Republic of Korea; 3R&D Team, Senior Products Industrial Center, Busan, Republic of KoreaAbstract: The risk of falling increases significantly in the elderly because of deterioration of the neural musculature regulatory mechanisms. Several studies have investigated methods of preventing falling using real-time systems to evaluate balance; however, it is difficult to monitor the results of such characterizations in real time. Herein, we describe the use of Microsoft’s Kinect depth sensor system to evaluate balance in real time. Six healthy male adults (25.5±1.8 years, 173.9±6.4 cm, 71.4±6.5 kg, and 23.6±2.4 kg/m2, with normal balance abilities and with no musculoskeletal disorders, were selected to participate in the experiment. Movements of the participants were induced by controlling the base plane of the balance training equipment in various directions. The dynamic motion of the subjects was measured using two Kinect depth sensor systems and a three-dimensional motion capture system with eight infrared cameras. The two systems yielded similar results for changes in the center of body mass (P>0.05 with a large Pearson’s correlation coefficient of γ>0.60. The results for the two systems showed similarity in the mean lower-limb joint angle with flexion–extension movements, and these values were highly correlated (hip joint: within approximately 4.6°; knee joint: within approximately 8.4° (0.40<γ<0.74 (P>0.05. Large differences with a low correlation were, however, observed for the lower-limb joint angle in relation to abduction–adduction and internal–external rotation motion (γ<0.40 (P<0.05. These findings show that clinical and dynamic accuracy can be achieved using the Kinect
International Nuclear Information System (INIS)
Kanwal, H.; Shahbaz, M.; Ashraf, M.
2011-01-01
The present study was aimed to assess salt tolerance of some newly developed and candidate cultivars of wheat using gas exchange and chlorophyll fluorescence parameters. Ten wheat cultivars including five newly developed (S-24, Saher-2006, Fsd-2008, Lasani and Inqlab-91) and five candidate (P .B-18, M.P-65, S.H-20, AARI-10 and G.A-20) were grown in sand culture. Salt stress (150 mM NaCl in Hoagland's nutrient solution) was applied at the seedling stage. A significant reduction in plant biomass production was recorded in all wheat cultivars. Cultivars S-24, Saher-2006 and Fsd-2008 showed less reduction in biomass production as compared with the other cultivars. Different gas exchange attributes such as leaf net photosynthetic rate (A), transpiration rate ( E), and stomatal conductance (gs) were also adversely affected due to salt stress and were positively associated with the plant biomass production of the genotypes under saline stress. More negative effects in relation to these gas exchange attributes were recorded in cvs. Lasani, G.A-20 and ARRI-10 than those in the other cultivars. Leaf maximum chlorophyll fluorescence (Fm), maximum fluorescence at steady state (Fms ), and photochemical fluorescence quenching (Qp) increased while maximum quantum yield (Fv/Fm), quantum yield of electron transport (Qp), electron transport rate ( ETR ) and non-photochemical quenching (Qn) decreased due to imposition of salt stress. The adverse effects of salt stress on these chlorophyll fluorescence attributes were minimum in cultivars S-24, Saher-2006 and Fsd-2008. A significant positive correlation was recorded between biomass production, different gas exchange attributes and chlorophyll fluorescence parameters. Overall, cvs. S-24, Saher-2006 and Fsd-2008 were ranked as salt tolerant on the basis of their performance in biomass production, gas exchange attributes and chlorophyll fluorescence parameters. (author)
Female Sexual Dysfunction-Medical and Psychological Treatments, Committee 14.
Kingsberg, Sheryl A; Althof, Stanley; Simon, James A; Bradford, Andrea; Bitzer, Johannes; Carvalho, Joana; Flynn, Kathryn E; Nappi, Rossella E; Reese, Jennifer B; Rezaee, Roya L; Schover, Leslie; Shifrin, Jan L
2017-12-01
Since the millennium we have witnessed significant strides in the science and treatment of female sexual dysfunction (FSD). This forward progress has included (i) the development of new theoretical models to describe healthy and dysfunctional sexual responses in women; (ii) alternative classification strategies of female sexual disorders; (iii) major advances in brain, hormonal, psychological, and interpersonal research focusing on etiologic factors and treatment approaches; (iv) strong and effective public advocacy for FSD; and (v) greater educational awareness of the impact of FSD on the woman and her partner. To review the literature and describe the best practices for assessing and treating women with hypoactive sexual desire disorder, female sexual arousal disorder, and female orgasmic disorders. The committee undertook a comprehensive review of the literature and discussion among themselves to determine the best assessment and treatment methods. Using a biopsychosocial lens, the committee presents recommendations (with levels of evidence) for assessment and treatment of hypoactive sexual desire disorder, female sexual arousal disorder, and female orgasmic disorders. The numerous significant strides in FSD that have occurred since the previous International Consultation of Sexual Medicine publications are reviewed in this article. Although evidence supports an integrated biopsychosocial approach to assessment and treatment of these disorders, the biological and psychological factors are artificially separated for review purposes. We recognize that best outcomes are achieved when all relevant factors are identified and addressed by the clinician and patient working together in concert (the sum is greater than the whole of its parts). Kingsberg SA, Althof S, Simon JA, et al. Female Sexual Dysfunction-Medical and Psychological Treatments, Committee 14. J Sex Med 2017;14:1463-1491. Copyright © 2017 International Society for Sexual Medicine. Published by
Ledogar, Robert J; Fleming, John; Andersson, Neil
2009-10-14
In preparation for a cluster-randomized controlled trial of a community intervention to increase the demand for measles vaccination in Lasbela district of Pakistan, a balance sheet summarized published evidence on benefits and possible adverse effects of measles vaccination. The balance sheet listed: 1) major health conditions associated with measles; 2) the risk among the unvaccinated who contract measles; 3) the risk among the vaccinated; 4) the risk difference between vaccinated and unvaccinated; and 5) the likely net gain from vaccination for each condition. Two models revealed very different projections of net gain from measles vaccine. A Lasbela-specific combination of low period prevalence of measles among the unvaccinated, medium vaccination coverage and low vaccine efficacy rate, as revealed by the baseline survey, resulted in less-than-expected gains attributable to vaccination. Modelled on estimates where the vaccine had greater efficacy, the gains from vaccination would be more substantial. Specific local conditions probably explain the low rates among the unvaccinated while the high vaccine failure rate is likely due to weaknesses in the vaccination delivery system. Community perception of these realities may have had some role in household decisions about whether to vaccinate, although the major discouraging factor was inadequate access. The balance sheet may be useful as a communication tool in other circumstances, applied to up-to-date local evidence.
Directory of Open Access Journals (Sweden)
Ali Abbasi
2012-04-01
Full Text Available Introduction: Since disorders in neuromuscular performance and imbalance are the main cause of fallingamong the middle aged, their aspects including rehabilitation of balance are the main concern theresearchers attend to them. The aim of this study was to determine the effects of eight weeks aquaticbalance training (ABT and detraining on neuromuscular performance and balance in healthy middle agedmale.Materials and Methods: Thirty adult male subjects were randomized into two groups of ABT and control(n=15 per group. Berg balance scale, Timed Up and Go and 5-Chair stand tests, as they are indicators ofbalance and neuromuscular performance in older subjects, were taken as pretest and post-test and after four,six, and eight weeks of detraining as well. The ABT consisted of the sessions that lasted one hour, threetimes a week, for eight weeks.Results: Results showed that neuromuscular performance and balance improved significantly in ABTgroup (P 0.05.Conclusion: ABT can affect neuromuscular performance and balance in healthy middle aged male, andreduce the probability of falling among them. Moreover, the effects of these training are persistent afterdetraining periods. Hence, ABT can be recommended as an effective neuromuscular and balance training inhealthy middle aged male
HPOTP low-speed flexible rotor balancing, phase 1
Giordano, J.; Zorzi, E.
1985-01-01
A method was developed that shows promise in overcoming many balancing limitations. This method establishes one or more windows for low speed, out-of-housing balancing of flexible rotors. These windows are regions of speed and support flexibility where two conditions are simultaneously fulfilled. First, the rotor system behaves flexibly; therefore, there is separation among balance planes. Second, the response due to balance weights is large enough to reliably measure. The analytic formulation of the low-speed flexible rotor balancing method is described. The results of proof-of-principle tests conducted under the program are presented. Based on this effort, it is concluded that low speed flexible rotor balancing is a viable technology. In particular, the method can be used to balance a rotor bearing system at low speed which results in smooth operation above more than one bending critical speed. Furthermore, this balancing methodology is applicable to SSME turbopump rotors.
Balance Functional Assessment in People with Visual Impairment
Directory of Open Access Journals (Sweden)
Rutkowska Izabela
2015-12-01
Full Text Available The aims of this study were twofold: to assess the level of balance of people with visual impairment against the BOT-2 standard scores for the able-bodied, and to identify in which trials subjects had the greatest difficulties in maintaining balance with respect to the degree of vision loss and age categories. One hundred twenty-seven subjects with visual impairment aged 6-16 years, participated in the study (68 girls and 59 boys. The division for partially sighted people (61 and the blind (66 was made according to the WHO classification. Functional balance assessment was made using a balance subtest from the Bruininks-Oseretsky test. Significant relationships were noticed between age and the level of balance (χ2 = 8.35 p <0,05, as well as between the degree of vision loss and the level of balance (χ2 = 24.53 p <0,001. The level of balance of almost all blind subjects was below (20% or well-below (60% the average for the able-bodied. The subjects’ ability to maintain balance was not dependent on gender and was associated primarily with the degree of visual impairment and age. Partially sighted people had better balance than the blind and the decrease in visual acuity resulted in reduction of balance skills. The lowest level of balance was observed in blind students aged 7-11 years. Elaborating physical fitness improvement programs for children and adolescents with visual impairment, diversity of age, the degree of vision loss and limitations of ablility to maintain balance should be taken into account.
Determination of hydrophilicâlipophilic balance value and emulsion properties of sacha inchi oil
Directory of Open Access Journals (Sweden)
Kiattiphumi Saengsorn
2017-12-01
Full Text Available Objective: To determine hydrophilicâlipophilic balance (HLB value, stability of formulate emulsion and properties of sacha inchi oil. Methods: The physiochemical characteristics of sacha inchi oil were first investigated. Free radical scavenging property was studied by DPPH assay. HLB value of sacha inchi oil was experimentally determined by preparing the emulsion using emulsifiers at different HLB value. Sacha inchi oil emulsion was prepared using the obtained HLB and its stability was conducted by centrifugation, temperature cycling, and accelerated stability test. The efficiency of the prepared emulsion was clinically investigated by 15 volunteers. The primary skin irritation was performed using closed patch test. Subjective sensory assessment was evaluated by using 5-point hedonic scale method. Results: Peroxide value of sacha inchi oil was 18.40Â meq O2/kg oil and acid value was 1.86 KOH/g oil. The major fatty acids are omega-3 (44%, omega-6 (35% and omega-9 (9%. The vitamin E content was 226Â mg/100Â g oil. Moreover, sacha inchi oil (167Â ppm and its emulsion showed 85% and 89% DPPH inhibition, respectively. The experimental HLB value of sacha inchi oil was 8.5. The sacha inchi oil emulsion exhibited good stability after stability test. The emulsion was classified as non-irritant after tested by primary skin irritation method. The skin hydration value significantly increased from 38.59 to 45.21 (PÂ <Â 0.05 after applying sacha inchi oil emulsion for 1 month and the overall product satisfaction of volunteers after use was with score of 4.2. Conclusions: This work provides information on HLB value and emulsion properties of sacha inchi oil which is useful for cosmetic and pharmaceutical application. Keywords: Sacha inchi oil, Hydrophilicâlipophilic balance value, Emulsion stability, Efficacy test, Sensory test
Correction of algocenosis by the preparation of komplezim in experimental ponds of fish-farm Nyvka
Directory of Open Access Journals (Sweden)
L. Dragan
2016-01-01
Full Text Available Purpose. To investigate the effect of the bacterial preparation "Komplezim", which is recommended for the prevention of mass reproduction of blue-green algae through algocoenosis correction, water cleaning and sanitary regime restoration, for the biological balance and self-purification of natural and farmed fish ponds of all sizes exposed to artificial or natural pollution. Methodology. The studies were carried out during 30 days in a 0.01 hectare pond with a depth of 1.0–1.5 m. The doses of the bacterial preparation "Komplezim" in the form of a solution were applied over the water surface of the experimental pond. The conventional techniques of hydrochemistry and hydrobiology were used to perform hydroecological studies. Findings. The study results showed that after the exposure of the bacterial preparation "Komplezim", pH level of water and oxidation rates were within the acceptable limits. Permanganate and dichromate oxidation decreased in the same manner in the middle and end of the experiment compared to initial values. Calcium, magnesium, and sulfate levels were lower compared to control values. This effect can be explained by the fact that bacteria from the “Komplezim” composition in aquatic medium started intensive metabolizing the products of organic decomposition enriched in calcium, magnesium and sulfates. The consequence of the application of "Komplezim" was an increase in the concentration of organic chlorides simultaneously with nitrites. The obtained results indicate that bacteria strains included in the “Komplezim” composition inhibit the processes of cyanobacteria reproduction by algocenosis correction and contributes to the optimization of hydrochemical conditions for pond fish rearing. Originality. The effect of the bacterial preparation "Komplezim" on the reproduction of blue-green algae and hydro-chemical composition of the water has been investigated for the first time. Practical value. Application of the
Bhat, Rashi; Moiz, Jamal Ali
2013-09-01
The preliminary study aimed to compare dynamic balance between collegiate athletes competing or training in football and hockey using star excursion balance test. A total thirty university level players, football (n = 15) and field hockey (n = 15) were participated in the study. Dynamic balance was assessed by using star excursion balance test. The testing grid consists of 8 lines each 120 cm in length extending from a common point at 45° increments. The subjects were instructed to maintain a stable single leg stance with the test leg with shoes off and to reach for maximal distance with the other leg in each of the 8 directions. A pencil was used to point and read the distance to which each subject's foot reached. The normalized leg reach distances in each direction were summed for both limbs and the total sum of the mean of summed normalized distances of both limbs were calculated. There was no significant difference in all the directions of star excursion balance test scores in both the groups. Additionally, composite reach distances of both groups also found non-significant (P=0.5). However, the posterior (P=0.05) and lateral (P=0.03) normalized reach distances were significantly more in field hockey players. Field hockey players and football players did not differ in terms of dynamic balance.
International Nuclear Information System (INIS)
Grove, R.E.
2005-01-01
The Slice Balance Approach (SBA) is an approach for solving geometrically-complex, neutral-particle transport problems within a multi-group discrete ordinates (S N ) framework. The salient feature is an angle-dependent spatial decomposition. We approximate general surfaces with arbitrary polygonal faces and mesh the geometry with arbitrarily-shaped polyhedral cells. A cell-local spatial decomposition divides cells into angle-dependent slices for each S N direction. This subdivision follows from a characteristic-based view of the transport problem. Most balance-based characteristic methods use it implicitly; we use it explicitly and exploit its properties. Our mathematical approach is a multiple balance approach using exact spatial moments balance equations on cells and slices along with auxiliary relations on slices. We call this the slice balance approach; it is a characteristic-based multiple balance approach. The SBA is intentionally general and can extend differencing schemes to arbitrary 2-D and 3-D meshes. This work contributes to development of general-geometry deterministic transport capability to complement Monte Carlo capability for large, geometrically-complex transport problems. The purpose of this paper is to describe the SBA. We describe the spatial decomposition and mathematical framework and highlight a few interesting properties. We sketch the derivation of two solution schemes, a step characteristic scheme and a diamond-difference-like scheme, to illustrate the approach and we present interesting results for a 2-D problem. (author)
Delgosha, Payam; Anantharam, Venkat
2018-03-01
Consider a simple locally finite hypergraph on a countable vertex set, where each edge represents one unit of load which should be distributed among the vertices defining the edge. An allocation of load is called balanced if load cannot be moved from a vertex to another that is carrying less load. We analyze the properties of balanced allocations of load. We extend the concept of balancedness from finite hypergraphs to their local weak limits in the sense of Benjamini and Schramm (Electron J Probab 6(23):13, 2001) and Aldous and Steele (in: Probability on discrete structures. Springer, Berlin, pp 1-72, 2004). To do this, we define a notion of unimodularity for hypergraphs which could be considered an extension of unimodularity in graphs. We give a variational formula for the balanced load distribution and, in particular, we characterize it in the special case of unimodular hypergraph Galton-Watson processes. Moreover, we prove the convergence of the maximum load under some conditions. Our work is an extension to hypergraphs of Anantharam and Salez (Ann Appl Probab 26(1):305-327, 2016), which considered load balancing in graphs, and is aimed at more comprehensively resolving conjectures of Hajek (IEEE Trans Inf Theory 36(6):1398-1414, 1990).
Balance control in older adults
Van Dieën, Jaap H.; Pijnappels, Mirjam
2017-01-01
To avoid falls during everyday movements, we need to maintain balance, i.e., control the position of our body's center of mass relative to our base of support. The balance control system comprises sensory subsystems, their afferent nerves, an extensive brain network, and the motor system.
Balancing for Unstable Nonlinear Systems
Scherpen, J.M.A.
1993-01-01
A previously obtained method of balancing for stable nonlinear systems is extended to unstable nonlinear systems. The similarity invariants obtained by the concept of LQG balancing for an unstable linear system can also be obtained by considering a past and future energy function of the system. By
A comparative study on music teacher preparation in Portugal and Brazil
Directory of Open Access Journals (Sweden)
Graça Mota
2012-05-01
Full Text Available The preparation of music teachers in Portugal and Brazil is the focus of this text, which aims at presenting preliminary aspects of a study in progress in the context of higher education in both countries. Inspired by comparative education methodology, the present study is investigating official documents and academic curricula offered in Portugal and Brazil for the music teachers’ preparation to promote, in different ways, the comparative reflection with an emphasis on school education. The music teachers’ education in both countries was analyzed taking into account the following elements: educational context in Portugal and Brazil; music preparation prior to higher education, and the entrance criteria in the courses that are offered for music teachers; curricular elements of the courses; teaching practice and professional perspectives. The preliminary results of this comparative analysis demonstrate similarities and differences in the two contexts: 1 in both countries, music teachers for regular schools receive their degrees in higher education institutions, and in Portugal, beyond the Licenciatura in Music, a Music Education Master degree is demanded; 2 in both countries specific entrance tests are accomplished in the universities, demanding previous musical knowledge; 3 the balance among the musical and pedagogical preparation is one of the curricular objectives; 4 the teaching practice is an emphasized component in the teachers’ preparation; 5 in Portugal, student’s motivation for the work in the regular school appears to be larger than in Brazil.
Gatica-Rojas, Valeska; Méndez-Rebolledo, Guillermo; Guzman-Muñoz, Eduardo; Soto-Poblete, Alex; Cartes-Velásquez, Ricardo; Elgueta-Cancino, Edith; Cofré Lizama, L Eduardo
2017-08-01
Evidence on the effect of systemic exercise programs to improve the standing balance with the Nintendo Wii system is very limited and its post-treatment effectiveness is unknown in cerebral palsy (CP) patients. Primary aim was to compare the effect of Nintendo Wii balance board (Wii-therapy) and standard physiotherapy (SPT), on the performance of standing balance in children and adolescents with CP. Secondary aim was to determine the post-treatment effectiveness of Wii-therapy and SPT. Two-arm, matched-pairs, parallel-groups, randomized, controlled clinical trial. Outpatient Rehabilitation Centre in the city of Talca. Patients with CP type spastic hemiplegia (SHE) and spastic diplegia (SDI), aged 7 to 14 years, and level I or II of GMFCS or GMFCS-ER. Were excluded patients with FSIQWii-therapy (SDI=7; SHE=9) or SPT intervention (SDI=7; SHE=9). In each group, patients received three sessions per week over a period of 6 weeks. Standing balance was assessed at baseline and every 2 weeks. Additionally, two follow-up assessments (4 additional weeks) were performed to determine post-treatment effectiveness. Standing balance was quantified on force platform obtaining the outcomes area of center-of-pressure (CoP) sway (CoPSway), standard deviation in the medial-lateral (SDML) and the anterior-posterior (SDAP) directions, and velocity in both directions (VML and VAP). Compared to SPT, Wii-therapy significantly reduced the CoPSway (P=0.02) and SDAP in the eyes-open condition (P=0.01). However, the effects wane after 2-4 weeks. Post-hoc analysis revealed that only SHE children benefited from Wii-therapy. Wii-therapy was better than SPT in improving standing balance in patients with CP, but improves the balance only in SHE patients. Also, Wii-therapy effectiveness waned 2-4 weeks after the end the intervention. A systematic exercise program like Wii-therapy using the Nintendo Wii Balance Board device can be considered to improves the standing balance in patients with CP
DEFF Research Database (Denmark)
Broholm-Jørgensen, Marie; Guassora, Ann Dorrit; Reventlow, Susanne
2017-01-01
Objective: Little is known about how strategies of retaining patients are acted out by general practitioners (GPs) in the clinical encounter. With this study, we apply Grimens’ (2009) analytical connection between trust and power to explore how trust and power appear in preventive health checks...... of clinical encounters. Results: From the empirical data, we identified three dimensions of respect: respect for the patient’s autonomy, respect for professional authority and respect as a mutual exchange. A balance of respect influenced trust in the relationship between GP and patients and the transfer...... of power in the encounter. The GPs articulated that a balance was needed in preventive health checks in order to establish trust and thus retain the patient in the clinic. One way this balance of respect was carried out was with the use of humour. Conclusions: To retain patients without formal education...
Wong, Christopher Kevin; Chen, Christine C; Blackwell, Wren M; Rahal, Rana T; Benoy, Stephany A
2015-01-01
Falls are common among adults with leg amputations and associated with balance confidence. But subjective confidence is not equivalent with physical ability. This multivariate analyses of community-dwelling adults with leg amputations examined relationships among individual characteristics, falls, balance ability and balance confidence. Cross-sectional study. Community-dwelling adults with leg amputations recruited from a support group and prosthetic clinic. Subjects provided self-reported medical/fall history, prosthetic functional use, and Activities-specific Balance Confidence (ABC) questionnaire data. Balance ability was assessed with the Berg Balance Scale (BBS). Fall incidence was categorized as any fall (one or more) and recurrent falls (more than one). Multivariate logistic regression analyzed relationships within the two fall categories. Cross tabulations and ANOVA analyzed differences among subcategories. Fifty-four subjects (mean age 56.8) with various etiologies, amputation levels, and balance abilities participated. 53.7% had any fall; 25.9% had recurrent falls. Models for both fall categories correctly classified fall history in > 70% of subjects with combinations of the variables ABC, BBS, body-mass-index, and amputation level. Falls occurred regardless of clinical characteristics. Total BBS and select item scores were independent determinants of fall history. Unlike other balance-impaired populations, adults with leg amputation and better balance ability had greater odds of falling.
Tsiliyannis, Christos Aristeides
2013-09-01
Hazardous waste incinerators (HWIs) differ substantially from thermal power facilities, since instead of maximizing energy production with the minimum amount of fuel, they aim at maximizing throughput. Variations in quantity or composition of received waste loads may significantly diminish HWI throughput (the decisive profit factor), from its nominal design value. A novel formulation of combustion balance is presented, based on linear operators, which isolates the wastefeed vector from the invariant combustion stoichiometry kernel. Explicit expressions for the throughput are obtained, in terms of incinerator temperature, fluegas heat recuperation ratio and design parameters, for an arbitrary number of wastes, based on fundamental principles (mass and enthalpy balances). The impact of waste variations, of recuperation ratio and of furnace temperature is explicitly determined. It is shown that in the presence of waste uncertainty, the throughput may be a decreasing or increasing function of incinerator temperature and recuperation ratio, depending on the sign of a dimensionless parameter related only to the uncertain wastes. The dimensionless parameter is proposed as a sharp a' priori waste 'fingerprint', determining the necessary increase or decrease of manipulated variables (recuperation ratio, excess air, auxiliary fuel feed rate, auxiliary air flow) in order to balance the HWI and maximize throughput under uncertainty in received wastes. A 10-step procedure is proposed for direct application subject to process capacity constraints. The results may be useful for efficient HWI operation and for preparing hazardous waste blends. Copyright © 2013 Elsevier Ltd. All rights reserved.
Atilio Enrique Liceti Dibos
1993-01-01
Resumo: O efeito da temperatura de extrusão e do teor de proteína da farinha de soja desengordurada (FSD) na qualidade tecnologica e nutricional do macarrão instantâneo de arroz foi estudado. Farinha de arroz foi misturada com vários níveis de FSD para se obterem teores de proteína de 15, 20 e 25%. A matéria-prima com os diversos níveis de proteína foi processada num extrusor de rosca única às temperaturas de 80, 100 e 120°C. O macarrão foi submetido aos vários testes tecnológicos para avalia...
INTRA-RATER RELIABILITY OF WII BALANCE BOARD (WBB IN ASSESSING STANDING BALANCE IN OLDER ADULTS
Directory of Open Access Journals (Sweden)
Shilpa Dugani Burji
2014-06-01
Full Text Available Background: WII Balance Board (WBB being one of the latest, advanced technologies of high sensitivity in monitoring change in balance over time and owing to, ease of use, and portability, it is being used in physical therapy clinics as a popular substitute for the expensive and complicated force plates to improve dynamic strength and balance. Despite its growing popularity, the WBB’s reliability as an intervention and assessment tool for balance is still being investigated. So this study aims in finding the accuracy of WBB. The objectives of the study are to find the Intraclass Correlation Coefficient and Standard Error Measurement on both day 1 and day 2 with eyes closed and eyes open in older adults. Method: 30 subjects over the age of 65 years were assessed for balance using WBB. Subjects were measured in double limb stance with eyes open and closed with feet comfortably distant apart on the board. The same procedure was repeated after 24 hours. Results: The study showed to be statistically significant for eyes open on day 1 and day 2, but was not statistically significant for eyes closed on day 1 and day 2. Conclusion: The study suggested that the WBB was reliable for eyes open and not reliable with eyes closed.
DEFF Research Database (Denmark)
Kluth, Michael Friederich; Pilegaard, Jess
2011-01-01
The present article seeks to make sense of recent European Union (EU) naval capability changes by applying neo-realist theory to the EU as a collective actor in the global balance of power. The paper compares two different strands of neorealist theory by deducing key predictions about the expecte......-term balancing strategy aimed at bolstering the autonomy and international influence of the Union vis-a`-vis other major powers, including the USA....
Balancing guava nutrition with liming and fertilization
Directory of Open Access Journals (Sweden)
Amanda Hernandes
2012-12-01
Full Text Available Guava response to liming and fertilization can be monitored by tissue testing. Tissue nutrient signature is often diagnosed against nutrient concentration standards. However, this approach has been criticized for not considering nutrient interactions and to generate numerical biases as a result of data redundancy, scale dependency and non-normal distribution. Techniques of compositional data analysis can control those biases by balancing groups of nutrients, such as those involved in liming and fertilization. The sequentially arranged and orthonormal isometric log ratios (ilr or balances avoid numerical bias inherent to compositional data. The objectives were to relate tissue nutrient balances with the production of "Paluma" guava orchards differentially limed and fertilized, and to adjust the current patterns of nutrient balance with the range of more productive guava trees. It was conducted one experiment of 7-yr of liming and three experiments of 3-yr with N, P and K trials in 'Paluma' orchards on an Oxisol. Plant N, P, K, Ca and Mg were monitored yearly. It was selected the [N, P, K | Ca, Mg], [N, P | K], [N | P] and [Ca | Mg] balances to set apart the effects of liming (Ca-Mg and fertilizers (N-K on macronutrient balances. Liming largely influenced nutrient balances of guava in the Oxisol while fertilization was less influential. The large range of guava yields and nutrient balances allowed defining balance ranges and comparing them with the critical ranges of nutrient concentration values currently used in Brazil and combined into ilr coordinates.
DEFF Research Database (Denmark)
Strøm, Mark; Thorborg, Kristian; Bandholm, Thomas
2016-01-01
(MVC), and in addition amplitude probability distribution function (APDF) between 90 and 10% was calculated as a measure of muscle activation variability. RESULTS: Balancing on BOSU® Ball and wobble board generally resulted in increased ankle kinematic and muscle activity variables, compared......BACKGROUND: A lateral ankle sprain is the most prevalent musculoskeletal injury in sports. Exercises that aim to improve balance are a standard part of the ankle rehabilitation process. In an optimal progression model for ankle rehabilitation and prevention of future ankle sprains, it is important...... to characterize different balance exercises based on level of difficulty and sensori-motor training stimulus. PURPOSE: The purpose of this study was to investigate frontal-plane ankle kinematics and associated peroneal muscle activity during single-legged balance on stable surface (floor) and three commonly used...
Multi-TSO cross border balancing mechanism
Energy Technology Data Exchange (ETDEWEB)
Llorens, Maria Luisa; Moreno, Laura; Fuente, Jose Ignacio de la; Junco, Paula; Arenillas, Jorge [Red Electrica de Espana (REE) S.A.U., Madrid (Spain). Operation Markets Dept.; Pereira, Pedro [REN - Servicos, S.A., Lisbon (Portugal). Gabinete Mercado e Liquidacoes; Chabanne, Colas [RTE Reseau de Transport d' Electricite, Paris (France). Markets Dept.; Apoyan, Lalake; Barbieri, Galileo [RTE Reseau de Transport d' Electricite, Paris (France). Cross-Border Market Design
2012-07-01
The balancing market integration has been highlighted as a necessary step to reach the European Union goal for the development of an effective, competitive single market for electricity across Europe. In this paper it is described the work done by RTE, REE and REN regarding the design of a non-discriminatory, efficient and reliable multi-TSO Cross Border Balancing Mechanism at regional level, extendible to other control areas. The implementation of this multi-TSO Cross Border Balancing Mechanism will aim at increasing the operational security, enhancing the Liquidity and Competition of balancing markets, facilitating the integration of energy produced by Renewable Energy Sources while optimizing the use of Interconnection capacities. With this mechanism, the three TSOs will be able to exchange to each other balancing energy through the available interconnection capacities after the last intraday market sessions. This mechanism will be based on a common IT platform where TSOs will share their available surplus of reserves and communicate their balancing needs. The available interconnection capacities will be taken into account in an automatic and centralized way. Two main options are investigated regarding the allocation method: on the one hand, the first come first served approach (FCFS), on the other hand, the ''social welfare'' optimization approach. (orig.)
H∞ Balancing for Nonlinear Systems
Scherpen, Jacquelien M.A.
1996-01-01
In previously obtained balancing methods for nonlinear systems a past and a future energy function are used to bring the nonlinear system in balanced form. By considering a different pair of past and future energy functions that are related to the H∞ control problem for nonlinear systems we define
Circuit-Adaptive Challenge Balancing in Racing Games
Rietveld, A.; Bakkes, S.; Roijers, D.
2014-01-01
In this paper, we propose a novel approach to challenge balancing in racing games: circuit-adaptive challenge balancing. We propose to automatically adapt the actual racing circuit - while it is being played - such that the performed circuit adaptations intelligently balance the challenge for all
Holmes, Jeffrey D; Jenkins, Mary E; Johnson, Andrew M; Hunt, Michael A; Clark, Ross A
2013-04-01
Impaired postural stability places individuals with Parkinson's at an increased risk for falls. Given the high incidence of fall-related injuries within this population, ongoing assessment of postural stability is important. To evaluate the validity of the Nintendo Wii(®) balance board as a measurement tool for the assessment of postural stability in individuals with Parkinson's. Twenty individuals with Parkinson's participated. Subjects completed testing on two balance tasks with eyes open and closed on a Wii(®) balance board and biomechanical force platform. Bland-Altman plots and a two-way, random-effects, single measure intraclass correlation coefficient model were used to assess concurrent validity of centre-of-pressure data. Concurrent validity was demonstrated to be excellent across balance tasks (intraclass correlation coefficients = 0.96, 0.98, 0.92, 0.94). This study suggests that the Wii(®) balance board is a valid tool for the quantification of postural stability among individuals with Parkinson's.
Research concerning the balancing of a plane mechanism
Bădoiu, D.; Petrescu, M. G.; Antonescu, N. N.; Toma, G.
2018-01-01
By statically balancing of the plane mechanisms and especially those functioning at high speeds is being pursued the decrease of the value of the resultant force of all inertia forces that work on the component elements, thus obtaining a significant decrease in vibrations and shocks during the functioning. On the other hand, the existence of balancing masses which ensure the balancing of the mechanism leads to increased gauge and its mass. In this paper are presented some possibilities of statically balancing a plane mechanism which is composed of three independent contours. First is analyzed the case when the mechanism is totally balanced. Then a solution is proposed for a partial balancing of the mechanism based on the balancing of the first harmonic of the inertia force developed in a piston of the mechanism. Finally, are presented some simulation results concerning the variation of the value of the resultant inertia force during a cinematic cycle when the mechanism is unbalanced and when it is partially balanced. Also, it is analyzed the variation of the motor moment when the mechanism is unbalanced and when is totally and partially balanced.
Reframing our pursuit of life balance.
Fuentes, David G; Ogden, Rachel R; Ryan-Haddad, Ann; Strang, Aimee F
2015-04-25
During our time in the 2013 Academic Leadership Fellows Program, we explored what it takes to achieve life balance through a framework presented in a Harvard Business Review article. In this Statement, we describe 5 different areas from the article that provide infrastructure for reflecting on how we have learned to approach life balance in academia. We also provide brief messages based on this reading and others to help academics' pursuit of life balance.
Reframing Our Pursuit of Life Balance
Fuentes, David G.; Ogden, Rachel R.; Ryan-Haddad, Ann; Strang, Aimee F.
2015-01-01
During our time in the 2013 Academic Leadership Fellows Program, we explored what it takes to achieve life balance through a framework presented in a Harvard Business Review article. In this Statement, we describe 5 different areas from the article that provide infrastructure for reflecting on how we have learned to approach life balance in academia. We also provide brief messages based on this reading and others to help academics’ pursuit of life balance.
MR fingerprinting for rapid quantification of myocardial T1 , T2 , and proton spin density.
Hamilton, Jesse I; Jiang, Yun; Chen, Yong; Ma, Dan; Lo, Wei-Ching; Griswold, Mark; Seiberlich, Nicole
2017-04-01
To introduce a two-dimensional MR fingerprinting (MRF) technique for quantification of T 1 , T 2 , and M 0 in myocardium. An electrocardiograph-triggered MRF method is introduced for mapping myocardial T 1 , T 2 , and M 0 during a single breath-hold in as short as four heartbeats. The pulse sequence uses variable flip angles, repetition times, inversion recovery times, and T 2 preparation dephasing times. A dictionary of possible signal evolutions is simulated for each scan that incorporates the subject's unique variations in heart rate. Aspects of the sequence design were explored in simulations, and the accuracy and precision of cardiac MRF were assessed in a phantom study. In vivo imaging was performed at 3 Tesla in 11 volunteers to generate native parametric maps. T 1 and T 2 measurements from the proposed cardiac MRF sequence correlated well with standard spin echo measurements in the phantom study (R 2 > 0.99). A Bland-Altman analysis revealed good agreement for myocardial T 1 measurements between MRF and MOLLI (bias 1 ms, 95% limits of agreement -72 to 72 ms) and T 2 measurements between MRF and T 2 -prepared balanced steady-state free precession (bias, -2.6 ms; 95% limits of agreement, -8.5 to 3.3 ms). MRF can provide quantitative single slice T 1 , T 2 , and M 0 maps in the heart within a single breath-hold. Magn Reson Med 77:1446-1458, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.
(CCL), Center for Creative Leadership; Patterson, Gordon
2011-01-01
Balance isn't an issue of time, but an issue of choice. It's about living your values by aligning your behavior with what you believe is really important. Aligning your behavior with your values is much like any other developmental experience; the basic process involves assessment, challenge, and support. You need to determine where you are, define where you want to go, and then put into place the tools you need to get there.Balance is about more than how you spend your time. It's about how you live your life. It's about recognizing that you have control over the choices you make and aligning
Power balance on a multibeam laser
Sampat, S.; Kelly, J. H.; Kosc, T. Z.; Rigatti, A. L.; Kwiatkowski, J.; Donaldson, W. R.; Romanofsky, M. H.; Waxer, L. J.; Dean, R.; Moshier, R.
2018-02-01
Inertial confinement fusion (ICF) cryogenic experiments on the 60-beam OMEGA laser have strict requirements for the laser energy delivered on target to be power balanced in order to maximize target-irradiation uniformity. For OMEGA, this quantity (power balance) is inferred from measurements of the time-integrated energy and time-resolved, spatially integrated temporal profile of each of the 60 beams at the output of the laser. The work presented here proposes a general definition of power balance as measured at the laser output and discusses the conditions that are fundamental to achieving laser power balance. Power balance necessitates equal gain across all stages of amplification, equal net losses across each amplifier stage, equal frequency conversion (from 1053 nm to 351 nm) of all 60 beams, and equal beam path lengths (beam timing). Typical OMEGA ICF laser pulse shapes consist of one or more short (100-ps) "pickets" followed by a shaped "drive" pulse of 1 to 2 ns. For these experiments, power balance is assessed for the pickets and the drive independently, with the ultimate goal of achieving root-mean-square (rms) imbalance across all 60 beams of less than 2% rms on both. This work presents a comprehensive summary of laser shot campaigns conducted to significantly improve laser power balance from typical rms values of 4.7% and 5.2%, respectively, to the 3% level for both features along with a discussion of future work required to further reduce the rms power imbalance of the laser system.
Optical properties of supported core-shell and alloy silver/gold nanoparticles
Energy Technology Data Exchange (ETDEWEB)
Hubenthal, Frank; Traeger, Frank [Universitaet Kassel (Germany)
2008-07-01
For many applications like surface enhanced Raman scattering in which the optical field enhancement associated with surface plasmon excitation is exploited, tunability of this collective resonance over a wide range is required. For this purpose we have prepared core-shell and alloy nanoparticles consisting of Ag and Au. The core-shell nanoparticles were made by subsequent deposition of Ag and Au atoms and vice versa on dielectric substrates followed by diffusion and nucleation. One of the most interesting among the numerous results is that the plasmon frequency can be tuned from 2.8 eV (442 nm) to 2.1 eV (590 nm) depending on the Au shell thickness. Subsequent annealing of the core-shell nanoparticles causes a shift of the resonance frequency to 2.6 eV. Theoretical modelling allows us to attribute this observation to the formation of alloy nanoparticles. Finally, we have measured the dephasing time T{sub 2} of the alloy nanoparticles by means of spectral hole burning. T{sub 2} amounts to 8.1{+-}1.6 fs, in good agreement with the dephasing time T{sub 2}=8.9 fs that is included in the dielectric function of the bulk.
Effect of Somatosensory Impairments on Balance Control
Directory of Open Access Journals (Sweden)
Alireza Hassanpour
2012-10-01
Full Text Available Background and Aim: The somatosensory system is one of the most effective systems in balance control. It consists of peripheral and central components. Knowing the role of these components in balance control assists the developing of effective rehabilitation protocols. In some diseases peripheral components and in others central components are impaired. This paper reviews the effect of impairment of peripheral and central components of the somatosensory system on balance control.Methods: In this study publication about somatosensory impairments from 1983 through 2011 in PubMed, Scopus, ProQuest, Google Scholar, Iran Medex, Iran Doc and Magiran were reviewed. Medical subject headings terms and keywords related to balance, somatosensory, somatosensory loss, and sensory integration/processing were used to perform the searches.Conclusion: Somatosensory impairments either with peripheral or central origin, can cause problems in balance control. However, these problems are not considered in some patients. In these impairments, balance training is recommended to be used alongside other routine treatments in the patients' rehabilitation programs.
Balance Performance Is Task Specific in Older Adults
Directory of Open Access Journals (Sweden)
Ayelet Dunsky
2017-01-01
Full Text Available Balance ability among the elderly is a key component in the activities of daily living and is divided into two types: static and dynamic. For clinicians who wish to assess the risk of falling among their elderly patients, it is unclear if more than one type of balance test can be used to measure their balance impairment. In this study, we examined the association between static balance measures and two dynamic balance field tests. One hundred and twelve community-dwelling older adults (mean age 74.6 participated in the study. They underwent the Tetrax static postural assessment and then performed the Timed Up and Go (TUG and the Functional Reach (FR Test as dynamic balance tests. In general, low-moderate correlations were found between the two types of balance tests. For women, age and static balance parameters explained 28.1–40.4% of the variance of TUG scores and 14.6–24% of the variance of FR scores. For men, age and static balance parameters explained 9.5–31.2% of the variance of TUG scores and 23.9–41.7% of the variance of FR scores. Based on our findings, it is suggested that a combination of both static and dynamic tests be used for assessing postural balance ability.
Prevalence and risk factors for female sexual dysfunction among Egyptian women.
Ibrahim, Zakia Mahdy; Ahmed, Magdy Refaat; Sayed Ahmed, Waleed Ali
2013-06-01
To assess sexual function among married women and determine associated risk factors for sexual dysfunction. Cross-sectional hospital-based study involving 509 non-pregnant married females 20-59 years old who were enrolled into the study after approval of the ethics committee. The study population was recruited among women attending gynecology outpatient clinic or their relatives visiting inpatients of obstetrics and gynecology department at Suez Canal University Hospital. Female and male partner-related data were collected using an interview questionnaire. Sexual dysfunction was assessed using female sexual function index (FSFI). Mean female age was 39.5 years. About half of the participants were premenopausal (48.7 %). Most of the females were circumcised (71.7 %). Desire and Orgasm domains were the most affected with 52.8 % of the participants having sexual dysfunction. Total FSFI score of ≤26.55 was the cutoff value for diagnosis of FSD and female age, postmenopausal status, duration of marriage, circumcision, partner's age, and the presence of male sexual dysfunction were found to be significant associated factors with FSD. FSD is highly prevalent in Egypt and orgasm and desire scores were the most affected domains. Several personal (female age, postmenopausal status, duration of marriage and circumcision) and male partner (age, and the presence of sexual dysfunction) factors were significantly associated.
Konak, H E; Kibar, S; Ergin, E S
2016-11-01
Osteoporosis is a serious disease characterized by muscle weakness in the lower extremities, shortened length of trunk, and increased dorsal kyphosis leading to poor balance performance. Although balance impairment increases in adults with osteoporosis, falls and fall-related injuries have been shown to occur mainly during the dual-task performance. Several studies have shown that dual-task performance was improved with specific repetitive dual-task exercises. The aims of this study were to compare the effect of single- and dual-task balance exercise programs on static balance, dynamic balance, and activity-specific balance confidence in adults with osteoporosis and to assess the effectiveness of dual-task balance training on gait speed under dual-task conditions. Older adults (N = 42) (age range, 45-88 years) with osteoporosis were randomly assigned into two groups. Single-task balance training group was given single-task balance exercises for 4 weeks, whereas dual-task balance training group received dual-task balance exercises. Participants received 45-min individualized training session, three times a week. Static balance was evaluated by one-leg stance (OLS) and a kinesthetic ability trainer (KAT) device. Dynamic balance was measured by the Berg Balance Scale (BBS), Time Up and Go (TUG) test, and gait speed. Self-confidence was assessed with the Activities-specific Balance Confidence (ABC-6) scale. Assessments were performed at baseline and after the 4-week program. At the end of the treatment periods, KAT score, BBS score, time in OLS and TUG, gait speeds under single- and dual-task conditions, and ABC-6 scale scores improved significantly in all patients (p gait speeds under single- and dual-task conditions showed significantly greater improvement in the dual-task balance training group than in the single-task balance training group (p gait speeds showed greater improvement following the application of a specific type of dual-task exercise programs
Directory of Open Access Journals (Sweden)
Megahed, Mohamed G.
1999-08-01
Full Text Available A simple method for the preparation of sucrose esters, from fatty acids and the least expensive sucrose, has been conducted. Fatty acids namely lauric, palmitic and oleic were used in their preparation in the absence of any organic solvent. Reasonable yields amounting to 86.5%, 87.3% and 88.6% for sucrose esters of laurate, palmitate and oleate were obtained, respectively. The products were evaluated for their hydrophile-lipophile balance (HLB, surface and interfacial tension properties as well as emulsion stability. The results showed that these sucrose esters exhibit similar properties as those of the commercially prepared compounds.
Se ha llevado a cabo un método simple para la preparación de ésteres de sacarosa a partir de ácidos grasos y sacarosa de bajo coste. Se han usado ácidos laurico, palmítico y oleico en su preparación, en ausencia de solventes orgánicos. Se obtuvieron rendimientos aceptables del 86.5%, 87.3% y 88.6% para los ásteres del láurico, palmítico y oleico respectivamente. En los productos se evaluaron sus balances hidrófilo-lipófilo (HLB, sus propiedades de tensión superficial e interfacial así como su estabilidad en emulsiones. Los resultados mostraron que estos esteres de sacarosa exhiben propiedades similares a las de los compuestos preparados comercialmente.
Balance perturbation system to improve balance compensatory responses during walking in old persons
Shapiro, Amir; Melzer, Itshak
2010-01-01
Abstract Ageing commonly disrupts the balance control and compensatory postural responses that contribute to maintaining balance and preventing falls during perturbation of posture. This can lead to increased risk of falling in old adults (65 years old and over). Therefore, improving compensatory postural responses during walking is one of the goals in fall prevention programs. Training is often used to achieve this goal. Most fall prevention programs are usually directed towards improving vo...
Development of a Common Nordic Balance Settlement
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-02-15
NordREG finds it essential for the customers that a common integrated end-user electricity market is developed and that all end-users are able to take part in the Nordic market. A common Nordic balance settlement is one important part of such a change. However, attention has to be paid to the comments that a badly designed common system is worse than well-designed national systems. It is thus important that the change to a common balance settlement is so thoroughly investigated that the common system gives a basis for a well-functioning market. An important basis for such a change is an agreed vision for the process: The present different systems for balance settlement shall by the year 2010 be replaced by a common Nordic balance settlement. This means that: It will be possible for a supplier to sell to the whole Nordic market from one legal entity and using only one system for customer management and reporting. The common Nordic balance settlement will be designed in such a way that it contributes to a well functioning market. This means for example that it will be attractive even for small suppliers and some end-users to be balance responsible parties. It is feasible that the first phase is focused on those present differences that are most decisive for fulfilment of the vision. NordREG recommends that the following issues shall be discussed and agreed in co-operation between NordREG, Nordel and relevant stakeholders in the first phase: The definition shall include how the common Nordic balance settlement shall interact with the balance control and the balance regulation of the interconnected power system and the balance settlement between countries performed by the TSOs. The definition should include the cost-base for common Nordic balance settlement in relation to other system responsibility costs. The core activities of system responsibility have also been analyzed by NordREG. It is important to find a balance between inter alia the need for simplicity and the
Development of a Common Nordic Balance Settlement
International Nuclear Information System (INIS)
2006-02-01
NordREG finds it essential for the customers that a common integrated end-user electricity market is developed and that all end-users are able to take part in the Nordic market. A common Nordic balance settlement is one important part of such a change. However, attention has to be paid to the comments that a badly designed common system is worse than well-designed national systems. It is thus important that the change to a common balance settlement is so thoroughly investigated that the common system gives a basis for a well-functioning market. An important basis for such a change is an agreed vision for the process: The present different systems for balance settlement shall by the year 2010 be replaced by a common Nordic balance settlement. This means that: It will be possible for a supplier to sell to the whole Nordic market from one legal entity and using only one system for customer management and reporting. The common Nordic balance settlement will be designed in such a way that it contributes to a well functioning market. This means for example that it will be attractive even for small suppliers and some end-users to be balance responsible parties. It is feasible that the first phase is focused on those present differences that are most decisive for fulfilment of the vision. NordREG recommends that the following issues shall be discussed and agreed in co-operation between NordREG, Nordel and relevant stakeholders in the first phase: The definition shall include how the common Nordic balance settlement shall interact with the balance control and the balance regulation of the interconnected power system and the balance settlement between countries performed by the TSOs. The definition should include the cost-base for common Nordic balance settlement in relation to other system responsibility costs. The core activities of system responsibility have also been analyzed by NordREG. It is important to find a balance between inter alia the need for simplicity and the
Balance equations for a relativistic plasma. Pt. 1
International Nuclear Information System (INIS)
Hebenstreit, H.
1983-01-01
Relativistic power moments of the four-momentum are decomposed according to a macroscopic four-velocity. The thus obtained quantities are identified as relativistic generalization of the nonrelativistic orthogonal moments, e.g. diffusion flow, heat flow, pressure, etc. From the relativistic Boltzmann equation we then derive balance equations for these quantities. Explicit expressions for the relativistic mass conservation, energy balance, pressure balance, heat flow balance are presented. The weak relativistic limit is discussed. The derivation of higher order balance equations is sketched. (orig.)
Directory of Open Access Journals (Sweden)
Šlekys Deividas
2017-12-01
Full Text Available Since regaining independence in 1990 and creating its regular armed forces, Lithuania has had to do a balancing act. It has had to balance between different approaches of state defence, military structure, collective and national defence. Due to events in Ukraine Lithuania had to reconfigure this balance. The Russian threat forced to emphasize strategy of territorial defence, which altogether required tying up forces and enlarging its numbers by bringing back conscription, substantially increased defence budget, followed by higher tempo and scale in procurement and training. However, Lithuania has managed to maintain its activity and participation in international military operations and political initiatives. Its recent contributions have led to an assumption that its participation in various military missions in the future will not diminish, quite the opposite. Increasing the framework of cooperation in terms of defence and security initiatives will involve Lithuania more deeply and will require further contributions.
17 CFR 210.6-04 - Balance sheets.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Balance sheets. 210.6-04... sheets. This rule is applicable to balance sheets filed by registered investment companies except for... of this part. Balance sheets filed under this rule shall comply with the following provisions: Assets...
Biofeedback-Based, Videogame Balance Training in Autism
Travers, Brittany G.; Mason, Andrea H.; Mrotek, Leigh Ann; Ellertson, Anthony; Dean, Douglas C., III; Engel, Courtney; Gomez, Andres; Dadalko, Olga I.; McLaughlin, Kristine
2018-01-01
The present study examined the effects of a visual-based biofeedback training on improving balance challenges in autism spectrum disorder (ASD). Twenty-nine youth with ASD (7-17 years) completed an intensive 6-week biofeedback-based videogame balance training. Participants exhibited training-related balance improvements that significantly…
The preparation and measurement of activity for 57Co standard solution
International Nuclear Information System (INIS)
Yang Jingxia; Yu Yiguang; Du Hongshan; Chen Xilin
1994-12-01
In the preparation of 57 Co, the reactions of 56 Fe (d, n) 57 Co and 56 Fe(d,2n) 57 Co were selected by using 8.7 MeV deuteron to radiate natural iron which was electroplated on copper target. The methods of TBP-Benzene extraction and cation exchange were used for separating and purifying 57 Co. The purity of the solution was checked by HPGe γ spectrometer and the total contents of γ impurities were below 0.2%. To prepare the source, silicon gel suspension was electrosprayed on VYNS thin film which was metallized by gold to form a proper source pad. Weighing balance was used to quantitatively prepare the sources. Research on the effects of the working gas pressure and the working voltage on the plateau curve was carried on by the pressurized 4 πβ-γ coincidence equipment. Finally, efficiency extrapolation method was used to accurately measure the specific activity of 57 Co solution by means of changing the discrimination threshold. The total uncertainty is about 1.2%(3σ) . It is shown that the solution is uniform, stable and accuracy with the reliable specific activity through the domestic comparison. (6 figs.; 6 tabs.)
BALANCER: A Computer Program for Balancing Chemical Equations.
Jones, R. David; Schwab, A. Paul
1989-01-01
Describes the theory and operation of a computer program which was written to balance chemical equations. Software consists of a compiled file of 46K for use under MS-DOS 2.0 or later on IBM PC or compatible computers. Additional specifications of courseware and availability information are included. (Author/RT)
Work - life balance u studentů
Fesslová, Tereza Anežka
2017-01-01
This bachelor thesis is focused on the importance of work-life balance, which means balance between work and life. The aim of this thesis is to find out current status of satisfaction with work-life balance for students of universities. In the theoretical part is explained the concept of work-life balance and another concepts related to this topic. The focus is drawn on four individual parts of human life, where people must be able to allocate their time. The practical part is devoted to char...
Experiments with a cryogenic torsion balance
International Nuclear Information System (INIS)
Newman, R.D.
1983-01-01
The torsion balance is a remarkably capable instrument for the measurement of slowly varying exceedingly small forces; indeed its potential abilities are still largely untapped. The author outlines some of the virtues (and limitations) of the torsion balance, and presents a menu of gravitation-related experiments to which it may be applied. He discusses plans for developing torsion balances operating at cryogenic temperatures, and describes an experiment to search for anomalous long-range interactions associated with intrinsic spin. (Auth.)
Work-Life-Balance in der Unternehmenspraxis
Beile, Judith; Jahnz, Sebastian
2007-01-01
Um die Frage zu beantworten, welche Maßnahmen einer Work-Life-Balance von Unternehmen im einzelnen umgesetzt werden, berichten die Autoren aus einschlägigen Studien der Hertie-Stiftung, des Instituts der deutschen Wirtschaft und einer eigenen Unternehmensbefragung. Sie skizzieren zunächst die Ziele, Chancen und Risiken von Work-Life-Balance als Personal- und Führungskonzept sowie als Wettbewerbsstrategie. Sie erörtern ferner die Frage, ob durch die Implementation von Work-Life-Balance bestehe...
Hafström, Anna; Malmström, Eva-Maj; Terdèn, Josefine; Fransson, Per-Anders; Magnusson, Måns
2016-01-01
Objective: To develop and assess the efficacy of a multimodal balance-enhancing exercise program (BEEP) designed to be regularly self-administered by community-dwelling elderly. The program aims to promote sensory reweighting, facilitate motor control, improve gaze stabilization, and stimulate continuous improvement by being constantly challenging. Method: Forty participants aged 60 to 80 years performed 6 weeks of BEEP training, on average for 16 min four times weekly, in a randomized one-arm crossover design. Results: One-leg standing time improved 32% with eyes open (EO), 206% with eyes closed (EC) on solid surface, and 54% EO on compliant surface (p balance improvements when perturbed on solid and compliant surfaces with EO and EC (p ≤ .033). Walking, step stool, and Timed Up and Go speeds increased (p ≤ .001), as did scores in Berg Balance and balance confidence scales (p ≤ .018). Discussion: Multimodal balance exercises offer an efficient, cost-effective way to improve balance control and confidence in elderly. PMID:28138495
Warren, Tracey
2017-01-01
This chapter provides an overview of the relative roles played by time and money in debates around work-life balance. It shows how time trumps money in dominant understandings of what ‘work-life’ means and in what parts of our lives are presumed to be in need of balance. Working ‘too many’ hours is seen to be the major challenge for achieving a work-life balance. This is an incomplete account. It is largely about the work-lives of the middle classes and it neglects the priorities of working c...
49 CFR 1243.2 - Condensed balance sheet.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Condensed balance sheet. 1243.2 Section 1243.2... § 1243.2 Condensed balance sheet. Commencing with reports for the 3 months beginning January 1, 1972, and... hereby, required to compile and file quarterly reports of balance sheet items in accordance with...
Forum shopping for ex-post gas-balancing services
International Nuclear Information System (INIS)
Keyaerts, Nico; D'haeseleer, William
2014-01-01
The patchwork of different imbalance-settlement rules in geographically adjacent gas regions induces shippers to go “forum shopping” to minimize costs of ex-post balancing services. This shopping increases efficiency, and thus welfare of the shippers, on the one hand. The impact on net efficiency is dependent on the relative incentives provided by different balancing mechanisms and the relative system-balancing costs that the transmission-system operators face to offer balancing services to unbalanced shippers, on the other hand. If the gas-balancing mechanism and the system-balancing costs are aligned, net efficiency in the combined gas system will rise. Our results demonstrate that such an outcome is not guaranteed. Hence, market integration without properly checking compatibility of balancing rules can improve shipper efficiency at the cost of reducing overall efficiency. The latter outcome should clearly be avoided by policy makers and European regulators whose primary concern should be overall efficiency as this provides fair and efficient prices for gas consumers and a higher utility for society. - Highlights: • Transnational gas-shipper activity increases shipper profit. • Balancing rules in multi-region gas markets are not always compatible. • Regional TSOs balance less efficiently if wrong incentives are provided. • Net efficiency is dependent on cost reflection of relative imbalance tariffs
WORK / LIFE BALANCE REFLECTIONS ON EMPLOYEE SATISFACTION
Directory of Open Access Journals (Sweden)
Selvarani
2011-03-01
Full Text Available The aim of this research is to analyze the relationship between employee satisfaction andwork/life balance. The construct used for this research consists of career opportunity, recognition,work tasks, payments, benefits, superior subordinate relationship, employee satisfaction, andwork/life balance. The study was conducted on a total of 210 respondents working in IT organization.This study makes a contribution to join two distinct research streams, namely employee satisfaction,and work/life balance. Findings suggest that high correlation exists between work task and employeesatisfaction with a mediator variable namely work-life balance.
17 CFR 210.5-02 - Balance sheets.
2010-04-01
... customers at the date of the balance sheet. Include a general description of the prerequisites for billing... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Balance sheets. 210.5-02... Balance sheets. The purpose of this rule is to indicate the various line items and certain additional...
Use of the Microsoft Kinect system to characterize balance ability during balance training.
Lim, Dohyung; Kim, ChoongYeon; Jung, HoHyun; Jung, Dukyoung; Chun, Keyoung Jin
2015-01-01
The risk of falling increases significantly in the elderly because of deterioration of the neural musculature regulatory mechanisms. Several studies have investigated methods of preventing falling using real-time systems to evaluate balance; however, it is difficult to monitor the results of such characterizations in real time. Herein, we describe the use of Microsoft's Kinect depth sensor system to evaluate balance in real time. Six healthy male adults (25.5±1.8 years, 173.9±6.4 cm, 71.4±6.5 kg, and 23.6±2.4 kg/m(2)), with normal balance abilities and with no musculoskeletal disorders, were selected to participate in the experiment. Movements of the participants were induced by controlling the base plane of the balance training equipment in various directions. The dynamic motion of the subjects was measured using two Kinect depth sensor systems and a three-dimensional motion capture system with eight infrared cameras. The two systems yielded similar results for changes in the center of body mass (P>0.05) with a large Pearson's correlation coefficient of γ>0.60. The results for the two systems showed similarity in the mean lower-limb joint angle with flexion-extension movements, and these values were highly correlated (hip joint: within approximately 4.6°; knee joint: within approximately 8.4°) (0.400.05). Large differences with a low correlation were, however, observed for the lower-limb joint angle in relation to abduction-adduction and internal-external rotation motion (γ<0.40) (P<0.05). These findings show that clinical and dynamic accuracy can be achieved using the Kinect system in balance training by measuring changes in the center of body mass and flexion-extension movements of the lower limbs, but not abduction-adduction and internal-external rotation.
Work-home Balance: a Management Perspective
Farrell, Kathleen
2012-01-01
Work-home balance issues have become a very important challenge for both management and employees in the 21st century. The purpose of this paper is to examine work-home balance practices from a management perspective in the Irish hotel industry. There is a dearth of research in relation to work-home balance practices in the hotel sector. The study included a sample of all hotels including Northern Ireland. It found that the needs of the organisation are paramount with profitability considerat...
Synaptic E-I Balance Underlies Efficient Neural Coding.
Zhou, Shanglin; Yu, Yuguo
2018-01-01
Both theoretical and experimental evidence indicate that synaptic excitation and inhibition in the cerebral cortex are well-balanced during the resting state and sensory processing. Here, we briefly summarize the evidence for how neural circuits are adjusted to achieve this balance. Then, we discuss how such excitatory and inhibitory balance shapes stimulus representation and information propagation, two basic functions of neural coding. We also point out the benefit of adopting such a balance during neural coding. We conclude that excitatory and inhibitory balance may be a fundamental mechanism underlying efficient coding.
Cho, Be-long; Scarpace, Diane; Alexander, Neil B
2004-07-01
To determine the relationships between two tests of stepping ability (the maximal step length (MSL) and rapid step test (RST)) and standard tests of standing balance, gait, mobility, and functional impairment in a group of at-risk older adults. Cross-sectional study. University-based laboratory. One hundred sixty-seven mildly balance-impaired older adults recruited for a balance-training and fall-reduction program (mean age 78, range 65-90). Measures of stepping maximally (MSL, the ability to maximally step out and return to the initial position) and rapidly (RST, the time taken to step out and return in multiple directions as fast as possible); standard measures of balance, gait, and mobility including timed tandem stance (TS), tandem walk (TW, both timing and errors), timed unipedal stance (US), timed up and go (TUG), performance oriented mobility assessment (POMA), and 6-minute walk (SMW); measures of leg strength (peak knee and ankle torque and power at slow and fast speeds); self-report measures of frequent falls (>2 per 12 months), disability (Established Population for Epidemiologic Studies of the Elderly (EPESE) physical function), and confidence to avoid falls (Activity-specific Balance Confidence (ABC) Scale). Spearman and Pearson correlation, intraclass correlation coefficient, logistic regression, and linear regression were used for data analysis. MSL consistently predicted a number of self-report and performance measures at least as well as other standard balance measures. MSL correlations with EPESE physical function, ABC, TUG, and POMA scores; SMW; and peak maximum knee and ankle torque and power were at least as high as those correlations seen with TS, TW, or US. MSL score was associated with the risk of being a frequent faller. In addition, the six MSL directions were highly correlated (up to 0.96), and any one of the leg directions yielded similar relationships with functional measures and a history of falls. Relationships between RST and these
Ruffieux, Jan; Mouthon, Audrey; Keller, Martin; Mouthon, Michaël; Annoni, Jean-Marie; Taube, Wolfgang
2018-01-01
Aging is associated with a shift from an automatic to a more cortical postural control strategy, which goes along with deteriorations in postural stability. Although balance training has been shown to effectively counteract these behavioral deteriorations, little is known about the effect of balance training on brain activity during postural tasks in older adults. We, therefore, assessed postural stability and brain activity using fMRI during motor imagery alone (MI) and in combination with action observation (AO; i.e., AO+MI) of a challenging balance task in older adults before and after 5 weeks of balance training. Results showed a nonsignificant trend toward improvements in postural stability after balance training, accompanied by reductions in brain activity during AO+MI of the balance task in areas relevant for postural control, which have been shown to be over-activated in older adults during (simulation of) motor performance, including motor, premotor, and multisensory vestibular areas. This suggests that balance training may reverse the age-related cortical over-activations and lead to changes in the control of upright posture toward the one observed in young adults.
Computer-Simulation of Balance Handling
Massen, C.H.; Swüste, C.H.W.; Robens, E.; Poulis, J.A.
1999-01-01
Several decades ago, when working in the field of magnetism, we had to use a balance the sensitivity of which was limited only by Brownian motion. This balance was a very slow one and to calculate the moment of force measured by it we used its equation of motion, T=Ja+ka+Ca, where we measured the
17 CFR 210.7-03 - Balance sheets.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Balance sheets. 210.7-03... 1940, AND ENERGY POLICY AND CONSERVATION ACT OF 1975 Insurance Companies § 210.7-03 Balance sheets. (a... otherwise permitted by the Commission, should appear on the face of the balance sheets and in the notes...
Preparation and evaluation of buccal bioadhesive films containing clotrimazole.
Singh, S; Jain, S; Muthu, M S; Tiwari, S; Tilak, R
2008-01-01
Buccal bioadhesive films, releasing topical drugs in the oral cavity at a slow and predetermined rate, provide distinct advantages over traditional dosage forms. The aim of present study was to prepare and evaluate buccal bioadhesive films of clotrimazole for oral candidiasis. The film was designed to release the drug at a concentration above the minimum inhibitory concentration for a prolonged period of time so as to reduce the frequency of administration of the available conventional dosage forms. The different proportions of sodium carboxymethylcellulose and carbopol 974P (CP 974P) were used for the preparation of films. Carbopol was used to incorporate the desired bioadhesiveness in the films. The films were prepared by solvent casting method and evaluated for bioadhesion, in vitro drug release and effectiveness against Candida albicans. In vitro drug release from the film was determined using a modified Franz diffusion cell while bioadhesiveness was evaluated with a modified two-arm balance using rabbit intestinal mucosa as a model tissue. Films containing 5% CP 974P of the total polymer were found to be the best with moderate swelling along with favorable bioadhesion force, residence time and in vitro drug release. The microbiological studies revealed that drug released from the film could inhibit the growth of C. albicans for 6 h. The drug release mechanism was found to follow non-Fickian diffusion.
Chan, Andy C M; Ouyang, Xi H; Jehu, Deborah A M; Chung, Raymond C K; Pang, Marco Y C
2018-01-01
Balance deficits are common after total knee arthroplasty (TKA); however the responsiveness of commonly used balance measurement tools has not been well defined. The objective of this prospective study was to compare the internal and external responsiveness of four measurement tools in assessing recovery of balance function following TKA. A total of 134 individuals with TKA (95 women; age: 66.3±6.6years) completed the Balance Evaluation Systems Test (BESTest), Mini-BESTest, Brief-BESTest, and Berg Balance Scale (BBS) at 2, 4, 8, 12, and 24 weeks post-TKA. The Functional Gait Assessment (FGA) served as the anchor measure, and was also measured across these time points. Internal responsiveness was indicated by the standardized response mean (SRM), while external responsiveness was reflected by the degree of association of the changes of balance scores with those of FGA. The SRM ranged from 0.60-1.14 for the BESTest, 0.40-0.94 for the Mini-BESTest, 0.27-0.91 for the Brief-BESTest, and 0.19-0.70 for the BBS, over time. The change in BESTest and Mini-BESTest scores predicted the change in the FGA scores across all time periods, except for the Mini-BESTest between weeks 12-24, accounting for 13-27%, and 12-24% of the variance, respectively. The Brief-BESTest scores only predicted FGA scores between the weeks 2-4 (R 2 =20%). The changes in BBS scores were not associated with the FGA. The BESTest is the most responsive in measuring recovery of balance among individuals with TKA. The Mini-BESTest is a reasonable option during time constraints. Copyright © 2017. Published by Elsevier B.V.
Low cost balancing unit design
Golembiovsky, Matej; Dedek, Jan; Slanina, Zdenek
2017-06-01
This article deals with the design of a low-cost balancing system which consist of battery balancing units, accumulator pack units and coordinator unit with interface for higher level of battery management system. This solution allows decentralized mode of operation and the aim of this work is implementation of controlling and diagnostic mechanism into an electric scooter project realized at Technical university of Ostrava. In todays world which now fully enjoys the prime of electromobility, off-grid battery systems and other, it is important to seek the optimal balance between functionality and the economy side of BMS that being electronics which deals with secondary cells of batery packs. There were numerous sophisticated, but not too practical BMS models in the past, such as centralized system or standalone balance modules of individual cells. This article aims at development of standalone balance modules which are able to communicate with the coordinator, adjust their parameters and ensure their cells safety in case of a communication failure. With the current worldwide cutting cost trend in mind, the emphasis was put on the lowest price possible for individual component. The article is divided into two major categories, the first one being desing of power electronics with emphasis on quality, safety (cooling) and also cost. The second part describes development of a communication interface with reliability and cost in mind. The article contains numerous graphs from practical measurements. The outcome of the work and its possible future is defined in the conclusion.